Closure Report for Corrective Action Unit 107: Low Impact Soil Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

2009-01-01

Corrective Action Unit (CAU) 107 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Low Impact Soil Sites' and consists of the following 15 Corrective Action Sites (CASs), located in Areas 1, 2, 3, 4, 5, 9, 10, and 18 of the Nevada Test Site: CAS 01-23-02, Atmospheric Test Site - High Alt; CAS 02-23-02, Contaminated Areas (2); CAS 02-23-03, Contaminated Berm; CAS 02-23-10, Gourd-Amber Contamination Area; CAS 02-23-11, Sappho Contamination Area; CAS 02-23-12, Scuttle Contamination Area; CAS 03-23-24, Seaweed B Contamination Area; CAS 03-23-27, Adze Contamination Area; CAS 03-23-28, Manzanas Contamination Area; CAS 03-23-29, Truchas-Chamisal Contamination Area; CAS 04-23-02, Atmospheric Test Site T4-a; CAS 05-23-06, Atmospheric Test Site; CAS 09-23-06, Mound of Contaminated Soil; CAS 10-23-04, Atmospheric Test Site M-10; and CAS 18-23-02, U-18d Crater (Sulky). Closure activities were conducted from February through April 2009 according to the FFACO (1996; as amended February 2008) and Revision 1 of the Streamlined Approach for Environmental Restoration Plan for CAU 107 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2009). The corrective action alternatives included No Further Action and Closure in Place with Administrative Controls. Closure activities are summarized.

Lanthanide ions induce hydrolysis of hemoglobin-bound 2,3-diphosphoglycerate (2,3-DPG), conformational changes of globin and bidirectional changes of 2,3-DPG-hemoglobin's oxygen affinity.

Science.gov (United States)

Cheng, Y; Lin, H; Xue, D; Li, R; Wang, K

2001-02-14

The changes in structure and function of 2,3-diphosphoglycerate-hemoglobin (2,3-DPG-Hb) induced by Ln(3+) binding were studied by spectroscopic methods. The binding of lanthanide cations to 2,3-DPG is prior to that to Hb. Ln(3+) binding causes the hydrolysis of either one from the two phosphomonoester bonds in 2,3-DPG non-specifically. The results using the ultrafiltration method indicate that Ln(3+) binding sites for Hb can be classified into three categories: i.e. positive cooperative sites (N(I)), non-cooperative strong sites (N(S)) and non-cooperative weak sites (N(W)) with binding constants in decreasing order: K(I)>K(S)>K(W). The total number of binding sites amounts to about 65 per Hb tetramer. Information on reaction kinetics was obtained from the change of intrinsic fluorescence in Hb monitored by stopped-flow fluorometry. Fluctuation of fluorescence dependent on Ln(3+) concentration and temperature was observed and can be attributed to the successive conformational changes induced by Ln(3+) binding. The results also reveal the bidirectional changes of the oxygen affinity of Hb in the dependence on Ln(3+) concentration. At the range of [Ln(3+)]/[Hb]<2, the marked increase of oxygen affinity (P(50) decrease) with the Ln(3+) concentration can be attributed to the hydrolysis of 2,3-DPG, while the slight rebound of oxygen affinity in higher Ln(3+) concentration can be interpreted by the transition to the T-state of the Hb tetramer induced by Ln(3+) binding. This was indicated by the changes in secondary structure characterized by the decrease of alpha-helix content.

Characterization report for Area 23, Building 650 Leachfield, Corrective Action Unit Number 94, Nevada Test Site. Revision 1

International Nuclear Information System (INIS)

1998-01-01

Corrective Action Unit (CAU) Number 94, Building 650 Leachfield, is an historic laboratory disposal unit located in Area 23 at the Nevada Test Site (NTS) in Nye County, Nevada. The objectives of this project were twofold: characterize subsurface conditions at the CAU with respect to the on-site disposal unit, and provide sufficient information to develop a closure strategy for the leachfield. To this end, subsurface sampling was conducted in the vicinity of the piping above the distribution box, under and around the distribution box, and within the leachfield

Characterization report for Area 23, Building 650 Leachfield, Corrective Action Unit Number 94, Nevada Test Site. Revision 1

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-01-27

Corrective Action Unit (CAU) Number 94, Building 650 Leachfield, is an historic laboratory disposal unit located in Area 23 at the Nevada Test Site (NTS) in Nye County, Nevada. The objectives of this project were twofold: characterize subsurface conditions at the CAU with respect to the on-site disposal unit, and provide sufficient information to develop a closure strategy for the leachfield. To this end, subsurface sampling was conducted in the vicinity of the piping above the distribution box, under and around the distribution box, and within the leachfield.

Gnome site decontamination and decommissioning project radiation contamination clearance report, March 28, 1979-September 23, 1979

International Nuclear Information System (INIS)

Berry, H.A.

1981-08-01

This report describes the operations and radiological activities conducted during Phase II and Phase III of the Gnome site decontamination and decommissioning (D/D) project in Carlsbad, New Mexico. The onsite radiological monitoring and documentation activities were performed for the Department of Energy, Nevada Operations (DOE/NV) by Reynolds Electrical and Engineering Co., Inc. (REECo) and EG and G, Inc., from March 28, 1979 to September 23, 1979. The monitoring program included soil sampling and analyses, portable instrument area surveys, thermoluminescent dosimeter (TLD) measurements and a post-operational aerial survey to document the final site status and to insure public and occupational health and safety. Although the analysis of data gathered during the final stages of the D/D project will provide the information necessary for DOE to return the Gnome site to the Department of the Interior, Bureau of Land Management (BLM) for unrestricted use of the land surface, there are permanent restrictions on excavation and/or drilling on the site at any depth between the surface and 1500 feet

Surface-site-selective study of valence electronic states of a clean Si(111)-7x7 surface using Si L23VV Auger electron and Si 2p photoelectron coincidence measurements

International Nuclear Information System (INIS)

Kakiuchi, Takuhiro; Tahara, Masashi; Nagaoka, Shin-ichi; Hashimoto, Shogo; Fujita, Narihiko; Tanaka, Masatoshi; Mase, Kazuhiko

2011-01-01

Valence electronic states of a clean Si(111)-7x7 surface are investigated in a surface-site-selective way using high-resolution coincidence measurements of Si pVV Auger electrons and Si 2p photoelectrons. The Si L 23 VV Auger electron spectra measured in coincidence with energy-selected Si 2p photoelectrons show that the valence band at the highest density of states in the vicinity of the rest atoms is shifted by ∼0.95 eV toward the Fermi level (E F ) relative to that in the vicinity of the pedestal atoms (atoms directly bonded to the adatoms). The valence-band maximum in the vicinity of the rest atoms, on the other hand, is shown to be shifted by ∼0.53 eV toward E F relative to that in the vicinity of the pedestal atoms. The Si 2p photoelectron spectra of Si(111)-7x7 measured in coincidence with energy-selected Si L 23 VV Auger electrons identify the topmost surface components, and suggest that the dimers and the rest atoms are negatively charged while the pedestal atoms are positively charged. Furthermore, the Si 2p-Si L 23 VV photoelectron Auger coincidence spectroscopy directly verifies that the adatom Si 2p component (usually denoted by C 3 ) is correlated with the surface state just below E F (usually denoted by S 1 ), as has been observed in previous angle-resolved photoelectron spectroscopy studies.

Shaft siting decision

International Nuclear Information System (INIS)

1987-08-01

This study identifies and establishes relative guidelines to be used for siting of repository shafts. Weights were determined for the significant factors that impact the selection of shaft locations for a nuclear waste repository in salt. The study identified a total of 45 factors. A panel of experienced mining people utilized the Kepner-Tregoe (K-T) Decision Analysis Process to perform a structured evaluation of each significant shaft siting factor. The evaluation determined that 22 of the factors were absolute constraints and that the other 23 factors were desirable characteristics. The group established the relative weights for each of the 23 desirable characteristics by using a paired comparison method. 8 refs., 2 figs., 5 tabs

Nuclear power plant site selection: a case study

International Nuclear Information System (INIS)

Lugasi, Y.; Mehrez, A.; Sinuany-Stern, Z.

1985-01-01

Selecting the site for a nuclear power plant involves the evaluation of numerous criteria and the professional judgment of various experts. The Israel Atomic Energy Commission has been concerned with the problem of selecting a site for a nuclear power station. Previous studies have been performed by the commission to identify potential sites. There were initial screenings where potential sites were chosen according to various minimal criteria and international standards. Only sites that met all the criteria were chosen. A study was made to find the most preferred site among the potential sites that met all the criteria. Two mathematical approaches were used: Keeney's multiattribute utility function and Saaty's eigenvalue prioritization technique. Both models ranked the same site as the most desirable; however, the models differed in their ranking of the other sites

INR targets and site-level anticoagulation control: results from the Veterans AffaiRs Study to Improve Anticoagulation (VARIA).

Science.gov (United States)

Rose, A J; Berlowitz, D R; Miller, D R; Hylek, E M; Ozonoff, A; Zhao, S; Reisman, J I; Ash, A S

2012-04-01

Not all clinicians target the same International Normalized Ratio (INR) for patients with a guideline-recommended target range of 2-3. A patient's mean INR value suggests the INR that was actually targeted. We hypothesized that sites would vary by mean INR, and that sites of care with mean values nearest to 2.5 would achieve better anticoagulation control, as measured by per cent time in therapeutic range (TTR). To examine variations among sites in mean INR and the relationship with anticoagulation control in an integrated system of care. We studied 103,897 patients receiving oral anticoagulation with an expected INR target between 2 and 3 at 100 Veterans Health Administration (VA) sites from 1 October 2006 to 30 September 2008. Key site-level variables were: proportion near 2.5 (that is, percentage of patients with mean INR between 2.3 and 2.7) and mean risk-adjusted TTR. Site mean INR ranged from 2.22 to 2.89; proportion near 2.5, from 30 to 64%. Sites' proportions of patients near 2.5, below 2.3 and above 2.7 were consistent from year to year. A 10 percentage point increase in the proportion near 2.5 predicted a 3.8 percentage point increase in risk-adjusted TTR (P < 0.001). Proportion of patients with mean INR near 2.5 is a site-level 'signature' of care and an implicit measure of targeted INR. This proportion varies by site and is strongly associated with site-level TTR. Our study suggests that sites wishing to improve TTR, and thereby improve patient outcomes, should avoid the explicit or implicit pursuit of non-standard INR targets. © 2012 International Society on Thrombosis and Haemostasis.

Observation and simulation of ethane at 23 FTIR sites

Science.gov (United States)

Bader, W. M. J.; Mahieu, E.; Franco, B.; Pozzer, A.; Taraborrelli, D.; Prignon, M.; Servais, C. P.; De Maziere, M.; Vigouroux, C.; Mengistu Tsidu, G.; Sufa, G.; Mellqvist, J.; Blumenstock, T.; Hase, F.; Schneider, M.; Sussmann, R.; Nagahama, T.; Sudo, K.; Hannigan, J. W.; Ortega, I.; Morino, I.; Nakajima, H.; Smale, D.; Makarova, M.; Poberovsky, A.; Murata, I.; Grutter de la Mora, M.; Guarin, C. A.; Stremme, W.; Té, Y.; Jeseck, P.; Notholt, J.; Palm, M.; Conway, S. A.; Lutsch, E.; Strong, K.; Griffith, D. W. T.; Jones, N. B.; Paton-Walsh, C.; Friedrich, M.; Smeekes, S.

2017-12-01

Ethane is the most abundant non-methane hydrocarbon (NMHC) in the Earth atmosphere. Its main sources are of anthropogenic origin, with globally 62% from leakage during production and transport of natural gas, 20% from biofuel combustion and 18% from biomass burning. In the Southern hemisphere, anthropogenic emissions are lower which makes biomass burning emissions a more significant source. The main removal process is oxidation by the hydroxyl radical (OH), leading to a mean atmospheric lifetime of 2 months. Until recently, a prolonged decrease of its abundance has been documented, at rates of -1 to -2.7%/yr, with global emissions dropping from 14 to 11 Tg/yr over 1984-2010 owing to successful measures reducing fugitive emissions from its fossil fuel sources. However, subsequent investigations have reported on an upturn in the ethane trend, characterized by a sharp rise from about 2009 onwards. The ethane increase is attributed to the oil and natural gas production boom in North America, although significant changes in OH could also be at play. In the present contribution, we report the trend of ethane at 23 ground-based Fourier Transform Infrared (FTIR) sites spanning the 80ºN to 79ºS latitude range. Over 2010-2015, a significant ethane rise of 3-5%/yr is determined for most sites in the Northern Hemisphere, while for the Southern hemisphere the rates of changes are not significant at the 2-sigma uncertainty level . Dedicated model simulations by EMAC (ECHAM5/MESSy Atmospheric Chemistry; 1.8×1.8 degrees) implementing various emission scenarios are included in order to support data interpretation. The usual underestimation of the NMHCs emissions in the main inventories is confirmed here for RCP85 (Representative Concentration Pathway Database v8.5). Scaling them by 1.5 is needed to capture the background levels of atmospheric ethane. Moreover, additional and significant emissions ( 7 Tg over 2009-2015) are needed to capture the ethane rise in the Northern

Tetragonal Lysozyme Interactions Studied by Site Directed Mutagenesis

Science.gov (United States)

Crawford, Lisa; Karr, Laurel J.; Nadarajah, Arunan; Pusey, Marc

1999-01-01

A number of recent experimental and theoretical studies have indicated that tetragonal lysozyme crystal growth proceeds by the addition of aggregates, formed by reversible self association of the solute molecules in the bulk solution. Periodic bond chain and atomic force microscopy studies have indicated that the probable growth unit is at minimum a 43 tetramer, and most likely an octamer composed of two complete turns about the 43 axis. If these results are correct, then there are intermolecular interactions which are only formed in the solution and others only formed at the joining of the growth unit to the crystal surface. We have set out to study these interactions, and the correctness of this hypothesis, using site directed mutagenesis of specific amino acid residues involved in the different bonds. We had initially expressed wild type lysozyme in S. cervasiae with yields of approximately 5 mg/L, which were eventually raised to approximately 40 mg/L. We are now moving the expression to the Pichia system, with anticipated yields of 300 to (3)500 mg/L, comparable to what can be obtained from egg whites. An additional advantage of using recombinant protein is the greater genetic homogeneity of the material obtained and the absence of any other contaminating egg proteins. The first mutation experiments are TYR 23 (Registered) PHE or ALA and ASN 113 (Registered) ALA or ASP. Both TYR 23 and ASN 113 form part of the postulated dimerization intermolecular binding site which lead to the formation of the 43 helix. Tyrosine also participates in an intermolecular hydrogen bond with ARG 114. The results of these and subsequent experiments will be discussed.

A Summary of Rheology Data For SB3 and SB2/3 Blend Simulant Savannah River Site Wastes

International Nuclear Information System (INIS)

KOOPMAN, DAVIDC.

2004-01-01

The purpose of this study was to document the rheological measurements made for Sludge Batch 3 (SB3) and the blend of SB3 with Sludge Batch 2 (SB2). These measurements were primarily made on Slurry Mix Evaporator (SME) products, i.e. melter feeds. Some measurements were made on SB2/3 blend Sludge Receipt and Adjustment Tank (SRAT) products. Measurements on radioactive SB3 and SB2/3 samples have been limited to sludge characterization. SB2/3 measurements studied the impact of changing the SRAT acid addition strategy on the SRAT and SME product rheology. SB2/3 measurements also studied the impact of changing the waste loading target (sludge oxides content in glass) of the SME product. SB3 measurements studied the impact of changes in the wash end point and acid addition strategy on the SME product (melter feed) rheology. A summary of the significant findings is given below: SB3 radioactive sludge and blended SB2/3 radioactive sludge were less viscous than SB2 radioactive sludge. SB2/3 b lend sludge is more viscous than SB3 sludge. SB3 simulant SME product rheology was strongly impacted by changing the noble metal concentrations to more closely match those of the qualification sample. This reduction in noble metals produced a lower pH product that was also considerably less viscous. Increased acid addition in the SB2/3 SRAT generally led to less viscous simulant SRAT products. This trend did not persist in the SME products. SME products became more viscous when increased acid was used in the SRAT cycle from 135 per cent up to 170 per cent of stoichiometry, then became less viscous as total acid was increased further to 185 per cent. A significant increase in hydrogen generation occurred between 170 per cent and 185 per cent. The impact of acid addition on SB3 SME products was also variable. The impact of waste loading changes from 31 to 35 to 40 per cent on SB2/3 simulant SME products led to more viscous melter feeds as waste loading increased at constant wt. per cent

Streamlined Approach for Environmental Restoration Plan for Corrective Action Unit 107: Low Impact Soil Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

2008-01-01

This Streamlined Approach for Environmental Restoration Plan covers activities associated with Corrective Action Unit (CAU) 107 of the Federal Facility Agreement and Consent Order (FFACO, 1996 (as amended February 2008)). CAU 107 consists of the following Corrective Action Sites (CASs) located in Areas 1, 2, 3, 4, 5, 9, 10, and 18 of the Nevada Test Site. (1) CAS 01-23-02, Atmospheric Test Site - High Alt; (2) CAS 02-23-02, Contaminated Areas (2); (3) CAS 02-23-03, Contaminated Berm; (4) CAS 02-23-10, Gourd-Amber Contamination Area; (5) CAS 02-23-11, Sappho Contamination Area; (6) CAS 02-23-12, Scuttle Contamination Area; (7) CAS 03-23-24, Seaweed B Contamination Area; (8) CAS 03-23-27, Adze Contamination Area; (9) CAS 03-23-28, Manzanas Contamination Area; (10) CAS 03-23-29, Truchas-Chamisal Contamination Area; (11) CAS 04-23-02, Atmospheric Test Site T4-a; (12) CAS 05-23-06, Atmospheric Test Site; (13) CAS 09-23-06, Mound of Contaminated Soil; (14) CAS 10-23-04, Atmospheric Test Site M-10; and (15) CAS 18-23-02, U-18d Crater (Sulky). Based on historical documentation, personnel interviews, site process knowledge, site visits, photographs, engineering drawings, field screening, analytical results, and the results of data quality objectives process (Section 3.0), closure in place with administrative controls or no further action will be implemented for CAU 107. CAU 107 closure activities will consist of verifying that the current postings required under Title 10 Code of Federal Regulations (CFR) Part 835 are in place and implementing use restrictions (URs) at two sites, CAS 03-23-29 and CAS 18-23-02. The current radiological postings combined with the URs are adequate administrative controls to limit site access and worker dose

Human deoxyhaemoglobin-2,3-diphosphoglycerate complex low-salt structure at 2.5 A resolution.

Science.gov (United States)

Richard, V; Dodson, G G; Mauguen, Y

1993-09-20

The haemoglobin-2,3-diphosphoglycerate complex structure has been solved at 2.5 A resolution using crystals grown from low-salt solutions. The results show some important differences with the precedent haemoglobin-2,3-diphosphoglycerate high-salt structure solved by Arnone. First, we observe a loss of symmetry in the binding site, secondly both of the lysine residues 82 beta interact with 2,3-diphosphoglycerate at the same time, each making two contacts. This level of interaction is in agreement with the functional behaviour of natural haemoglobin mutants with mutations at the 2,3-diphosphoglycerate binding site.

General siting study 95. Siting of a deep repository for spent nuclear fuel

International Nuclear Information System (INIS)

1995-10-01

General Siting Study 95 is a detailed description of the work carried out to put the siting of a deep repository in a national and regional context. The report is based on SKB's siting factors, which have been applied on a national scale. Different factors of importance or of possible importance for the long-term radiological safety, technology, land and environment as well as society are described and evaluated. This report is the overall description on general siting studies which the government considered that SKB should report in connection with the RD and D Programme 95. 121 refs, 40 figs

General siting study 95. Siting of a deep repository for spent nuclear fuel

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-10-01

General Siting Study 95 is a detailed description of the work carried out to put the siting of a deep repository in a national and regional context. The report is based on SKB`s siting factors, which have been applied on a national scale. Different factors of importance or of possible importance for the long-term radiological safety, technology, land and environment as well as society are described and evaluated. This report is the overall description on general siting studies which the government considered that SKB should report in connection with the RD and D Programme 95. 121 refs, 40 figs.

Dicty_cDB: FC-AI23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

Post-Closure Inspection and Monitoring Report for Corrective Action Unit 342: Area 23 Mercury Fire Training Pit, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

NSTec Environmental Restoration

2006-01-01

This report provides a summary and analysis of visual site inspections and soil gas sampling results for Corrective Action Unit (CAU) 342, Area 23 Mercury Fire Training Pit. CAU 342 is identified in the Federal Facility Agreement and Consent Order of 1996 and consists of Corrective Action Site 23-56-01, Former Mercury Fire Training Pit. This report covers calendar years 2004 and 2005. Visual site inspections were conducted on May 20 and November 14, 2004, and May 17 and November 15, 2005. No significant findings were observed during these inspections. The site was in good condition, and no repair activities were required. Soil gas samples were collected on November 29, 2005, for analysis of volatile organic compounds (VOCs) and semivolatile organic compounds (SVOCs), and samples were collected on December 1, 2005, for analysis of base gases. Base gas concentrations in the monitoring well show a high concentration of carbon dioxide and a low concentration of oxygen, which is an indication of biodegradation of total petroleum hydrocarbons (TPH) in the soil. Results for VOCs and SVOCs are unchanged, with VOCs below or near laboratory method detection limits and no SVOCs detected above laboratory method detection limits. Post-closure monitoring was required for six years after closure of the site. Therefore, since 2005 was the sixth year of monitoring, the effectiveness of natural attenuation of the TPH-impacted soil by biodegradation was evaluated. The base gas concentrations indicate that biodegradation of TPH in the soil is occurring; therefore, it is recommended that monitoring be discontinued. Visual site inspections should continue to be performed biannually to ensure that the signs are in place and readable and that the use restriction has been maintained. The results of the site inspections will be documented in a letter report and submitted annually

Streamlined Approach for Environmental Restoration Plan for Corrective Action Unit 107: Low Impact Soil Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

2009-01-01

This Streamlined Approach for Environmental Restoration Plan covers activities associated with Corrective Action Unit (CAU) 107 of the Federal Facility Agreement and Consent Order (1996 (as amended February 2008)). CAU 107 consists of the following Corrective Action Sites (CASs) located in Areas 1, 2, 3, 4, 5, 9, 10, and 18 of the Nevada Test Site. (sm b ullet) CAS 01-23-02, Atmospheric Test Site - High Alt(sm b ullet) CAS 02-23-02, Contaminated Areas (2)(sm b ullet) CAS 02-23-03, Contaminated Berm(sm b ullet) CAS 02-23-10, Gourd-Amber Contamination Area(sm b ullet) CAS 02-23-11, Sappho Contamination Area(sm b ullet) CAS 02-23-12, Scuttle Contamination Area(sm b ullet) CAS 03-23-24, Seaweed B Contamination Area(sm b ullet) CAS 03-23-27, Adze Contamination Area(sm b ullet) CAS 03-23-28, Manzanas Contamination Area(sm b ullet) CAS 03-23-29, Truchas-Chamisal Contamination Area(sm b ullet) CAS 04-23-02, Atmospheric Test Site T4-a(sm b ullet) CAS 05-23-06, Atmospheric Test Site(sm b ullet) CAS 09-23-06, Mound of Contaminated Soil(sm b ullet) CAS 10-23-04, Atmospheric Test Site M-10(sm b ullet) CAS 18-23-02, U-18d Crater (Sulky) Based on historical documentation, personnel interviews, site process knowledge, site visits, photographs, engineering drawings, field screening, analytical results, and the results of data quality objectives process (Section 3.0), closure in place with administrative controls or no further action will be implemented for CAU 107.

Dicty_cDB: FC-BR23 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2

Methodology of site studies

International Nuclear Information System (INIS)

Caries, J.C.; Hugon, J.; Grauby, A.

1980-01-01

This methodology consists in an essentially dynamic, estimated and follow-up analysis of the impact of discharges on all the environment compartments, whether natural or not, that play a part in the protection of man and his environment. It applies at two levels, to wit: the choice of site, or the detailed study of the site selected. Two examples of its application will be developed, namely: at the choice of site level in the case of marine sites, and of the detailed study level of the chosen site in that of a riverside site [fr

Characteristics of plant concentration ratios assessed in a 64-site field survey of 23 elements

International Nuclear Information System (INIS)

Sheppard, S.C.; Evenden, W.G.

1990-01-01

Many of the statistical characteristics of plant concentration ratios (CRs) and translocation factors (TFs) have not been critically assessed, especially in field surveys. The statistical characteristics, particularly the measures of variation, are important for stochastic modelling of plant uptake. The CR and TF values for 23 naturally occurring elements throughout the geographic range of one plant species, blueberries (Vaccinium angustifolium), in Canada were surveyed. Although the ratios imply linear relationships, the numerator concentrations were not closely correlated with the denominator concentrations. The variation in the ratios was not clearly related to the means or to characteristics of the elements. The overall geometric standard deviation for CRs was 2.5 and for TFs was 1.6. The values of CR were intercorrelated for certain groups of elements and these groups reflected the periodic classification of elements. Thus, correlation between elements in stochastic models, which may reduce overall variability, is valid. Site variables such as soil pH, soil bulk density, soil fertility and plant growth condition were only slightly useful in statistically explaining some of the variation in CR values. (author)

Study of site layout in the Rokkasho site

International Nuclear Information System (INIS)

Sato, Kazuyoshi; Tamura, Kousaku; Yagenji, Akira; Sekiya, Shigeki; Takahashi, Hideo; Neyatani, Yuzuru; Uehara, Masaharu; Motohashi, Keiichi; Hashimoto, Masayoshi; Ogino, Shunji; Nagamatsu, Nobuhide

2006-03-01

The Final Design Report (FDR) of the International Thermonuclear Experimental Reactor (ITER) was published on July 2001 as a summary of the Engineering Design Activity (EDA). After the EDA, site dependent design has been investigated for the invitation of ITER toward Rokkasho Site (Iyasakadai area) in Aomori prefecture. This report describes the results of site layout of major buildings and structures of ITER in the Rokkasho-Site. The data of the ground near the site and the results of site dependent design in Japan were applied to this study. Through this study, the most appropriate site layout has been constructed with satisfaction of following conditions. (1) Bedrock level at the tokamak complex building is relatively high and it can be reduced the cost of excavation and foundation work. (2) Total amount of excavation soil for site preparation is minimized and the flexibility of the layout is ensured with flat ground level. (3) Accessibility of human and equipments, reduction of noise and vibration to the environment can be obtained. Total length of ducts and piping between buildings in site is minimized. (author)

Corrective Action Decision Document/Corrective Action Plan for Corrective Action Unit 104: Area 7 Yucca Flat Atmospheric Test Sites Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Patrick Matthews

2012-10-01

CAU 104 comprises the following corrective action sites (CASs): • 07-23-03, Atmospheric Test Site T-7C • 07-23-04, Atmospheric Test Site T7-1 • 07-23-05, Atmospheric Test Site • 07-23-06, Atmospheric Test Site T7-5a • 07-23-07, Atmospheric Test Site - Dog (T-S) • 07-23-08, Atmospheric Test Site - Baker (T-S) • 07-23-09, Atmospheric Test Site - Charlie (T-S) • 07-23-10, Atmospheric Test Site - Dixie • 07-23-11, Atmospheric Test Site - Dixie • 07-23-12, Atmospheric Test Site - Charlie (Bus) • 07-23-13, Atmospheric Test Site - Baker (Buster) • 07-23-14, Atmospheric Test Site - Ruth • 07-23-15, Atmospheric Test Site T7-4 • 07-23-16, Atmospheric Test Site B7-b • 07-23-17, Atmospheric Test Site - Climax These 15 CASs include releases from 30 atmospheric tests conducted in the approximately 1 square mile of CAU 104. Because releases associated with the CASs included in this CAU overlap and are not separate and distinguishable, these CASs are addressed jointly at the CAU level. The purpose of this CADD/CAP is to evaluate potential corrective action alternatives (CAAs), provide the rationale for the selection of recommended CAAs, and provide the plan for implementation of the recommended CAA for CAU 104. Corrective action investigation (CAI) activities were performed from October 4, 2011, through May 3, 2012, as set forth in the CAU 104 Corrective Action Investigation Plan.

Studies on the intracellular localization of hHR23B

International Nuclear Information System (INIS)

Katiyar, Samiksha; Lennarz, William J.

2005-01-01

Yeast Rad23, originally identified as a DNA repair protein, has been proposed to participate in other cellular functions, i.e., the proteasome-degradation pathway, the process of spindle pole body duplication and as a component of the anaphase checkpoint. Two human homologs of yeast Rad23, hHR23A and hHR23B, exhibit high sequence homology with yRad23 and also have been shown to be involved in DNA repair and proteasome-dependent degradation. Previous studies on the intracellular localization of hHR23A and hHR23B revealed their predominant localization in the nucleus during interphase and in the cytoplasm during mitosis. We have analyzed the localization of hHR23B during all the phases of the cell cycle using immunofluorescence. Unlike previous studies, our results suggest localization of hHR23B in the nucleus as well as in the cytoplasm during G1 phase. The nuclear levels of hHR23B decrease during S-phase of the cell cycle. When the cell enters mitosis, hHR23B relocalizes in the cytoplasm without association with chromatin. These results indicate that the intracellular distribution hHR23B is cell cycle dependent

Fibroblast Growth Factor-23, Sclerostin, and Bone Microarchitecture in Patients With Osteoporotic Fractures of the Proximal Femur: A Cross-sectional Study.

Science.gov (United States)

Herlyn, Philipp K E; Cornelius, Norina; Haffner, Dieter; Zaage, Franziska; Kasch, Cornelius; Schober, Hans-Christof; Mittlmeier, Thomas; Fischer, Dagmar-C

2016-01-01

This cross-sectional observational cohort study was designed to simultaneously investigate bone microarchitecture and serum markers of bone metabolism in elderly osteoporotic patients experiencing a trochanteric or femoral neck fracture. Special emphasis was put on renal function, sclerostin and fibroblast growth factor-23 (FGF-23). Eighty-two patients (median age: 84 years; 49 trochanteric fractures) scheduled for emergency surgery due to an osteoporotic fracture participated. Bone specimens for ex vivo microcomputed X-ray tomography were sampled during surgery. Blood samples for laboratory workup were collected before surgery (t0) and 1 day afterward (t1). Fifty-eight patients consented to dual-energy X-ray absorptiometry scanning of the lumbar spine and/or contralateral femoral neck after recovery during the in-patient stay. Samples were grouped according to the site of fracture. Regression coefficients were controlled for age and/or estimated glomerular filtration rate (eGFR), if appropriate. Patients experiencing a femoral neck fracture presented with better preserved renal function (eGFR) and lower C-terminal fragment of fibroblast growth factor-23 (cFGF-23) concentrations compared to those with trochanteric fractures. By contrast, serum sclerostin was similar at both time points and did not differ between groups. Age-adjusted correlation analysis revealed negative associations between eGFR and cFGF-23 determined at t1 (R=-0.34; ptrochanteric and femoral neck fractures, respectively. Our study provides evidence that not only an age-related decline of renal function but also the type of skeletal injury may contribute to the circulating concentrations of cFGF-23. Copyright © 2016 The International Society for Clinical Densitometry. Published by Elsevier Inc. All rights reserved.

Socioeconomic Site Study Plan: Draft

International Nuclear Information System (INIS)

1987-07-01

Social and economic issues and concerns of the Deak Smith County site area will be evaluated during site characterization. Effects that the area could experience from a repository project include demographic, economic, community service, fiscal, and social impacts. The Socioeconomic Site Study Plan is designed to provide a strategy to assess the potential for those impacts. The Socioeconomic Site Study Plan is structured to provide an overview of the socioeconomic program requirements, objectives, and activities to be conducted during site characterization. This report will describe the study design and its rationale; data collection, management, and reporting; program schedules and milestones; site study organization and management; and quality assurance issues. 43 refs

The Involvement of miR-23a/APAF1 Regulation Axis in Colorectal Cancer

Directory of Open Access Journals (Sweden)

Fung Lin Yong

2014-07-01

Full Text Available Recent advances in microRNAome have made microRNAs (miRNAs a compelling novel class of biomarker in cancer biology. In the present study, the role of miR-23a in the carcinogenesis of colorectal cancer (CRC was investigated. Cell viability, apoptosis, and caspase 3/7 activation analyses were conducted to determine the potentiality of apoptosis resistance function of miR-23a in CRC. Luciferase assay was performed to verify a putative target site of miR-23a in the 3'-UTR of apoptosis protease activating factor 1 (APAF1 mRNA. The expression levels of miR-23a and APAF1 in CRC cell lines (SW480 and SW620 and clinical samples were assessed using reverse transcription-quantitative real-time PCR (RT-qPCR and Western blot. We found that the inhibition of miR-23a in SW480 and SW620 cell lines resulted in significant reduction of cell viability and promotion of cell apoptosis. Moreover, miR-23a up-regulation was coupled with APAF1 down-regulation in CRC tissue samples. Taken together, miR-23a was identified to regulate apoptosis in CRC. Our study highlights the potential application of miR-23a/APAF1 regulation axis in miRNA-based therapy and prognostication.

Analysis of laparoscopic port site complications: A descriptive study.

Science.gov (United States)

Karthik, Somu; Augustine, Alfred Joseph; Shibumon, Mundunadackal Madhavan; Pai, Manohar Varadaraya

2013-04-01

The rate of port site complications following conventional laparoscopic surgery is about 21 per 100,000 cases. It has shown a proportional rise with increase in the size of the port site incision and trocar. Although rare, complications that occur at the port site include infection, bleeding, and port site hernia. To determine the morbidity associated with ports at the site of their insertion in laparoscopic surgery and to identify risk factors for complications. Prospective descriptive study. In the present descriptive study, a total of 570 patients who underwent laparoscopic surgeries for various ailments between August 2009 and July 2011 at our institute were observed for port site complications prospectively and the complications were reviewed. Descriptive statistical analysis was carried out in the present study. The statistical software, namely, SPSS 15.0 was used for the analysis of the data. Of the 570 patients undergoing laparoscopic surgery, 17 (3%) had developed complications specifically related to the port site during a minimum follow-up of three months; port site infection (PSI) was the most frequent (n = 10, 1.8%), followed by port site bleeding (n = 4, 0.7%), omentum-related complications (n = 2; 0.35%), and port site metastasis (n = 1, 0.175%). Laparoscopic surgeries are associated with minimal port site complications. Complications are related to the increased number of ports. Umbilical port involvement is the commonest. Most complications are manageable with minimal morbidity, and can be further minimized with meticulous surgical technique during entry and exit.

Analysis of laparoscopic port site complications: A descriptive study

Directory of Open Access Journals (Sweden)

Somu Karthik

2013-01-01

Full Text Available Context: The rate of port site complications following conventional laparoscopic surgery is about 21 per 100,000 cases. It has shown a proportional rise with increase in the size of the port site incision and trocar. Although rare, complications that occur at the port site include infection, bleeding, and port site hernia. Aims: To determine the morbidity associated with ports at the site of their insertion in laparoscopic surgery and to identify risk factors for complications. Settings and Design: Prospective descriptive study. Materials and Methods: In the present descriptive study, a total of 570 patients who underwent laparoscopic surgeries for various ailments between August 2009 and July 2011 at our institute were observed for port site complications prospectively and the complications were reviewed. Statistical Analysis Used: Descriptive statistical analysis was carried out in the present study. The statistical software, namely, SPSS 15.0 was used for the analysis of the data. Results: Of the 570 patients undergoing laparoscopic surgery, 17 (3% had developed complications specifically related to the port site during a minimum follow-up of three months; port site infection (PSI was the most frequent (n = 10, 1.8%, followed by port site bleeding (n = 4, 0.7%, omentum-related complications (n = 2; 0.35%, and port site metastasis (n = 1, 0.175%. Conclusions: Laparoscopic surgeries are associated with minimal port site complications. Complications are related to the increased number of ports. Umbilical port involvement is the commonest. Most complications are manageable with minimal morbidity, and can be further minimized with meticulous surgical technique during entry and exit.

Analysis of laparoscopic port site complications: A descriptive study

Science.gov (United States)

Karthik, Somu; Augustine, Alfred Joseph; Shibumon, Mundunadackal Madhavan; Pai, Manohar Varadaraya

2013-01-01

CONTEXT: The rate of port site complications following conventional laparoscopic surgery is about 21 per 100,000 cases. It has shown a proportional rise with increase in the size of the port site incision and trocar. Although rare, complications that occur at the port site include infection, bleeding, and port site hernia. AIMS: To determine the morbidity associated with ports at the site of their insertion in laparoscopic surgery and to identify risk factors for complications. SETTINGS AND DESIGN: Prospective descriptive study. MATERIALS AND METHODS: In the present descriptive study, a total of 570 patients who underwent laparoscopic surgeries for various ailments between August 2009 and July 2011 at our institute were observed for port site complications prospectively and the complications were reviewed. STATISTICAL ANALYSIS USED: Descriptive statistical analysis was carried out in the present study. The statistical software, namely, SPSS 15.0 was used for the analysis of the data. RESULTS: Of the 570 patients undergoing laparoscopic surgery, 17 (3%) had developed complications specifically related to the port site during a minimum follow-up of three months; port site infection (PSI) was the most frequent (n = 10, 1.8%), followed by port site bleeding (n = 4, 0.7%), omentum-related complications (n = 2; 0.35%), and port site metastasis (n = 1, 0.175%). CONCLUSIONS: Laparoscopic surgeries are associated with minimal port site complications. Complications are related to the increased number of ports. Umbilical port involvement is the commonest. Most complications are manageable with minimal morbidity, and can be further minimized with meticulous surgical technique during entry and exit. PMID:23741110

Universal Access in Heritage Sites: A Case Study on Historic Sites in Jaipur, India.

Science.gov (United States)

Vardia, Shweta; Khare, Rachna; Khare, Ajay

2016-01-01

A nation is recognized by a range of its significant historical, cultural and natural properties. These properties are generally preserved and maintained either by national administration or by private owners and charitable trusts due to higher value of their cultural inheritance and termed globally as heritage or historic sites. Heritage sites are a significant asset, a unique and irreplaceable resource which reflects a rich and diverse expression of past societies and forms an integral part of local, regional and national cultural identity. Today, heritage sites also play an important role in communication and knowledge exchange. Thus the rapidly increasing heritage tourism industry faces several challenges too. One of the challenges is that there is a segment of society who is not yet able to equally enjoy the visit to historic structures/sites and attractions, facilities and services. This paper aims to study the experience and develop understanding regarding the heritage structures/sites approached and interacted by diverse users. This study is an outcome of a hands on workshop conducted with diverse users at various historic sites in the city of Jaipur viz. at The City Palace Complex, Jaipur, Jaigarh Fort and the Haveli at Kanota near to Jaipur India.

Site study plan for EDBH [Engineering Design Boreholes] seismic surveys, Deaf Smith County site, Texas: Revision 1

International Nuclear Information System (INIS)

Hume, H.

1987-12-01

This site study plan describes seismic reflection surveys to run north-south and east-west across the Deaf Smith County site, and intersecting near the Engineering Design Boreholes (EDBH). Both conventional and shallow high-resolution surveys will be run. The field program has been designed to acquire subsurface geologic and stratigraphic data to address information/data needs resulting from Federal and State regulations and Repository program requirements. The data acquired by the conventional surveys will be common-depth- point, seismic reflection data optimized for reflection events that indicate geologic structure near the repository horizon. The data will also resolve the basement structure and shallow reflection events up to about the top of the evaporite sequence. Field acquisition includes a testing phase to check/select parameters and a production phase. The field data will be subjected immediately to conventional data processing and interpretation to determine if there are any anamolous structural for stratigraphic conditions that could affect the choice of the EDBH sites. After the EDBH's have been drilled and logged, including vertical seismic profiling, the data will be reprocessed and reinterpreted for detailed structural and stratigraphic information to guide shaft development. The shallow high-resulition seismic reflection lines will be run along the same alignments, but the lines will be shorter and limited to immediate vicinity of the EDBH sites. These lines are planned to detect faults or thick channel sands that may be present at the EDBH sites. 23 refs. , 7 figs., 5 tabs

Corrective Action Investigation Plan for Corrective Action Unit 137: Waste Disposal Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

Wickline, Alfred

2005-01-01

This Corrective Action Investigation Plan (CAIP) contains project-specific information including facility descriptions, environmental sample collection objectives, and criteria for conducting site investigation activities at Corrective Action Unit (CAU) 137: Waste Disposal Sites. This CAIP has been developed in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S. Department of Defense. Corrective Action Unit 137 contains sites that are located in Areas 1, 3, 7, 9, and 12 of the Nevada Test Site (NTS), which is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Corrective Action Unit 137 is comprised of the eight corrective action sites (CASs) shown on Figure 1-1 and listed below: (1) CAS 01-08-01, Waste Disposal Site; (2) CAS 03-23-01, Waste Disposal Site; (3) CAS 03-23-07, Radioactive Waste Disposal Site; (4) CAS 03-99-15, Waste Disposal Site; (5) CAS 07-23-02, Radioactive Waste Disposal Site; (6) CAS 09-23-07, Radioactive Waste Disposal Site; (7) CAS 12-08-01, Waste Disposal Site; and (8) CAS 12-23-07, Waste Disposal Site. The Corrective Action Investigation (CAI) will include field inspections, radiological surveys, geophysical surveys, sampling of environmental media, analysis of samples, and assessment of investigation results, where appropriate. Data will be obtained to support corrective action alternative evaluations and waste management decisions. The CASs in CAU 137 are being investigated because hazardous and/or radioactive constituents may be present in concentrations that could potentially pose a threat to human health and the environment. Existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives for the CASs. Additional information will be generated by conducting a CAI before evaluating and selecting corrective action

Corrective Action Investigation Plan for Corrective Action Unit 104: Area 7 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Patrick Matthews

2011-08-01

CAU 104 comprises the 15 CASs listed below: (1) 07-23-03, Atmospheric Test Site T-7C; (2) 07-23-04, Atmospheric Test Site T7-1; (3) 07-23-05, Atmospheric Test Site; (4) 07-23-06, Atmospheric Test Site T7-5a; (5) 07-23-07, Atmospheric Test Site - Dog (T-S); (6) 07-23-08, Atmospheric Test Site - Baker (T-S); (7) 07-23-09, Atmospheric Test Site - Charlie (T-S); (8) 07-23-10, Atmospheric Test Site - Dixie; (9) 07-23-11, Atmospheric Test Site - Dixie; (10) 07-23-12, Atmospheric Test Site - Charlie (Bus); (11) 07-23-13, Atmospheric Test Site - Baker (Buster); (12) 07-23-14, Atmospheric Test Site - Ruth; (13) 07-23-15, Atmospheric Test Site T7-4; (14) 07-23-16, Atmospheric Test Site B7-b; (15) 07-23-17, Atmospheric Test Site - Climax These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on April 28, 2011, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 104. The releases at CAU 104 consist of surface-deposited radionuclides from 30 atmospheric nuclear tests. The presence and nature of contamination at CAU 104 will be evaluated based on information collected from a field investigation. Radiological contamination will be evaluated based on a comparison

Site locality identification study: Hanford Site. Volume II. Data cataloging

International Nuclear Information System (INIS)

1980-07-01

Data compilation and cataloging for the candidate site locality identification study were conducted in order to provide a retrievable data cataloging system for the present siting study and future site evaluation and licensng processes. This task occurred concurrently with and also independently of other tasks of the candidate site locality identification study. Work in this task provided the data utilized primarily in the development and application of screening and ranking processes to identify candidate site localities on the Hanford Site. The overall approach included two steps: (1) data acquisition and screening; and (2) data compilation and cataloging. Data acquisition and screening formed the basis for preliminary review of data sources with respect to their probable utilization in the candidate site locality identification study and review with respect to the level of completeness and detail of the data. The important working assumption was that the data to be used in the study be based on existing and available published and unpublished literature. The data compilation and cataloging provided the basic product of the Task; a retrievable data cataloging system in the form of an annotated reference list and key word index and an index of compiled data. The annotated reference list and key word index are cross referenced and can be used to trace and retrieve the data sources utilized in the candidate site locality identification study

E2F1 interactions with hHR23A inhibit its degradation and promote DNA repair.

Science.gov (United States)

Singh, Randeep K; Dagnino, Lina

2016-05-03

Nucleotide excision repair (NER) is a major mechanism for removal of DNA lesions induced by exposure to UV radiation in the epidermis. Recognition of damaged DNA sites is the initial step in their repair, and requires multiprotein complexes that contain XPC and hHR23 proteins, or their orthologues. A variety of transcription factors are also involved in NER, including E2F1. In epidermal keratinocytes, UV exposure induces E2F1 phosphorylation, which allows it to recruit various NER factors to sites of DNA damage. However, the relationship between E2F1 and hHR23 proteins vis-à-vis NER has remained unexplored. We now show that E2F1 and hHR23 proteins can interact, and this interaction stabilizes E2F1, inhibiting its proteasomal degradation. Reciprocally, E2F1 regulates hHR23A subcellular localization, recruiting it to sites of DNA photodamage. As a result, E2F1 and hHR23A enhance DNA repair following exposure to UV radiation, contributing to genomic stability in the epidermis.

A conserved chloramphenicol binding site at the entrance to the ribosomal peptide exit tunnel

DEFF Research Database (Denmark)

Long, Katherine S; Porse, Bo T

2003-01-01

, of E.coli 23S rRNA and G2084 (2058 in E.coli numbering) in domain V of H.halobium 23S rRNA. The modification sites overlap with a portion of the macrolide binding site and cluster at the entrance to the peptide exit tunnel. The data correlate with the recently reported chloramphenicol binding site...... on an archaeal ribosome and suggest that a similar binding site is present on the E.coli ribosome....

Shaft siting decision report: Final report

International Nuclear Information System (INIS)

1985-11-01

The purpose of this study is to identify and establish relative guidelines to be used for siting of repository shafts. Weights were determined for the significant factors which impact the selection of shaft locations for a nuclear waste repository in salt. The study identified a total of 45 factors. A panel of experienced mining people utilized the Kepner-Tregoe (K-T) Decision Analysis Process to perform a structured evaluation of each significant shaft siting factor. The evaluation determined that 22 of the factors were absolute constraints and that the other 23 factors were desirable characteristics. The group established the relative weights for each of the 23 desirable characteristics by using a paired comparison method. 49 refs., 2 figs., 5 tabs

A theoretical quantum study on the distribution of electrophilic and nucleophilic active sites on Cu(100) surfaces modeled as finite clusters

International Nuclear Information System (INIS)

Rios R, C.H.; Romero R, M.; Ponce R, A.; Mendoza H, L.H.

2008-01-01

In this work, it is shown a theoretical quantum study of the active sites distribution on a monocrystalline surface of Cu(100). The copper surface was modeled as finite clusters of 14, 23, 38 and 53 atoms. We performed Hartree-Fock and Density Functional Theory (B3LYP) ab initio calculations employing the pseudopotentials of Hay and Wadt (LANLlMB y LANL2DZ). From calculations, we found a work function value of 4.1 eV. The mapping of the HOMO and LUMO in the frozen core approximation, allowed us finding the electrophilic and nucleophilic active sites distribution, respectively. The results indicated that electrophilic sites on the Cu(100) surface were located on hollow position and its numerical density was 8.6 x 10 16 sites cm -2 . From the nucleophilic local softness study, it was found that the nucleophilic sites were formed by a group of atoms and it had a numerical density of 2.4x 10 16 sitescm -2 . Last results indicated that adsorptions with 2 x 2 and 3 x 3 distributions can be favored onto a Cu(100) surface for the electrophilic and nucleophilic cases, respectively. (Author)

23 CFR 750.308 - Reports.

Science.gov (United States)

2010-04-01

... 23 Highways 1 2010-04-01 2010-04-01 false Reports. 750.308 Section 750.308 Highways FEDERAL... Outdoor Advertising (Acquisition of Rights of Sign and Sign Site Owners) § 750.308 Reports. Periodic reports on site acquisitions and actual sign removals shall be submitted on FHWA Form 1424 and as...

Forsmark site characterisation - Borehole KFM22 and KFM23: Derivation of porewater data by diffusion experiments

Energy Technology Data Exchange (ETDEWEB)

Waber, H. N. [Rock Water Interaction, University of Bern, Bern (Switzerland); Smellie, J. A. T. [Conterra AB, Partille (Sweden)

2012-04-15

Within the Detum Project (Detailed Investigations in Forsmark) a 'Methodology comparison for porewater extraction and characterisation techniques' was initiated. This has centred on two shallow boreholes drilled at Soederviken within the northern part of the Forsmark characterisation site. The comparison includes different methodologies to characterise the chemical and isotopic composition of porewater residing in the connected pore space of the rock matrix. The present report describes the chemical and isotopic information of the porewater obtained by out-diffusion experiments and the diffusive isotope equilibration technique applied to originally water saturated drillcore samples. In addition, petrophysical data and solute transport properties of the rock matrix, all necessary for porewater characterisation, have also been elaborated. Specially conditioned drillcore samples were obtained from depths of less than 100 m from boreholes KFM22 and KFM23. Porewater has been extracted successfully from seven samples by laboratory out-diffusion and diffusive isotope exchange methods. The methodology to extract and analyse the porewater is outlined and the analytical data are tabulated. The data are critically reviewed for potential experimental artefacts and their significance with respect to in situ conditions. The connected pore space in the core material representing borehole KFM22 and KFM23 was measured on different types of originally saturated drillcore samples using gravimetric and isotope mass balance methods. Out-diffusion experiments were performed on kg-sized drillcore samples to derive the in situ concentration of the chemically conservative compounds chloride and bromide. The attainment of equilibrium conditions in the out-diffusion experiments was monitored by the concentration change of chloride and bromide as a function of time. The water isotope composition of porewater was determined by the diffusive isotope equilibration technique and by

Site locality identification study: Hanford Site. Volume I. Methodology, guidelines, and screening

International Nuclear Information System (INIS)

1980-07-01

Presented in this report are the results of the site locality identification study for the Hanford Site using a screening process. To enable evaluation of the entire Hanford Site, the screening process was applied to a somewhat larger area; i.e., the Pasco Basin. The study consisted of a series of screening steps that progressively focused on smaller areas which are within the Hanford Site and which had a higher potential for containing suitable repository sites for nuclear waste than the areas not included for further study. Five site localities, designated H-1, H-2, H-3, H-4, H-5 (Figure A), varying in size from approximately 10 to 50 square miles, were identified on the Hanford Site. It is anticipated that each site locality may contain one or more candidate sites suitable for a nuclear waste repository. The site locality identification study began with definition of objectives and the development of guidelines for screening. Three objectives were defined: (1) maximize public health and safety; (2) minimize adverse environmental and socioeconomic impacts; and (3) minimize system costs. The screening guidelines have numerical values that provided the basis for the successive reduction of the area under study and to focus on smaller areas that had a higher likelihood of containing suitable sites

Crystal Structures of the Pro-Inflammatory Cytokine Interleukin-23 and Its Complex with a High-Affinity Neutralizing Antibody

Energy Technology Data Exchange (ETDEWEB)

Beyer, Brian M.; Ingram, Richard; Ramanathan, Lata; Reichert, Paul; Le, Hung V.; Madison, Vincent; Orth, Peter (SPRI)

2009-06-25

Interleukin (IL)-23 is a pro-inflammatory cytokine playing a key role in the pathogenesis of several autoimmune and inflammatory diseases. We have determined the crystal structures of the heterodimeric p19-p40 IL-23 and its complex with the Fab (antigen-binding fragment) of a neutralizing antibody at 2.9 and 1.9 {angstrom}, respectively. The IL-23 structure closely resembles that of IL-12. They share the common p40 subunit, and IL-23 p19 overlaps well with IL-12 p35. Along the hydrophilic heterodimeric interface, fewer charged residues are involved for IL-23 compared with IL-12. The binding site of the Fab is located exclusively on the p19 subunit, and comparison with published cytokine-receptor structures suggests that it overlaps with the IL-23 receptor binding site.

Posttranscriptional modifications in the A-loop of 23S rRNAs from selected archaea and eubacteria.

OpenAIRE

Hansen, M A; Kirpekar, F; Ritterbusch, W; Vester, B

2002-01-01

Posttranscriptional modifications were mapped in helices 90-92 of 23S rRNA from the following phylogenetically diverse organisms: Haloarcula marismortui, Sulfolobus acidocaldarius, Bacillus subtilis, and Bacillus stearothermophilus. Helix 92 is a component of the ribosomal A-site, which contacts the aminoacyl-tRNA during protein synthesis, implying that posttranscriptional modifications in helices 90-92 may be important for ribosome function. RNA fragments were isolated from 23S rRNA by site-...

A Case Study in the Mars Landing Site Selection for Science Objects

Directory of Open Access Journals (Sweden)

Haingja Seo

2012-12-01

Full Text Available It is a crucial matter to select a landing site for landers or rovers in planning the Mars exploration. The landing site must have not only a scientific value as a landing site, but also geographical features to lead a safe landing for Mars probes. In this regard, this study analyzed landing site of Mars probes and rovers in previous studies and discussed the adequacy of the landing site to scientific missions. Moreover, this study also examined domestic studies on the Mars. The frameworks of these studies will guide the selection of exploration sites and a landing site when sending Mars probe to the Mars through our own efforts. Additionally, this paper will be used as the preliminary data for selection of exploration site and a landing site.

Managing a User’s Vulnerability on a Social Networking Site

Science.gov (United States)

2015-05-01

aid not only the cyberbullying of teenagers but also the cyberstalking and cyberharassment of adults3. On a social networking site, an individual user...news/2011-07-23-facebook-stalker- sentenced_n.htm 3en.wikipedia.org/wiki/ Cyberbullying 1 posts and subsequent interactions. The owner of the site

Methodology of site protection studies

International Nuclear Information System (INIS)

Farges, L.

1980-01-01

Preliminary studies preceding building of a nuclear facility aim at assessing the choice of a site and establishing operating and control procedures. These studies are of two types. Studies on the impact of environment on the nuclear facility to be constructed form one type and studies on the impact of nuclear facilities on the environment form the second type. A methodology giving a framework to studies of second type is presented. These studies are undertaken to choose suitable sites for nuclear facilities. After a preliminary selection of a site based on the first estimate, a detailed site study is undertaken. The procedure for this consists of five successive phases, namely, (1) an inquiry assessing the initial state of the site, (2) an initial synthesis of accumulated information for assessing the health and safety consequences of releases, (3) laboratory and field studies simulating the movement of waste products for a quantitative assessment of effects, (4) final synthesis for laying down the release limits and radiological control methods, and (5) conclusions based on comparing the data of final synthesis to the limits prescribed by regulations. These five phases are outlined. Role of periodic reassessments after the facility is in operation for same time is explained. (M.G.B.)

Surface-site-selective study of valence electronic structures of clean Si(100)-2x1 using Si-L23VV Auger electron-Si-2p photoelectron coincidence spectroscopy

International Nuclear Information System (INIS)

Kakiuchi, Takuhiro; Nagaoka, Shinichi; Hashimoto, Shogo; Fujita, Narihiko; Tanaka, Masatoshi; Mase, Kazuhiko

2010-01-01

Valence electronic structures of a clean Si(100)-2x1 surface are investigated in a surface-site-selective way using Si-L 23 VV Auger electron-Si-2p photoelectron coincidence spectroscopy. The Si-L 23 VV Auger electron spectra measured in coincidence with Si-2p photoelectrons emitted from the Si up-atoms or Si 2nd-layer of Si(100)-2x1 suggest that the position where the highest density of valence electronic states located in the vicinity of the Si up-atoms is shifted by 0.8 eV towards lower binding energy relative to that in the vicinity of the Si 2nd-layer. Furthermore, the valence band maximum in the vicinity of the Si up-atoms is indicated to be shifted by 0.1 eV towards lower binding energy relative to that in the vicinity of the Si 2nd-layer. These results are direct evidence of the transfer of negative charge from the Si 2nd-layer to the Si up-atoms. (author)

Quantifying siting difficulty: a case study of US transmission line siting

Energy Technology Data Exchange (ETDEWEB)

Vajjhala, S.P. [Resources for the Future, Washington DC (United States); Fischbeck, P.S. [Carnegie Mellon University, Pittsburgh, PA (United States). Departments of Social and Decision Sciences and Engineering and Public Policy

2007-01-15

The worldwide demand for new energy infrastructures has been paralleled in recent years by the increasing difficulty of siting major facilities. Siting difficulty is the subject of widespread discussion, but because of the complexity of the problem, potential solutions are not obvious or well understood. This paper presents a two-step policy-level framework that first develops an empirical measure of siting difficulty and then qualitatively assesses its major causes. The approach is based on the creation and aggregation of four siting indicators that are independent of the common causes and localized effects of siting problems. The proposed framework is demonstrated for the case of US transmission line siting. Results of the analyses reveal significant variations in state siting difficulty and industry experts' perceptions of its dominant causes, with implications for the long-term success of Regional Transmission Organizations (RTOs) and knowledge transfer among siting professionals in the deregulated industry. (author)

Soil and water pollution studies from a waste site deposit in Bantama, Kumasi, Ghana using magnetic susceptibility measurements

International Nuclear Information System (INIS)

Hadi, M.; Preko, K.; Ashia, T.

2012-01-01

The magnetic susceptibility of soil and water samples from around the Uadara barracks waste site deposit in Bantama, a suburb of Kumasi was measured with the aim of investigating the potential threat of pollution to the soil, streams, fish ponds and other water sources at the site around Armed Forces Senior High School campus which shares the same premises with the barracks. The studied soil samples were picked from the near surface (∼10 cm depth) along profiles taken from the waste site towards the stream and the ponds. Again, water samples were picked along the stream and from ten (10) ponds aligned along the stream. Laboratory measurements of the magnetic susceptibility were done using the Bartington MS2 metre and the MS2B dual frequency sensor for the soil samples, and the MS2G sensor for the water samples. The soil samples from the site registered an average magnetic susceptibility of 180. 04 x 10 -5 SI whereas the water samples recorded an average of -2.3 x 10 -6 SI showing a significant increment in comparison with the standard water magnetic susceptibility of -9.04 x 10 -6 SI. Thus, not withstand the lithology of the area studied, the presence of heavy metals and other chemical waste materials form the Uadara barracks garbage deposit site were found to greatly pollute the soil and particularly the water bodies around the Armed Forces Senior High School. (au)

Corrective Action Investigation Plan for Corrective Action Unit 569: Area 3 Yucca Flat Atmospheric Test Sites Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Patrick Matthews; Christy Sloop

2012-02-01

Corrective Action Unit (CAU) 569 is located in Area 3 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 569 comprises the nine numbered corrective action sites (CASs) and one newly identified site listed below: (1) 03-23-09, T-3 Contamination Area (hereafter referred to as Annie, Franklin, George, and Moth); (2) 03-23-10, T-3A Contamination Area (hereafter referred to as Harry and Hornet); (3) 03-23-11, T-3B Contamination Area (hereafter referred to as Fizeau); (4) 03-23-12, T-3S Contamination Area (hereafter referred to as Rio Arriba); (5) 03-23-13, T-3T Contamination Area (hereafter referred to as Catron); (6) 03-23-14, T-3V Contamination Area (hereafter referred to as Humboldt); (7) 03-23-15, S-3G Contamination Area (hereafter referred to as Coulomb-B); (8) 03-23-16, S-3H Contamination Area (hereafter referred to as Coulomb-A); (9) 03-23-21, Pike Contamination Area (hereafter referred to as Pike); and (10) Waste Consolidation Site 3A. Because CAU 569 is a complicated site containing many types of releases, it was agreed during the data quality objectives (DQO) process that these sites will be grouped. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each study group. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the DQOs developed on September 26, 2011, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO

Anion Binding Studies on Receptors Derived from the Indolo[2,3-a]carbazole Scaffold Having Different Binding Cavity Sizes

Directory of Open Access Journals (Sweden)

Guzmán Sánchez

2014-07-01

Full Text Available The indolo[2,3-a]carbazole scaffold is a fused polyheteroaromatic system bearing two NH groups which suitably converge as hydrogen bond donor sites for the recognition of anions. A simple derivatisation of the indolocarbazole system at positions 1 and 10 with different functional groups, namely alcohols and amides, has contributed to modulate the anion binding selectivity and sensibility. A particularly good response has been obtained for the benzoate anion.

Plasma intact fibroblast growth factor 23 levels in women with bulimia nervosa: A cross-sectional pilot study

Directory of Open Access Journals (Sweden)

Yoshiuchi Kazuhiro

2011-06-01

Full Text Available Abstract Fibroblast growth factor (FGF 23, a circulating 26-kDa peptide produced by osteogenic cells, is a novel phosphaturic factor. In our previous study, binge-eating/purging type anorexia nervosa (AN-BP patients had elevated plasma intact FGF23 (iFGF23 levels, while restricting type (AN-R patients had plasma iFGF23 levels similar to healthy controls. Although bulimia nervosa (BN patients as well as some patients with AN-BP regularly engage in binge eating, there have been no studies regarding plasma iFGF23 levels in BN patients. Therefore, this study was performed to determine plasma iFGF23 concentrations in BN patients and healthy controls. The study population consisted of 13 female BN patients and 11 healthy female controls. Blood samples were collected from all subjects after overnight fasting. Plasma iFGF23 was measured using an ELISA kit in a cross-sectional manner. The two-tailed Mann-Whitney U-test was used to assess differences between BN patients and healthy controls. In addition, BN patients were divided into two groups based on questionnaire-reported binge eating frequency immediately prior to participation in this study: high frequency of binge eating (once a week or more; HF group; n = 8 and low frequency of binge eating (less than once a week; LF group; n = 5. Two-tailed Mann-Whitney U-test with Bonferroni's correction was performed after the Kruskal-Wallis test to assess differences between HF group, LF group, and healthy controls. Median (quartiles plasma iFGF23 levels were greater in BN patients (35.5 [14.8-65.0] pg/ml than in controls (3.8 [not detected-5.3] pg/ml; p = 0.002. In addition, median (quartiles plasma iFGF23 levels were greater in the HF group (62.3 [44.4-73.4] pg/ml than in controls (p

Annual Report RCRA Post-Closure Monitoring and Inspections for CAU 112: Area 23 Hazardous Waste Trenches, Nevada Test Site, Nevada, for the Period October 1999-October 2000

Energy Technology Data Exchange (ETDEWEB)

D. F. Emer

2001-03-01

This annual Neutron Soil Moisture Monitoring report provides an analysis and summary for site inspections, meteorological information, and neutron soil moisture monitoring data obtained at the Area 23 Hazardous Waste Trenches Resource Conservation and Recovery Act (RCRA) unit, located in Area 23 of the Nevada Test Site, Nye County, Nevada, during the October 1999-October 2000 period. Inspections of the Area 23 Hazardous Waste Trenches RCRA unit are conducted to determine and document the physical condition of the covers, facilities, and any unusual conditions that could impact the proper operation of the waste unit closure. Physical inspections of the closure were completed quarterly and indicated that the site is in good condition with no significant findings noted. An annual subsidence survey of the elevation markers was conducted in August 2000. There has been no subsidence at any of the markers since monitoring began seven years ago. The objective of the neutron logging program is to monitor the soil moisture conditions along 30 neutron access tubes and detect changes that maybe indicative of moisture movement at a point located directly beneath each trench. Precipitation for the period October 1999 through October 2000 was 10.44 centimeters (cm) (4.11 inches [in.]) (U.S. National Weather Service, 2000). The prior year annual rainfall (January 1999 through December 1999) was 10.13cm (3.99 in.). The highest 30-day cumulative rainfall occurred on March 8, 2000, with a total of 6.63 cm (2.61 in.). The heaviest daily precipitation occurred on February 23,2000, with a total of 1.70 cm (0.67 in.) falling in that 24-hour period. The recorded average annual rainfall for this site, from 1972 to January 1999, is 15.06 cm (5.93 in.). All monitored access tubes are within the compliance criteria of less than 5 percent residual volumetric moisture content at the compliance point directly beneath each respective trench. Soil conditions remain dry and stable underneath the

Detailed site characterization for final disposal of spent fuel in Finland - Case study Loviisa

Energy Technology Data Exchange (ETDEWEB)

Anttila, P. [IVO Power Engineering Ltd. (Finland); Ahokas, H.; Ruotsalainen, P. [Fintact Oy (Finland); Cosma, C.; Keskinen, J. [Vibrometric Oy (Finland); Hinkkanen, H. [Posiva Oy (Finland); Rouhiainen, P. [PRG-Tec Oy (Finland); Oehberg, A. [Saanio and Riekkola Consulting Engineers (Finland)

1998-09-01

The spent fuel from the Finnish nuclear power plants will be disposed of in the Finnish bedrock. Pos iva Oy is responsible for the site selection programme carried out in accordance with the governmental decisions. Preliminary site investigations were made in five areas in 1987-1992. Based on the results, three areas, Romuvaara in Kuhmo, Kivetty in Aeaenekoski and Olkiluoto in Eurajoki, were selected for the detailed site characterization in 1993-2000. The final site will be selected by the end of the year 2000. The interim reporting of the detailed studies of the three areas was made in 1996. In 1997, the island of Haestholmen, as the host to the Loviisa NPP, was included as a fourth candidate site in the programme for the detailed site investigations. The goal is to characterize this site also in detail by the end of 2000 to attain the same level of knowledge as available from the three other sites. The background information existing from the studies made for the construction of the repository for the low-and intermediate-level wastes will create a good basis to reach the target. The research programme for the detailed site characterization has mainly been focused on groundwater flow and geochemistry due to their importance in terms of long-term safety of the repository. Equipment and methodology development by Posiva has introduced new tools that provide more accurate data on relevant parameters than the ones used in previous stages of site characterization. The programme also contains studies for additional information of the structural and geological properties of the bedrock towards the depth. Also predictive modelling has been made for evaluating the relevance of the assumptions made. The methods applied in the site characterization have comprised, e.g., geological mapping, deep core drilling, groundwater sampling and analyzing, hydraulic testing and geophysical measurements 23 refs, 4 figs

Oxazolidinone resistance mutations in 23S rRNA of Escherichia coli reveal the central region of domain V as the primary site of drug action

DEFF Research Database (Denmark)

Xiong, L; Kloss, P; Douthwaite, S

2000-01-01

Oxazolidinone antibiotics inhibit bacterial protein synthesis by interacting with the large ribosomal subunit. The structure and exact location of the oxazolidinone binding site remain obscure, as does the manner in which these drugs inhibit translation. To investigate the drug-ribosome interaction......, we selected Escherichia coli oxazolidinone-resistant mutants, which contained a randomly mutagenized plasmid-borne rRNA operon. The same mutation, G2032 to A, was identified in the 23S rRNA genes of several independent resistant isolates. Engineering of this mutation by site-directed mutagenesis...

Corrective Action Decision Document/Closure Report for Corrective Action Unit 105: Area 2 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Matthews, Patrick

2013-09-01

This Corrective Action Decision Document/Closure Report presents information supporting the closure of Corrective Action Unit (CAU) 105: Area 2 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada. CAU 105 comprises the following five corrective action sites (CASs): -02-23-04 Atmospheric Test Site - Whitney Closure In Place -02-23-05 Atmospheric Test Site T-2A Closure In Place -02-23-06 Atmospheric Test Site T-2B Clean Closure -02-23-08 Atmospheric Test Site T-2 Closure In Place -02-23-09 Atmospheric Test Site - Turk Closure In Place The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation that no further corrective action is needed for CAU 105 based on the implementation of the corrective actions. Corrective action investigation (CAI) activities were performed from October 22, 2012, through May 23, 2013, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 105: Area 2 Yucca Flat Atmospheric Test Sites; and in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices.

Fibroblast growth factor-23 and phosphorus related factors in young Japanese women: a cross-sectional study.

Science.gov (United States)

Ito, Sanae; Ishida, Hiromi; Uenishi, Kazuhiro

2016-01-01

Phosphorus homeostasis is determined by dietary intake, intestinal absorption, and renal tubular reabsorption of phosphorus. Serum fibroblast growth factor-23 (FGF-23) is considered to be a sensitive early biomarker of disordered phosphorus metabolism in both patients with chronic kidney diseases and healthy subjects. However, the number of studies evaluating serum FGF-23 concentrations in healthy subjects is limited. The objective of this cross-sectional study was to examine the relationship between serum FGF-23 concentrations and phosphorus related factors in 182 young Japanese women (mean age, 19.5±0.4 years). We found that higher serum concentrations of inorganic phosphorus and lower serum concentrations of 1,25-dihydroxy vitamin D as well as lower fat but higher phosphorus and calcium intake were weakly but significantly associated with high serum concentrations of FGF-23, adjusted for postmenarcheal age and body weight. These results suggested that in young Japanese women, serum FGF-23 might be indicative of phosphorus nutrition status. However, it is worthy of note that maturity factors, including postmenarcheal age and physical attributes, such as body weight, might be related to serum FGF-23 concentrations.

[Post-operative pain after ultrasound transversus abdominis plane block versus trocar site infiltration in laparoscopic nephrectomy: a prospective study].

Science.gov (United States)

Araújo, Ana M; Guimarães, Joana; Nunes, Catarina S; Couto, Paula S; Amadeu, Eduarda

Transversus abdominis plane (TAP) block is useful in reducing post-operative pain in laparoscopic nephrectomy compared to placebo. The purpose of this work is to compare post-operative pain and recovery after TAP block or trocar site infiltration (TSI) in this surgery. A prospective, single blinded study on patients scheduled for laparoscopic nephrectomy. Patients were assigned to two groups: TSI Group: trocar site infiltration at the end of surgery; TAP Group: unilateral ultrasound-guided TAP block after induction. Sevoflurane and remifentanil, in a target controlled infusion mode, were used for maintenance of general anesthesia. Before the end of surgery paracetamol, tramadol and morphine were administered. Visual analogue scale (VAS 0-100mm) at rest and with cough was applied in three moments: in recovery room (T1 at admission and T2 before discharge) and 24h after surgery (T3). Pain scores with incentive spirometer were also evaluated at T3. In recovery, morphine was administered as a rescue drug whenever VAS>30mm. Time to oral intake, chair sitting, ambulation and length of hospital stay were evaluated 24h after surgery. Student's t-test and Chi-square test, and linear regression models. A p-value0.05). VAS at rest (TAP vs. TSI groups) was: T1=33±29 vs. 39±32, T2=10±9 vs. 17±18 and T3=7±12 vs. 10±18. VAS with cough (TAP vs. TSI groups) was: T1=51±34 vs. 45±32, T2=24±24 vs. 33±23 and T3=20±23 vs. 23±23. VAS with incentive spirometer (TAP vs. TSI groups) was: T3=21±27 vs. 21±25. Intraoperative remifentanil consumption was similar between TAP (0.16±0.07mcg.kg -1 .min -1 ) and TSI (0.18±0.9mcg.kg -1 .min -1 ) groups. There were no differences in opioid consumption between TAP (4.4±3.49mg) and TSI (6.87±4.83mg) groups during recovery. Functional recovery parameters were not statistically different between groups. Multimodal analgesia with TAP block did not show a significant clinical benefit compared with trocar site infiltration in laparoscopic

Post-operative pain after ultrasound transversus abdominis plane block versus trocar site infiltration in laparoscopic nephrectomy: a prospective study

Directory of Open Access Journals (Sweden)

Ana M. Araújo

Full Text Available Abstract Background Transversus abdominis plane (TAP block is useful in reducing post-operative pain in laparoscopic nephrectomy compared to placebo. The purpose of this work is to compare post-operative pain and recovery after TAP block or trocar site infiltration (TSI in this surgery. Methods A prospective, single blinded study on patients scheduled for laparoscopic nephrectomy. Patients were assigned to two groups: TSI Group: trocar site infiltration at the end of surgery; TAP Group: unilateral ultrasound-guided TAP block after induction. Sevoflurane and remifentanil, in a target controlled infusion mode, were used for maintenance of general anesthesia. Before the end of surgery paracetamol, tramadol and morphine were administered. Visual analogue scale (VAS 0-100 mm at rest and with cough was applied in three moments: in recovery room (T1 at admission and T2 before discharge and 24 h after surgery (T3. Pain scores with incentive spirometer were also evaluated at T3. In recovery, morphine was administered as a rescue drug whenever VAS > 30 mm. Time to oral intake, chair sitting, ambulation and length of hospital stay were evaluated 24 h after surgery. Statistical analysis: Student's t-test and Chi-square test, and linear regression models. A p-value 0.05. VAS at rest (TAP vs. TSI groups was: T1 = 33 ± 29 vs. 39 ± 32, T2 = 10 ± 9 vs. 17 ± 18 and T3 = 7 ± 12 vs. 10 ± 18. VAS with cough (TAP vs. TSI groups was: T1 = 51 ± 34 vs. 45 ± 32, T2 = 24 ± 24 vs. 33 ± 23 and T3 = 20 ± 23 vs. 23 ± 23. VAS with incentive spirometer (TAP vs. TSI groups was: T3 = 21 ± 27 vs. 21 ± 25. Intraoperative remifentanil consumption was similar between TAP (0.16 ± 0.07 mcg.kg-1.min-1 and TSI (0.18 ± 0.9 mcg.kg-1.min-1 groups. There were no differences in opioid consumption between TAP (4.4 ± 3.49 mg and TSI (6.87 ± 4.83 mg groups during recovery. Functional recovery parameters were not statistically different between groups. Conclusions Multimodal

Corrective Action Investigation Plan for Corrective Action Unit 568: Area 3 Plutonium Dispersion Sites Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Matthews, Patrick

2014-01-01

CAU 568 is a grouping of sites where there has been a suspected release of contamination associated with nuclear testing. This document describes the planned investigation of CAU 568, which comprises the following corrective action sites (CASs): • 03-23-17, S-3I Contamination Area • 03-23-19, T-3U Contamination Area • 03-23-20, Otero Contamination Area • 03-23-22, Platypus Contamination Area • 03-23-23, San Juan Contamination Area • 03-23-26, Shrew/Wolverine Contamination Area These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the investigation report.

Bacterial meningoencephalomyelitis in dogs: a retrospective study of 23 cases (1990-1999).

Science.gov (United States)

Radaelli, Simona T; Platt, Simon R

2002-01-01

The clinical records of 23 dogs (1990-1999) with histopathologically confirmed bacterial meningoencephalomyelitis were evaluated retrospectively. No breed, age, sex, or weight predisposition was found. All the dogs presented with clinical signs of a brain lesion, whereas 5 of 23 had neck pain. Pyrexia was detected in 11 of 23 dogs on admission. CBCs revealed neutrophilic leucocytosis in 7 of 21 dogs and thrombocytopenia in 3 of 21 dogs. The serum chemistry profiles were abnormal in 15 of 21 dogs. The results of cerebrospinal fluid (CSF) analysis were abnormal in 13 of 14 dogs and aerobic CSF culture was positive for bacteria in 1of 8 samples. At postmortem examination, the lesions were localized to the central nervous system. Escherichia coli, Streptococcus, and Klebsiella spp were the most frequently isolated bacteria from cultures collected at postmortem examination. Twelve papers reporting 51 total clinical cases of canine bacterial meningoencephalomyelitis were reviewed. The clinical signs and results of the CBC, serum chemistry, blood culture, and CSF analysis were collated and compared with those of this study. The results of the CSF analysis in this study were similar to those in the literature. CSF cultures documented in the literature were positive for Staphylococcus, Pasteurella. Actinomyces, Nocardia spp, and various anaerobic species including Peptostreptococcus, Eubacterium, and Bacteroides spp.

Nuclear site selection studies

International Nuclear Information System (INIS)

Gharib, A.; Zohoorian Izadpanah, A.A.; Iranmanesh, H.

2000-01-01

It is of special importance, especially from the nuclear safety viewpoint, to select suitable sites for different nuclear structures with the considered future activities. Site selection sometimes involves high costs not necessarily for merely selecting of site but for some preliminary measures to be taken so as the site may have the necessary characteristics. The more suitable the natural characteristics of the site for the considered project, the more successful and efficient the project, the lower the project costs and the longer the project operation period. If so, the project will cause the growth of public culture and sustainable socioeconomic development. This paper is the result of the conclusion of numerous massive reports of this activity in the preliminary phase based on theories, practices and the related safety principles on this ground as well as the application of data and information of the past and a glance to the future. The conception of need for a site for medium structures and nuclear research projects and how to perform this process are presented step by step here with a scientific approach to its selection during the investigations. In this study, it is practically described how the site is selected, by determining and defining the characteristics of research and nuclear projects with medium structures and also its fitting to the optimum site. The discovered sites typically involve the best advantages in technical and economic aspects and no particular contrast with the concerned structures

IMMUNOGENICITY AND SAFETY OF 23-VALENT POLYSACCHARIDE PNEUMOCOCCAL VACCINE IN PATIENTS WITH RHEUMATOID ARTHRITIS: RESULTS OF A TWO-YEAR FOLLOW-UP STUDY

Directory of Open Access Journals (Sweden)

M. S. Naumtseva

2016-01-01

Full Text Available Objective: to investigate the immunogenicity, safety, and clinical efficacy of 23-valent polysaccharide pneumococcal vaccine in patients with rheumatoid arthritis (RA during a two-year follow-up study.Subjects and methods. The prospective open-label comparative study enrolled 110 people, of them there were 81 (73.6% women and 29 (26.4% men at the age of 23 to 76 years, including 79 patients with RA, as well as 31 subjects without systemic inflammatory rheumatic diseases (RD (a control group. The group of RA patients exhibited a predominance of middle-aged women who had > 3 years’ disease duration and a moderate inflammatory activity (the mean value of DAS28, 4.32. 52 patients received methotrexate (MTX, 14 had Leflunomide (LEF, and 13 were treated with tumor necrosis factor-α (TNF-α inhibitors + MTX.The 23-valent polysaccharide pneumococcal vaccine Pneumo-23 (Sanofi Pasteur, France was administered in a single dose of 0.5 ml subcutaneously during continuous MTX or LEF therapy for the underlying disease or 3–4 weeks before the use of TNF-α inhibitors. Clinical examinations of the patient and conventional clinical and laboratory studies were performed during control visits (1, 3, 12, and 24 months after vaccination. Clinical effectiveness and safety were evaluated in all the patients included in the study. The serum levels of anti-pneumococcal capsular polysaccharide antibodies (Ab were measured in 72 patients with RA and in 30 individuals in the control group during a 12-month follow-up study, including in 25 patients with RA for a 24-month follow-up study by enzyme immunoassay using commercial VaccZymeTM Anti-PCP IgG Enzyme Immunoassay kits (The Binding Site Group Ltd, Birmingham, United Kingdom. Along with this, the post-immunization response coefficient was calculated for each patient as the ratio of postvaccination Ab levels during Visits 2, 3, 4, and 5 to the baseline Ab level. Results and discussion. No clinical and

ITER site selection studies in Spain

International Nuclear Information System (INIS)

Medrano, M.; Alejaldre, C.; Doncel, J.; Garcia, A.; Ibarra, A.; Jimenez, J.A.; Sanchez de Mora, M.A.; Alcala, F.; Diez, J.E.; Dominguez, M.; Albisu, F.

2003-01-01

The studies carried out to evaluate and select a candidate site for International Thermonuclear Experimental Reactor (ITER) construction in Spain are presented in this paper. The ITER design, completed in July 2001, considered a number of technical requirements that must be fulfilled by the selected site. Several assumptions concerning the ITER site were made in order to carry on the design before final site selection. In the studies undertaken for ITER site selection in Spain, the referred technical requirements and assumptions were applied across the whole of Spain and two areas were identified as being preferential. These areas are on the Mediterranean coast and are situated in the Catalan and Valencian regions. A comparative evaluation based on technical characteristics for the concrete plots, proposed within the preferential areas, has been done. The result of these studies was the selection of a site that was deemed to be the most competitive--Vandellos (Tarragona)--and it was proposed to the European Commission for detailed studies in order to be considered as a possible European site for ITER construction. Another key factor for hosting ITER in Spain, is the licensing process. The present status is summarised in this paper

23 CFR 630.1002 - Purpose.

Science.gov (United States)

2010-04-01

... highway infrastructure and growing congestion in many locations. Addressing these safety and mobility... the Code of Federal Regulations at 23 CFR part 655. It is available on the FHWA's Web site at http...

Site and feasibility studies of a first nuclear power plant in Morocco

International Nuclear Information System (INIS)

Righi, M.

1988-11-01

Basing on the estimated studies related to the evaluation of future needs of electrical energy, the launching of a nuclear power program in Morocco is confirmed necessary. A complete study of sites and feasibility has been carried out. Taking into account the site selection factors two sites: BIR ELHAR and SIDI BOULBRA have been kept as candidate sites. The evaluation of seismic and geotechnical risks of the power plant impact on the environment and risks related to human activities has led to privilege the SIDI BOULBRA site. The studies for confirming this site are summarized. 4 figs. (F.M.)

Corrective Action Investigation Plan for Corrective Action Unit 137: Waste Disposal Sites, Nevada Test Site, Nevada, Rev. No.:0

Energy Technology Data Exchange (ETDEWEB)

Wickline, Alfred

2005-12-01

This Corrective Action Investigation Plan (CAIP) contains project-specific information including facility descriptions, environmental sample collection objectives, and criteria for conducting site investigation activities at Corrective Action Unit (CAU) 137: Waste Disposal Sites. This CAIP has been developed in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S. Department of Defense. Corrective Action Unit 137 contains sites that are located in Areas 1, 3, 7, 9, and 12 of the Nevada Test Site (NTS), which is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Corrective Action Unit 137 is comprised of the eight corrective action sites (CASs) shown on Figure 1-1 and listed below: (1) CAS 01-08-01, Waste Disposal Site; (2) CAS 03-23-01, Waste Disposal Site; (3) CAS 03-23-07, Radioactive Waste Disposal Site; (4) CAS 03-99-15, Waste Disposal Site; (5) CAS 07-23-02, Radioactive Waste Disposal Site; (6) CAS 09-23-07, Radioactive Waste Disposal Site; (7) CAS 12-08-01, Waste Disposal Site; and (8) CAS 12-23-07, Waste Disposal Site. The Corrective Action Investigation (CAI) will include field inspections, radiological surveys, geophysical surveys, sampling of environmental media, analysis of samples, and assessment of investigation results, where appropriate. Data will be obtained to support corrective action alternative evaluations and waste management decisions. The CASs in CAU 137 are being investigated because hazardous and/or radioactive constituents may be present in concentrations that could potentially pose a threat to human health and the environment. Existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives for the CASs. Additional information will be generated by conducting a CAI before evaluating and selecting

Effect of short-term strenuous exercise on erythrocyte 2,3-diphosphoglycerate in untrained men: a time-course study.

Science.gov (United States)

Odje, O E; Ramsey, J M

1995-01-01

The literature on the response of erythrocyte 2,3-diphosphoglycerate (2,3-DPG) following exercise is replete with inconsistencies, and recent studies have shown that the time of blood sampling during and following exercise, as well as the duration of exercise, are important in evaluating the response of 2,3-DPG. Experiments were designed to measure the response of 2,3-DPG following short-term strenuous exercise in two groups of untrained men. Twelve men, 19-22 years old (study 1), exercised on a bicycle ergometer at 122.5 W for 10 min and red blood cell (RBC) 2,3-DPG was measured at 0 and 50 min following exercise. The level of 2,3-DPG (mumol.ml-1 RBC) increased after exercise (P < 0.05), but this increase was not significant when 2,3-DPG was expressed as mol.mol-1 hemoglobin (Hb). However, following 50 min of rest, 2,3-DPG (mol.mol-1 Hb) decreased significantly. In a second group (study 2), nine other men, aged 18-19 years, exercised at the same workload for 15 min and 2,3-DPG was measured at 0, 30, 60, 180, and 330 min respectively after exercise, and no significant mean changes in the level of the phosphate were observed. Findings from these studies suggest that 2,3-DPG does not provide a compensatory adjustment to facilitate oxygen delivery in the hypoxia of short-term strenuous exercise in untrained males immediately following exercise and when recovery intervals of up to 330 min are also examined. It is suggested that 2,3-DPG be reported as mol.mol-1 Hb, since the phosphate exists on Hb in an equimolar ratio in normal physiological states.

Lionfish string experiences of an inland poison center: a retrospective study of 23 cases.

Science.gov (United States)

Trestrail, J H; al-Mahasneh, Q M

1989-04-01

From January 1979 through March 1988, our regional poison center, located many hundreds of miles from the nearest coastal salt water, documented 23 cases of envenomation by "Lionfish" (members of genus Pterois). All cases involved specimens which were maintained in the homes of amateur aquarists. A study of patient epidemiology showed the following: patient's sex 91.3% male, 8.7% female; patients ages ranged from 17 to 50 years with an average age for males of 29.8 years and 35 years for females; the site of the envenomation accident was always in the home; the only part of the body envenomated was the hand or finger; and all of the patients were symptomatic. Symptoms noted included sharp pain, swelling, redness, bleeding, nausea, numbness, joint pain, anxiety, headache, disorientation, and dizziness. One patient had a complication of cellulitis. Treatment provided included immersion of the effected area in hot water at 40 C for 60 to 90 min, analgesics, tetanus toxoid, and antibiotics. There were no deaths noted and treatment proved effective in all cases. This paper also discusses the natural history, clinical effects, and current treatment for envenomations from these beautiful but dangerous venomous fish, which can cause poisoning exposures that are likely to be encountered by poison centers anywhere in the world.

SITE: a methodology for assessment of energy facility siting patterns. Regional studies program

International Nuclear Information System (INIS)

Frigerio, N.A.; Habegger, L.J.; King, R.F.; Hoover, L.J.; Clark, N.A.; Cobian, J.M.

1975-08-01

The timely development of the nation's energy production capacity in a manner that minimizes potential adverse local and regional impacts associated with energy facilities requires the use of sophisticated techniques for evaluation of siting alternatives and fuel cycle options. This report is a documentation of the computerized SITE methodology that has been developed for evaluating health, environmental, and socioeconomic impacts related to utilization of alternate sites for energy production within a region of interest. The cost, impact, and attribute vectors, which are generated and displayed on density maps, can be used in a multiparameter overlay process to identify preferable siting areas. The assessment of clustered facilities in energy centers is also possible within the SITE analysis framework. An application of the SITE methodology to Northern Illinois is presented. Also included is a description of the ongoing extension of SITE for the accumulative evaluation of alternative regional energy siting patterns and fuel cycle options. An appendix provides documentation and user information for the SITE computer program

Salmonellosis in Equidae: a study of 23 cases.

Science.gov (United States)

Morse, E V; Duncan, M A; Page, E A; Fessler, J F

1976-04-01

Salmonellosis in Equidae is a serious global problem. The prevalence may range from 0.36% to 27%. Probably 5% to 10% of the equine population in the U.S. is or has been infected. Over 40 serotypes of Salmonella have been cultured from Equidae. S. typhimurium (66.31%), S. enteritidis (9.6%), S. newport (5.16%) and S. heidelberg (4.89%) have been the most common equine isolates. The clinical and bacteriological studies of 23 naturally occurring infections in a large veterinary hospital were studied. Nine patients were infected with S. typhimurium, 8 with S. anatum, 1 with S. newport, 4 with dual serotype infections (3-S. typhimurium/S. anatum and 1 S. anatum/S. newington) and 1 untyped Salmonella. The roles of physical, surgical and environmental stress factors were analyzed. The fecal shedder state persisted for over 3 1/2 months. Feces of a foal contained 10(5) salmonella per gram. Salmonella were isolated from the feces of horses during and following antimicrobial therapy regimes. Supportive and symptomatic treatment as well as good nursing care are imperative in handling cases of equine salmonellosis.

Feasibility study for siting of a deep repository within the Storuman municipality

International Nuclear Information System (INIS)

1995-01-01

It is SKB's task to gather a broad body of information for the siting of a deep repository for Sweden's spent nuclear fuel and other long-lived radioactive waste. The criteria presented by SKB serve as guidelines for the siting studies. Overviews of siting factors are compiled in general siting studies of all or parts of Sweden. Feasibility studies examine the siting prospects in potentially suitable and interested municipalities. SKB plans to carry out feasibility studies in five to ten municipalities in different parts of the country. General studies and feasibility studies are primarily based on existing material. The feasibility study in Storuman is the first to be conducted. It began during the second half of 1993 with the conclusion of an agreement between the municipality and SKB. SKB has been in charge of the execution of the feasibility study. SKB has been responsible for the summary provided in a status report published in June 1994, as well as for the conclusions and evaluations in this final report. Altogether about 30 reports have been published within the framework of the feasibility study. The purpose of the various studies have been to describe, in as much detail as possible, the prospects for siting a deep repository in the municipality of Storuman, and to shed light on the possible positive and negative consequences of such a siting. The feasibility study has led to a discussion within the municipality and the region concerning the siting of a deep repository. In SKB's opinion, this gives all those concerned ample opportunity to become acquainted with the issues and to assert their interests and present their viewpoints at an early stage. 55 refs

A qualitative exploratory study: Using medical students' experiences ...

African Journals Online (AJOL)

2012-08-23

Aug 23, 2012 ... There is recognition of the importance of qualitative research on incentives ... an attribute, such as personality type; and secondly does ... Method. Study site. The study site was a rural district-level hospital in KwaZulu-. Natal.

A microseismic study in a low seismicityarea: the 2001 site-response experimentin the Città di Castello Basin (Italy

Directory of Open Access Journals (Sweden)

A. Michelini

2003-06-01

Full Text Available A site response experiment was performed in the basin of Città di Castello (a small town in Central Italy in May 2001. This study is part of a project on the evaluation of seismic hazard in seismogenic areas funded by the Gruppo Nazionale Difesa dai Terremoti (GNDT. The experiment consisted of a dense fixed transect configuration with most of the stations recording in continuous mode, and several ambient noise measurements both in single station and in array configuration spread over the investigated area. The dense transect was composed of 26 seismic stations in a crosswise configuration with a maximum inter-station distance of 250 m. The stations were deployed in the southern part of the basin, from the eastern bedrock outcrop to the western edge, across the town. About 70 earthquakes were recorded during 10 days of deployment, generally low magnitude or regional events. We located 23 earthquakes and 17 of them were located using the waveform similarity approach at 4 stations outside the target area. These 4 stations were part of a dense temporary seismic network involved in a previous experiment of the same project, aimed at performing a high-resolution picture of the local seismicity. Delay analysis on the recorded waveforms allowed us to infer the basin geometry at depth and estimate the S-wave velocity of sediments. Moreover, we evaluated relative site response along the E-W transect by performing a standard spectral ratio. Amplification factors up to 9 are found inside the basin; at frequencies above 5 Hz stations closer to the edges show higher amplification, whereas stations located in the middle of the basin, where the alluvial sediments are thicker (CD11-CD14, show higher amplification below 5 Hz. We considered the average amplification in two frequency bands (1-5 Hz and 5-10 Hz, representative of the resonance frequency for 2-3 storey buildings and 1 storey houses,respectively. Our results suggest that the potential hazard for 2-3

Annual Report RCRA Post-Closure Monitoring and Inspections for CAU 112: Area 23 Hazardous Waste Trenches, Nevada Test Site, Nevada, for the period October 2000-July 2001

International Nuclear Information System (INIS)

Tobiason, D. S.

2002-01-01

This annual Neutron Soil Moisture Monitoring report provides an analysis and summary for site inspections, meteorological information, and neutron soil moisture monitoring data obtained at the Area 23 Hazardous Waste Trenches Resource Conservation and Recovery Act (RCRA) unit, located in Area 23 of the Nevada Test Site, Nye County, Nevada, during the October 2000--July 2001 monitoring period. Inspections of the Area 23 Hazardous Waste Trenches RCRA unit are conducted to determine and document the physical condition of the covers, facilities, and any unusual conditions that could impact the proper operation of the waste unit closure. Physical inspections of the closure were completed quarterly and indicated that the site is in good condition with no significant findings noted. An annual subsidence survey of the elevation markers was conducted in July 2001. There has been no subsidence at any of the markers since monitoring began eight years ago. Precipitation for the period October 2000 through July 2001 was 9.42 centimeters (cm) (3.71 inches [in]) (U.S. National Weather Service, 2001). The prior year annual rainfall (January 2000 through December 2000) was 10.44 cm (4.1 1 in.). The recorded average annual rainfall for this site from 1972 to January 2000 is 14.91 cm (5.87 in.). The objective of the neutron logging program is to monitor the soil moisture conditions along 30 neutron access tubes and detect changes that may be indicative of moisture movement at a point located directly beneath each trench. All monitored access tubes are within the compliance criteria of less than 5 percent residual volumetric moisture content at the compliance point directly beneath each respective trench. Soil conditions remain dry and stable underneath the trenches

The increasing incidence of paranasal organizing hematoma: a 20-year experience of 23 cases at a single center.

Science.gov (United States)

Kim, Jong Seung; Oh, Jong Seok; Kwon, Sam Hyun

2016-06-01

Sinonasal organized hematoma is a rare, benign disease that can be locally aggressive and may be mistaken for malignancy. Because of its rarity, the clinical characteristics are not well known. The aim of this study is to investigate the distinguishing features of organized hematoma with an emphasis on incidence change. In this retrospective study, we reviewed the records of 23 patients with organized hematoma confirmed histopathologically among 5,378 patients who underwent endoscopic sinus surgery performed by a single surgeon from January 1995 to December 2014 at a tertiary care center. Clinical symptoms, endoscopic photography, computed tomography, and operative findings were reviewed. We also reviewed the relevant literature. Age, sex, site, origin subsite and histopathology were investigated. A statistical review was performed using R 3.1.2 to examine incidence change. The most common complaint was frequent epistaxis and nasal obstruction (52.1%). Of the 23 patients, eight were women and 15 were men with an age range of 18 to 75 years. (mean 38.9 years). Nine of these hematomas occurred on the right side and 14 on the left side. The predominant occurrence site was the antrum (65%), followed by the septum (17.3%), inferior turbinate (8%), and ethmoid sinus (8%). The incidence steadily increased over 20 years. Investigation of the clinical characteristics and incidence change of organized hematoma can provide useful information. Through analysis of the 23 cases in our study, the age distribution was found to be bimodal and the incidence of organizing hematoma was observed to steadily increase. Clinicians should be aware of these characteristics to avoid misdiagnoses of malignant tumors.

Status of siting studies for a near surface repository site for radioactive wastes in the Philippines

International Nuclear Information System (INIS)

Valdezco, E.M.; Palattao, M.V.B.; Marcelo, E.A.; Caseria, E.S.; Venida, L.L.; Cruz, J.M. dela

2002-01-01

The Philippines, through the Philippine Nuclear Research Institute (PNRI), decided to conduct a study on siting a low level radioactive waste disposal facility. The infrastructure set up for this purpose, the radioactive waste disposal concept, the overall siting process, the methodology applied and preliminary results obtained are described in this paper. (author)

Feasibility study for siting of a deep repository within the Storuman municipality

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-01-01

It is SKB`s task to gather a broad body of information for the siting of a deep repository for Sweden`s spent nuclear fuel and other long-lived radioactive waste. The criteria presented by SKB serve as guidelines for the siting studies. Overviews of siting factors are compiled in general siting studies of all or parts of Sweden. Feasibility studies examine the siting prospects in potentially suitable and interested municipalities. SKB plans to carry out feasibility studies in five to ten municipalities in different parts of the country. General studies and feasibility studies are primarily based on existing material. The feasibility study in Storuman is the first to be conducted. It began during the second half of 1993 with the conclusion of an agreement between the municipality and SKB. SKB has been in charge of the execution of the feasibility study. SKB has been responsible for the summary provided in a status report published in June 1994, as well as for the conclusions and evaluations in this final report. Altogether about 30 reports have been published within the framework of the feasibility study. The purpose of the various studies have been to describe, in as much detail as possible, the prospects for siting a deep repository in the municipality of Storuman, and to shed light on the possible positive and negative consequences of such a siting. The feasibility study has led to a discussion within the municipality and the region concerning the siting of a deep repository. In SKB`s opinion, this gives all those concerned ample opportunity to become acquainted with the issues and to assert their interests and present their viewpoints at an early stage. 55 refs.

Division of Aquatic Resources (DAR), Division of Lands and Natural Resources (DLNR) of the State of Hawaii Fish Surveys from 23 West Hawaii Aquarium Project Sites during 1999-2005 (NODC Accession 0002767)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — Data are from underwater visual surveys of fish stocks at 23 sites in West Hawaii. Survey sites are 8 to 14 m deep and are all located on reef shelves with moderate...

A study of moult-site fidelity in Egyptian geese, Alopochen ...

African Journals Online (AJOL)

Little is known about moult and moult-site fidelity of African waterfowl. Satellite telemetry and uniquely engraved colour-rings were used to study moult-site fidelity of Egyptian geese marked at two sites in South Africa – Barberspan in the summer-rainfall region and Strandfontein in the winter-rainfall region. Twelve Egyptian ...

Technical procedures for the implementation of cultural resource site studies, Deaf Smith County, Texas: Preliminary draft

International Nuclear Information System (INIS)

1987-01-01

Cultural resources at the Deaf Smith County site will be identified, evaluated and managed through the implementation of studies detailed in the Site Study Plan for Cultural Resources. This technical procedure outlines the conduct of pedestrian survey and the documentation of identified cultural resources. The purpose of the field surveys is to identify and document cultural resources in the areas that will be affected by site characterization activities and to record the environmental setting of identified cultural resources. Three pedestrian surveys will cover 100 percent of the on-site and off-site project areas. Survey 1 will provide coverage of the Repository Surface Facility (RSF) area, which includes the Exploratory Shaft Facility (ESF) and two linear engineering design borehole (EDBH) seismic survey corridors. Survey 2 will provide coverage of a 39 km 2 (15 mi 2 ) area that includes the 23 km 2 (9 mi 2 ) Deaf Smith County site plus a 0.4 to 0.8 kM (1/4 to 1/2 mi) border area but excludes the area covered by Survey 1. Survey 3 will cover offsite geotechnical test areas, such as the locations of playa boreholes, deep playa wells, hydrologic tests, site foundation borings, and their access routes. The purpose of site documentation or recording is to address the project information needs for land use permits and approvals, engineering design support, and cultural resource evaluation for National Register of Historic Places eligibility. Site documentation will consist of gathering sufficient data on identified resources to complete Texas Natural Resource Information System (TNRIS). 7 refs., 3 figs

Both interleukin-23A polymorphism and serum interlukin-23 expression are associated with Graves' disease risk.

Science.gov (United States)

Jia, Huiying; Tao, Feng; Liu, Changqin; Guo, Ting; Zhu, Wei; Wang, Shu; Cui, Bin; Ning, Guang

2015-03-01

Two independent Chinese cohorts were used to study the genetic association between the interleukin-23A (IL-23A) gene polymorphism (rs11171806) and susceptibility to Graves' disease (GD). The initial Shanghai cohort consisted of 712 unrelated patients with GD and 705 healthy control subjects, and the replication cohort from Xiamen Island included 433 patients with GD and 410 healthy control subjects. The serum concentration of IL-23 in GD patients was measured significantly higher than in health controls. Moreover in the subgroup analysis, higher concentrations of IL-23 were identified in patients of older age (⩾40 years) and female gender. We also performed an association study with the IL-23 gene polymorphism rs11171806 in both cohorts, in Shanghai cohorts, the frequencies of rs11171806 alleles were strongly different between Graves' disease patients (G 95.7% and A 4.3%) and healthy controls (G 97.7% and A 2.3%) (P=2.6×10(-3), OR=1.93 (95% CI: 1.25-2.97)), and in Xiamen cohorts, the proportion of individuals carrying the A allele of rs11171806 was the same significantly higher in Graves' disease patients than in controls [Graves' disease vs. control, 4.8% vs. 4.3%, OR=2.15 (95% CI: 1.23-3.79), P(allele)=6.3×10(-3)]. The distribution of rs11171806 genotype was also investigated in subgroups according to the age and gender. All of these findings suggested that IL-23 may play an important role in the development of GD, and the IL-23A gene is a genetic risk marker for GD in Han Chinese population. Copyright © 2015 Elsevier Inc. All rights reserved.

Interaction of Carthamus tinctorius lignan arctigenin with the binding site of tryptophan-degrading enzyme indoleamine 2,3-dioxygenase☆

Science.gov (United States)

Temml, Veronika; Kuehnl, Susanne; Schuster, Daniela; Schwaiger, Stefan; Stuppner, Hermann; Fuchs, Dietmar

2013-01-01

Mediterranean Carthamus tinctorius (Safflower) is used for treatment of inflammatory conditions and neuropsychiatric disorders. Recently C. tinctorius lignans arctigenin and trachelogenin but not matairesinol were described to interfere with the activity of tryptophan-degrading enzyme indoleamine 2,3-dioxygenase (IDO) in peripheral blood mononuclear cells in vitro. We examined a potential direct influence of compounds on IDO enzyme activity applying computational calculations based on 3D geometry of the compounds. The interaction pattern analysis and force field-based minimization was performed within LigandScout 3.03, the docking simulation with MOE 2011.10 using the X-ray crystal structure of IDO. Results confirm the possibility of an intense interaction of arctigenin and trachelogenin with the binding site of the enzyme, while matairesinol had no such effect. PMID:24251110

Site study plan for Transportation, Deaf Smith County Site, Texas: Preliminary draft

International Nuclear Information System (INIS)

1987-06-01

This site study plan describes transportation field studies to be conducted during the characterization of the Deaf Smith County, Texas, site for the US Department of Energy's Salt Repository Project. The studies are needed to identify and assess potential project impacts to transportation infrastructure and systems in the project vicinity and along potential transportation routes to the site across the State of Texas. The studies are also needed to locate and design project transportation facilities, and to evaluate and design impact mitigation. After identifying the transportation information requirements needed to comply with Federal, State, and local regulations and repository program requirements, the site study plan describes the study design and rationale, the field data collection procedures and equipment, the data analysis methods and application of results, the data management strategy, the schedule of field activities, the management of the study, and the study's quality assurance program. The field data collection activities are organized into programs for the characterization of site vicinity rail corridors and highway corridors, characterization of alternative statewide transportation routes, monitoring of site characterization effects on transportation, characterization of aircraft overflight patterns and hazardous material transportation patterns, and assessment of emergency response preparedness along alternative statewide transportation routes. 34 refs., 10 figs., 2 tabs

The rRNA methyltransferase Bud23 shows functional interaction with components of the SSU processome and RNase MRP.

Science.gov (United States)

Sardana, Richa; White, Joshua P; Johnson, Arlen W

2013-06-01

Bud23 is responsible for the conserved methylation of G1575 of 18S rRNA, in the P-site of the small subunit of the ribosome. bud23Δ mutants have severely reduced small subunit levels and show a general failure in cleavage at site A2 during rRNA processing. Site A2 is the primary cleavage site for separating the precursors of 18S and 25S rRNAs. Here, we have taken a genetic approach to identify the functional environment of BUD23. We found mutations in UTP2 and UTP14, encoding components of the SSU processome, as spontaneous suppressors of a bud23Δ mutant. The suppressors improved growth and subunit balance and restored cleavage at site A2. In a directed screen of 50 ribosomal trans-acting factors, we identified strong positive and negative genetic interactions with components of the SSU processome and strong negative interactions with components of RNase MRP. RNase MRP is responsible for cleavage at site A3 in pre-rRNA, an alternative cleavage site for separating the precursor rRNAs. The strong negative genetic interaction between RNase MRP mutants and bud23Δ is likely due to the combined defects in cleavage at A2 and A3. Our results suggest that Bud23 plays a role at the time of A2 cleavage, earlier than previously thought. The genetic interaction with the SSU processome suggests that Bud23 could be involved in triggering disassembly of the SSU processome, or of particular subcomplexes of the processome.

An X-ray absorption spectroscopic study of the metal site preference in Al1-xGaxFeO3

Science.gov (United States)

Walker, James D. S.; Grosvenor, Andrew P.

2013-01-01

Magnetoelectric materials have potential for being introduced into next generation technologies, especially memory devices. The AFeO3 (Pna21; A=Al, Ga) system has received attention to better understand the origins of magnetoelectric coupling. The magnetoelectric properties this system exhibits depend on the amount of anti-site disorder present, which is affected by the composition and the method of synthesis. In this study, Al1-xGaxFeO3 was synthesized by the ceramic method and studied by X-ray absorption spectroscopy. Al L2,3-, Ga K-, and Fe K-edge spectra were collected to examine how the average metal coordination number changes with composition. Examination of XANES spectra from Al1-xGaxFeO3 indicate that with increasing Ga content, Al increasingly occupies octahedral sites while Ga displays a preference for occupying the tetrahedral site. The Fe K-edge spectra indicate that more Fe is present in the tetrahedral site in AlFeO3 than in GaFeO3, implying more anti-site disorder is present in AlFeO3.

An X-ray absorption spectroscopic study of the metal site preference in Al1−xGaxFeO3

International Nuclear Information System (INIS)

Walker, James D.S.; Grosvenor, Andrew P.

2013-01-01

Magnetoelectric materials have potential for being introduced into next generation technologies, especially memory devices. The AFeO 3 (Pna2 1 ; A=Al, Ga) system has received attention to better understand the origins of magnetoelectric coupling. The magnetoelectric properties this system exhibits depend on the amount of anti-site disorder present, which is affected by the composition and the method of synthesis. In this study, Al 1−x Ga x FeO 3 was synthesized by the ceramic method and studied by X-ray absorption spectroscopy. Al L 2,3 -, Ga K-, and Fe K-edge spectra were collected to examine how the average metal coordination number changes with composition. Examination of XANES spectra from Al 1−x Ga x FeO 3 indicate that with increasing Ga content, Al increasingly occupies octahedral sites while Ga displays a preference for occupying the tetrahedral site. The Fe K-edge spectra indicate that more Fe is present in the tetrahedral site in AlFeO 3 than in GaFeO 3 , implying more anti-site disorder is present in AlFeO 3 . - Graphical abstract: Al 1−x Ga x FeO 3 has been investigated by XANES. Through examination of Al L 2,3 -, Ga K-, and Fe K-edge XANES spectra, it was found that more anti-site disorder of the Fe atoms is present in AlFeO 3 compared to in GaFeO 3 . Highlights: ► Al 1−x Ga x FeO 3 was investigated by X-ray absorption spectroscopy. ► Ga prefers to occupy the tetrahedral site in Al 1−x Ga x FeO 3 . ► Fe prefers to occupy the octahedral sites in Al 1−x Ga x FeO 3 as x increases. ► More anti-site disorder is present in AlFeO 3 compared to in GaFeO 3.

Toward a regional power plant siting method: AEC-Maryland regional siting factors study, FY 1974 progress report

International Nuclear Information System (INIS)

Yaffee, S.L.; Miller, C.A.

1974-11-01

The ''AEC-Maryland Regional Siting Factors Study'' examines the process of siting in a regional context. It is developing an analysis method to delineate candidate areas for siting of several power plant technology packages, including both fossil-fueled and nuclear options. Tools that are being used include simulation modeling, economic and demographic forecasting, spatial analysis, and computer graphics and numerical manipulation. The approach will describe the trade-offs incurred if a power plant is located in one candidate area rather than in another. In FY 1974, a suitability analysis method was developed which uses engineering and environmental parameters to define a level of environmental cost incurred if a segment of land is used to site a specific technology package. (U.S.)

Effect of oral sodium bicarbonate on fibroblast growth factor-23 in patients with chronic kidney disease: a pilot study.

Science.gov (United States)

Chen, Wei; Melamed, Michal L; Hostetter, Thomas H; Bauer, Carolyn; Raff, Amanda C; Almudevar, Anthony L; Lalonde, Amy; Messing, Susan; Abramowitz, Matthew K

2016-08-05

The regulation of fibroblast growth factor-23 (FGF23) secretion in patients with chronic kidney disease (CKD) is incompletely understood. An in vitro study showed that metabolic acidosis increased FGF23 in mouse bone. The objective of this study is to evaluate the effect of oral sodium bicarbonate on circulating FGF23 levels in patients with CKD. This was a single-blind pilot study. Twenty adults with estimated glomerular filtration rate between 15-45 mL/min/1.73 m(2) and serum bicarbonate between 20-24 mEq/L were treated with placebo for 2 weeks, followed by increasing doses of oral sodium bicarbonate (0.3, 0.6 and 1.0 mEq/kg/day) in 2 week intervals for a total of 6 weeks. C-terminal FGF23 levels were measured at the initial visit, after 2 weeks of placebo and after 6 weeks of bicarbonate therapy. Wilcoxon matched-pairs signed-rank test was used to compare FGF23 before and after sodium bicarbonate. After 6 weeks of oral sodium bicarbonate, the median FGF23 increased significantly from 150.9 RU/mL (IQR 107.7-267.43) to 191.4 RU/mL (IQR 132.6-316.9) (p = 0.048) and this persisted after excluding participants who received activated vitamin D. FGF23 increased after short-term oral sodium bicarbonate therapy in patients with CKD and mild metabolic acidosis. It is unclear whether this was due to the alkalinizing effect of sodium bicarbonate or other factors. The study was registered at ClinicalTrials.gov ( NCT00888290 ) on April 23, 2009.

Discovering How Students Search a Library Web Site: A Usability Case Study.

Science.gov (United States)

Augustine, Susan; Greene, Courtney

2002-01-01

Discusses results of a usability study at the University of Illinois Chicago that investigated whether Internet search engines have influenced the way students search library Web sites. Results show students use the Web site's internal search engine rather than navigating through the pages; have difficulty interpreting library terminology; and…

Reactive sites influence in PMMA oligomers reactivity: a DFT study

Science.gov (United States)

Paz, C. V.; Vásquez, S. R.; Flores, N.; García, L.; Rico, J. L.

2018-01-01

In this work, we present a theoretical study of methyl methacrylate (MMA) living anionic polymerization. The study was addressed to understanding two important experimental observations made for Michael Szwarc in 1956. The unexpected effect of reactive sites concentration in the propagation rate, and the self-killer behavior of MMA (deactivating of living anionic polymerization). The theoretical calculations were performed by density functional theory (DFT) to obtain the frontier molecular orbitals values. These values were used to calculate and analyze the chemical interaction descriptors in DFT-Koopmans’ theorem. As a result, it was observed that the longest chain-length species (related with low concentration of reactive sites) exhibit the highest reactivity (behavior associated with the increase of the propagation rate). The improvement in this reactivity was attributed to the crosslinking produced in the polymethyl methacrylate chains. Meanwhile, the self-killer behavior was associated with the intermolecular forces present in the reactive sites. This behavior was associated to an obstruction in solvation, since the active sites remained active through all propagation species. The theoretical results were in good agreement with the Szwarc experiments.

Elevated Dopamine D2/3 Receptor Availability in Obese Individuals: A PET Imaging Study with [11C](+)PHNO.

Science.gov (United States)

Gaiser, Edward C; Gallezot, Jean-Dominique; Worhunsky, Patrick D; Jastreboff, Ania M; Pittman, Brian; Kantrovitz, Lauren; Angarita, Gustavo A; Cosgrove, Kelly P; Potenza, Marc N; Malison, Robert T; Carson, Richard E; Matuskey, David

2016-12-01

Most prior work with positron emission tomography (PET) dopamine subtype 2/3 receptor (D 2/3 R) non-selective antagonist tracers suggests that obese (OB) individuals exhibit lower D 2/3 Rs when compared with normal weight (NW) individuals. A D 3 -preferring D 2/3 R agonist tracer, [ 11 C](+)PHNO, has demonstrated that body mass index (BMI) was positively associated with D 2/3 R availability within striatal reward regions. To date, OB individuals have not been studied with [ 11 C](+)PHNO. We assessed D 2/3 R availability in striatal and extrastriatal reward regions in 14 OB and 14 age- and gender-matched NW individuals with [ 11 C](+)PHNO PET utilizing a high-resolution research tomograph. Additionally, in regions where group D 2/3 R differences were observed, secondary analyses of 42 individuals that constituted an overweight cohort was done to study the linear association between BMI and D 2/3 R availability in those respective regions. A group-by-brain region interaction effect (F 7, 182 =2.08, p=0.047) was observed. Post hoc analyses revealed that OB individuals exhibited higher tracer binding in D 3 -rich regions: the substantia nigra/ventral tegmental area (SN/VTA) (+20%; p=0.02), ventral striatum (VST) (+14%; p<0.01), and pallidum (+11%; p=0.02). BMI was also positively associated with D 2/3 R availability in the SN/VTA (r=0.34, p=0.03), VST (r=0.36, p=0.02), and pallidum (r=0.30, p=0.05) across all subjects. These data suggest that individuals who are obese have higher D 2/3 R availability in brain reward regions densely populated with D 3 Rs, potentially identifying a novel pharmacologic target for the treatment of obesity.

Report of JLC site study group

CERN Document Server

Hasegawa, T; Yamashita, S

2003-01-01

This study group selected some good sites for construction of JLC (Electron-Positron Linear Collider) on the basis of investigation of data and field survey. The aims, activity, use of underground of private land, conditions of site, selection of site at present and future, summary and proposal are reported. 9 sites (Hidaka, Kitakami, Murayama, Abukuma, Kitaibaraki, Aichi and Gifu, Takamatsu, Hiroshima and Seburi range) are selected for the construction on the basis of firm ground and 4 sites (Okinawa, Harima, Tsukuba and Mutsuogawara) for development and researches. 9 sites area consists of plutonic rock or old strata of Paleozoic era. Many problems in each site are reported. There are three following proposals; 1) the self-governing communities of the sites have to understand JLC and start to construct it by information, 2) a site evaluation committee consists of specialist of civil engineering, building, social and natural environment and disaster prevention and 3) the vibration test should be carried out ...

Closure report for CAU No. 450: Historical UST release sites, Nevada Test Site. Volume 2

International Nuclear Information System (INIS)

1997-09-01

This report addresses the closure of 11 historical underground storage tank release sites within various areas of the Nevada Test Site. This report contains remedial verification of the soil sample analytical results for the following: Area 11 Tweezer facility; Area 12 boiler house; Area 12 service station; Area 23 bypass yard; Area 23 service station; Area 25 power house; Area 25 tech. services building; Area 25 tech. operations building; Area 26 power house; and Area 27 boiler house

Behavior-based safety on construction sites: a case study.

Science.gov (United States)

Choudhry, Rafiq M

2014-09-01

This work presents the results of a case study and describes an important area within the field of construction safety management, namely behavior-based safety (BBS). This paper adopts and develops a management approach for safety improvements in construction site environments. A rigorous behavioral safety system and its intervention program was implemented and deployed on target construction sites. After taking a few weeks of safety behavior measurements, the project management team implemented the designed intervention and measurements were taken. Goal-setting sessions were arranged on-site with workers' participation to set realistic and attainable targets of performance. Safety performance measurements continued and the levels of performance and the targets were presented on feedback charts. Supervisors were asked to give workers recognition and praise when they acted safely or improved critical behaviors. Observers were requested to have discussions with workers, visit the site, distribute training materials to workers, and provide feedback to crews and display charts. They were required to talk to operatives in the presence of line managers. It was necessary to develop awareness and understanding of what was being measured. In the process, operatives learned how to act safely when conducting site tasks using the designed checklists. Current weekly scores were discussed in the weekly safety meetings and other operational site meetings with emphasis on how to achieve set targets. The reliability of the safety performance measures taken by the company's observers was monitored. A clear increase in safety performance level was achieved across all categories: personal protective equipment; housekeeping; access to heights; plant and equipment, and scaffolding. The research reveals that scores of safety performance at one project improved from 86% (at the end of 3rd week) to 92.9% during the 9th week. The results of intervention demonstrated large decreases in

Relationship of associated secondary hyperparathyroidism to serum fibroblast growth factor-23 in end stage renal disease: A case-control study

Science.gov (United States)

Sliem, Hamdy; Tawfik, Gamal; Moustafa, Fadia; Zaki, Heba

2011-01-01

Introduction: Secondary hyperparathyroidism (SHPT) is an insidious disease that develops early in the course of chronic kidney disease (CKD) and increases in severity as the glomerular filtration rate deteriorates. Recent studies have identified fibroblast growth factor-23 (FGF23) as a new protein with phosphaturic activity. It is mainly secreted by osteoblasts and is now considered the most important factor for regulation of phosphorus homeostasis. It is not yet proven if there is any direct relation between parathyroid hormone (PTH) and FGF23. The present study aims to evaluate the relation between serum FGF23, phosphorus, and PTH in end-stage renal disease in patients with SHPT on regular hemodialysis. Materials and Methods: Forty-six consecutive CKD adult patients (case group) and 20 healthy adults (control group) were included in the study. All patients had SHPT and were on regular hemodialysis. Both groups were subjected to full medical history, clinical examination and biochemical studies. Serum phosphorus, calcium, ferritin, hemoglobin level, blood urea, creatinine, PTH, and FGF23 were analyzed. Results: Levels of FGF23 were significantly higher in the case group in comparison with those in the control group, viz., 4-fold, and positively correlated with PTH. Phosphorus levels in the case group were significantly high in spite of the increasing levels of FGF23. Both PTH and FGF23 were positively correlated with phosphorus and negatively with hemoglobin levels. Conclusion: SHPT and FGF23 may have a partial role in the development of anemia in patients with CKD. FGF23 could be a central factor in the pathogenesis of SHPT. Its role in controlling hyperphosphatemia in CKD is vague. PMID:21731867

Relationship of associated secondary hyperparathyroidism to serum fibroblast growth factor-23 in end stage renal disease: A case-control study

Directory of Open Access Journals (Sweden)

Hamdy Sliem

2011-01-01

Full Text Available Introduction: Secondary hyperparathyroidism (SHPT is an insidious disease that develops early in the course of chronic kidney disease (CKD and increases in severity as the glomerular filtration rate deteriorates. Recent studies have identified fibroblast growth factor-23 (FGF23 as a new protein with phosphaturic activity. It is mainly secreted by osteoblasts and is now considered the most important factor for regulation of phosphorus homeostasis. It is not yet proven if there is any direct relation between parathyroid hormone (PTH and FGF23. The present study aims to evaluate the relation between serum FGF23, phosphorus, and PTH in end-stage renal disease in patients with SHPT on regular hemodialysis. Materials and Methods: Forty-six consecutive CKD adult patients (case group and 20 healthy adults (control group were included in the study. All patients had SHPT and were on regular hemodialysis. Both groups were subjected to full medical history, clinical examination and biochemical studies. Serum phosphorus, calcium, ferritin, hemoglobin level, blood urea, creatinine, PTH, and FGF23 were analyzed. Results: Levels of FGF23 were significantly higher in the case group in comparison with those in the control group, viz., 4-fold, and positively correlated with PTH. Phosphorus levels in the case group were significantly high in spite of the increasing levels of FGF23. Both PTH and FGF23 were positively correlated with phosphorus and negatively with hemoglobin levels. Conclusion: SHPT and FGF23 may have a partial role in the development of anemia in patients with CKD. FGF23 could be a central factor in the pathogenesis of SHPT. Its role in controlling hyperphosphatemia in CKD is vague.

Intragenic suppressor of Osiaa23 revealed a conserved tryptophan residue crucial for protein-protein interactions.

Directory of Open Access Journals (Sweden)

Jun Ni

Full Text Available The Auxin/Indole-3-Acetic Acid (Aux/IAA and Auxin Response Factor (ARF are two important families that play key roles in auxin signal transduction. Both of the families contain a similar carboxyl-terminal domain (Domain III/IV that facilitates interactions between these two families. In spite of the importance of protein-protein interactions among these transcription factors, the mechanisms involved in these interactions are largely unknown. In this study, we isolated six intragenic suppressors of an auxin insensitive mutant, Osiaa23. Among these suppressors, Osiaa23-R5 successfully rescued all the defects of the mutant. Sequence analysis revealed that an amino acid substitution occurred in the Tryptophan (W residue in Domain IV of Osiaa23. Yeast two-hybrid experiments showed that the mutation in Domain IV prevents the protein-protein interactions between Osiaa23 and OsARFs. Phylogenetic analysis revealed that the W residue is conserved in both OsIAAs and OsARFs. Next, we performed site-specific amino acid substitutions within Domain IV of OsARFs, and the conserved W in Domain IV was exchanged by Serine (S. The mutated OsARF(WSs can be released from the inhibition of Osiaa23 and maintain the transcriptional activities. Expression of OsARF(WSs in Osiaa23 mutant rescued different defects of the mutant. Our results suggest a previously unknown importance of Domain IV in both families and provide an indirect way to investigate functions of OsARFs.

Corrective Action Decision Document/Closure Report for Corrective Action Unit 569: Area 3 Yucca Flat Atmospheric Test Sites Nevada National Security Site, Nevada with ROTC 1, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Sloop, Christy

2013-04-01

This Corrective Action Decision Document/Closure Report presents information supporting the closure of Corrective Action Unit (CAU) 569: Area 3 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada. CAU 569 comprises the following nine corrective action sites (CASs): • 03-23-09, T-3 Contamination Area • 03-23-10, T-3A Contamination Area • 03-23-11, T-3B Contamination Area • 03-23-12, T-3S Contamination Area • 03-23-13, T-3T Contamination Area • 03-23-14, T-3V Contamination Area • 03-23-15, S-3G Contamination Area • 03-23-16, S-3H Contamination Area • 03-23-21, Pike Contamination Area The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation that no further corrective action is needed for CAU 569 based on the implementation of the corrective actions listed in Table ES-2.

Site Response Analysis Using DeepSoil: Case Study of Bangka Site, Indonesia

Energy Technology Data Exchange (ETDEWEB)

Iswanto, Eko Rudi; Yee, Eric [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)

2015-10-15

Indonesia government declared through Act No. 17 year 2007 on the National Long-Term Development Plant Year 2005-2025 and Presidential Decree No. 5 year 2006 on the National Energy Policy (Indonesia 2007; Indonesia 2006), that nuclear energy is stated as a part of the national energy system. In order to undertake the above national policy, National Nuclear Energy Agency of Indonesia, as the promotor for the utilization of nuclear energy will conduct site study, which is a part of infrastructure preparation for NPP construction. Thorough preparation and steps are needed to operate an NPP and it takes between 10 to 15 years from the preliminary study (site selection, financial study, etc.) up to project implementation (manufacturing, construction, commissioning). During project implementation, it is necessary to prepare various documents relevant for permit application such as Safety Evaluation Report for site permit, Preliminary Safety Analysis Report and Environment Impact Assessment Report for construction permit. Considering the continuously increasing electricity energy demand, it is necessary to prepare for alternative NPP sites. The safety requirements of NPP's are stringent; amongst the various requirements is the ability to safely shut down in the wake of a possible earthquake. Ground response analysis of a potential site therefore needs to be carried out, parameter that affect the resistance of an NPP to earthquakes such as peak strain profiles is analysed. The objective of this paper is to analyse the ground response of the selected site for a NPP, using The Mw 7.9 in Sikuai Island, West Sumatra on September 12, 2007 as present input motion. This analysis will be carried out using a ground response analysis program, DeepSoil. In addition to this, an attempt was made to define the site specific input motion characteristics of the selected site for use in DeepSoil (DeepSoil 5.0). A site investigation at the WB site was performed primarily on the PS

A Study of Social Networking Sites for Learners of Japanese

Directory of Open Access Journals (Sweden)

Fusako Ota

2011-01-01

Full Text Available Social Networking Sites (SNSs such as “Facebook” and “MySpace” have been used by many people from different countries around the world, and they have recently been applied to second language (L2 learning, both inside and outside classrooms. A number of researchers have investigated the utility of SNSs, and some language researchers have studied the use of SNSs for L2 learning in language classrooms. However, the study of the usage of SNSs for L2 learning outside the classroom has not yet been studied thoroughly, despite the fact that many communities and groups exist for users who are interested in learning L2 on such sites. This article examines the nature and extent of SNS communities available specifically for L2 learners of Japanese, and describes the usage which is being made of these communities in particular on the SNSs, “mixi” and “Facebook”. Furthermore, the beneficial aspects of using such sites for L2 learning will be discussed.

Integrating knowledge-based multi-criteria evaluation techniques with GIS for landfill site selection: A case study using AHP

Directory of Open Access Journals (Sweden)

Fagbohun B.J.

2016-09-01

Full Text Available A major challenge in most growing urban areas of developing countries, without a pre-existing land use plan is the sustainable and efficient management of solid wastes. Siting a landfill is a complicated task because of several environmental regulations. This challenge gives birth to the need to develop efficient strategies for the selection of proper waste disposal sites in accordance with all existing environmental regulations. This paper presents a knowledge-based multi-criteria decision analysis using GIS for the selection of suitable landfill site in Ado-Ekiti, Nigeria. In order to identify suitable sites for landfill, seven factors - land use/cover, geology, river, soil, slope, lineament and roads - were taken into consideration. Each factor was classified and ranked based on prior knowledge about the area and existing guidelines. Weights for each factor were determined through pair-wise comparison using Saaty’s 9 point scale and AHP. The integration of factors according to their weights using weighted index overlay analysis revealed that 39.23 km2 within the area was suitable to site a landfill. The resulting suitable area was classified as high suitability covering 6.47 km2 (16.49%, moderate suitability 25.48 km2 (64.95% and low suitability 7.28 km2 (18.56% based on their overall weights.

Test-retest and between-site reliability in a multicenter fMRI study.

Science.gov (United States)

Friedman, Lee; Stern, Hal; Brown, Gregory G; Mathalon, Daniel H; Turner, Jessica; Glover, Gary H; Gollub, Randy L; Lauriello, John; Lim, Kelvin O; Cannon, Tyrone; Greve, Douglas N; Bockholt, Henry Jeremy; Belger, Aysenil; Mueller, Bryon; Doty, Michael J; He, Jianchun; Wells, William; Smyth, Padhraic; Pieper, Steve; Kim, Seyoung; Kubicki, Marek; Vangel, Mark; Potkin, Steven G

2008-08-01

In the present report, estimates of test-retest and between-site reliability of fMRI assessments were produced in the context of a multicenter fMRI reliability study (FBIRN Phase 1, www.nbirn.net). Five subjects were scanned on 10 MRI scanners on two occasions. The fMRI task was a simple block design sensorimotor task. The impulse response functions to the stimulation block were derived using an FIR-deconvolution analysis with FMRISTAT. Six functionally-derived ROIs covering the visual, auditory and motor cortices, created from a prior analysis, were used. Two dependent variables were compared: percent signal change and contrast-to-noise-ratio. Reliability was assessed with intraclass correlation coefficients derived from a variance components analysis. Test-retest reliability was high, but initially, between-site reliability was low, indicating a strong contribution from site and site-by-subject variance. However, a number of factors that can markedly improve between-site reliability were uncovered, including increasing the size of the ROIs, adjusting for smoothness differences, and inclusion of additional runs. By employing multiple steps, between-site reliability for 3T scanners was increased by 123%. Dropping one site at a time and assessing reliability can be a useful method of assessing the sensitivity of the results to particular sites. These findings should provide guidance toothers on the best practices for future multicenter studies.

A NEW FRAMEWORK FOR GEOSPATIAL SITE SELECTION USING ARTIFICIAL NEURAL NETWORKS AS DECISION RULES: A CASE STUDY ON LANDFILL SITES

Directory of Open Access Journals (Sweden)

S. K. M. Abujayyab

2015-10-01

Full Text Available This paper briefly introduced the theory and framework of geospatial site selection (GSS and discussed the application and framework of artificial neural networks (ANNs. The related literature on the use of ANNs as decision rules in GSS is scarce from 2000 till 2015. As this study found, ANNs are not only adaptable to dynamic changes but also capable of improving the objectivity of acquisition in GSS, reducing time consumption, and providing high validation. ANNs make for a powerful tool for solving geospatial decision-making problems by enabling geospatial decision makers to implement their constraints and imprecise concepts. This tool offers a way to represent and handle uncertainty. Specifically, ANNs are decision rules implemented to enhance conventional GSS frameworks. The main assumption in implementing ANNs in GSS is that the current characteristics of existing sites are indicative of the degree of suitability of new locations with similar characteristics. GSS requires several input criteria that embody specific requirements and the desired site characteristics, which could contribute to geospatial sites. In this study, the proposed framework consists of four stages for implementing ANNs in GSS. A multilayer feed-forward network with a backpropagation algorithm was used to train the networks from prior sites to assess, generalize, and evaluate the outputs on the basis of the inputs for the new sites. Two metrics, namely, confusion matrix and receiver operating characteristic tests, were utilized to achieve high accuracy and validation. Results proved that ANNs provide reasonable and efficient results as an accurate and inexpensive quantitative technique for GSS.

Scaling up kangaroo mother care in South Africa: 'on-site' versus 'off-site' educational facilitation

Directory of Open Access Journals (Sweden)

van Rooyen Elise

2008-07-01

Full Text Available Abstract Background Scaling up the implementation of new health care interventions can be challenging and demand intensive training or retraining of health workers. This paper reports on the results of testing the effectiveness of two different kinds of face-to-face facilitation used in conjunction with a well-designed educational package in the scaling up of kangaroo mother care. Methods Thirty-six hospitals in the Provinces of Gauteng and Mpumalanga in South Africa were targeted to implement kangaroo mother care and participated in the trial. The hospitals were paired with respect to their geographical location and annual number of births. One hospital in each pair was randomly allocated to receive either 'on-site' facilitation (Group A or 'off-site' facilitation (Group B. Hospitals in Group A received two on-site visits, whereas delegates from hospitals in Group B attended one off-site, 'hands-on' workshop at a training hospital. All hospitals were evaluated during a site visit six to eight months after attending an introductory workshop and were scored by means of an existing progress-monitoring tool with a scoring scale of 0–30. Successful implementation was regarded as demonstrating evidence of practice (score >10 during the site visit. Results There was no significant difference between the scores of Groups A and B (p = 0.633. Fifteen hospitals in Group A and 16 in Group B demonstrated evidence of practice. The median score for Group A was 16.52 (range 00.00–23.79 and that for Group B 14.76 (range 07.50–23.29. Conclusion A previous trial illustrated that the implementation of a new health care intervention could be scaled up by using a carefully designed educational package, combined with face-to-face facilitation by respected resource persons. This study demonstrated that the site of facilitation, either on site or at a centre of excellence, did not influence the ability of a hospital to implement KMC. The choice of outreach

Integrating intrusive and nonintrusive characterization methods to achieve a conceptual site model for the SLDA FUSRAP site

International Nuclear Information System (INIS)

Durham, L.A.; Peterson, J.M.; Frothingham, D.G.; Frederick, W.T.; Lenart, W.

2008-01-01

The US Army Corps of Engineers (USACE) is addressing radiological contamination following Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) requirements at the Shallow Land Disposal Area (SLDA) site, which is a radiologically contaminated property that is part of the Formerly utilized Sites Remedial Action Program (FUSRAP). The SLDA is an 18-hectare (44-acre) site in Parks township, Armstrong County, Pennsylvania, about 37 kilometers (23 miles) east-northeast of Pittsburgh. According to historical record, radioactive wastes were disposed of at the SLDA in a series of trenches by the Nuclear Materials and Equipment Company (NUMEC) in the 1960s. The wastes originated from the nearby Apollo nuclear fuel fabrication facility, which began operations under NUMEC in the late 1950s and fabricated enriched uranium into naval reactor fuel elements. It is believed that the waste materials were buried in a series of pits constructed adjacent to one another in accordance with an Atomic Energy Commission (AEC) regulation that has since been rescinded. A CERCLA remedial investigation/feasibility study (RI/FS) process was completed for the SLDA site, and the results of the human health risk assessment indicated that the radiologically contaminated wastes could pose a risk to human health in the future. There are no historical records that provide the exact location of these pits. However, based on geophysical survey results conducted in the 1980s, these pits were defined by geophysical anomalies and were depicted on historical site drawings as trenches. At the SLDA site, a combination of investigative methods and tools was used in the RI/FS and site characterization activities. The SLDA site provides an excellent example of how historical documents and data, historical aerial photo analysis, physical sampling, and nonintrusive geophysical and gamma walkover surveys were used in combination to reduce the uncertainty in the location of the trenches. The

A systematic review of laparoscopic port site hernias in gastrointestinal surgery.

LENUS (Irish Health Repository)

Owens, M

2012-02-01

INTRODUCTION: Port site hernia is an important yet under-recognised complication of laparoscopic surgery, which carries a high risk of strangulation due to the small size of the defect involved. The purpose of this study was to examine the incidence, classification, and pathogenesis of this complication, and to evaluate strategies to prevent and treat it. METHODS: Medline was searched using the words "port site hernia", "laparoscopic port hernia" "laparoscopic complications" and "trocar site hernias". The search was limited to articles on cholecystectomy, colorectal, bariatric or anti-reflux surgery published in English. A total of 42 articles were analysed and of these 35 were deemed eligible for review. Inclusion criteria were laparoscopic gastrointestinal surgery in English only with reported incidence of port site herniation. Studies were excluded if insufficient data was provided. Eligible studies were also cross-referenced. RESULTS: Analysis of 11,699 patients undergoing laparoscopic gastrointestinal procedures demonstrated an incidence of port site hernias of 0.74% with a mean follow-up of 23.9 months. The lowest incidence of port site herniation was for bariatric surgery with 0.57% in 2644 patients with a mean follow-up of 67.4 months while the highest incidence was for laparoscopic colorectal surgery with an incidence of 1.47% in 477 patients with a mean follow-up of 71.5 months. CONCLUSION: All fascial defects larger than or equal to 10mm should be closed with peritoneum, while smaller defects may require closure in certain circumstances to prevent herniation. Laparoscopic port site herniation is a completely preventable cause of morbidity that requires a second surgical procedure to repair.

Corrective action plan for corrective action Unit 342: Area 23 Mercury Fire Training Pit, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

Nacht, S.

1999-01-01

The Mercury Fire Training Pit is a former fire training area located in Area 23 of the Nevada Test Site (NTS). The Mercury Fire Training Pit was used from approximately 1965 to the early 1990s to train fire-fighting personnel at the NTS, and encompasses an area approximately 107 meters (m) (350 feet [ft]) by 137 m (450 ft). The Mercury Fire Training Pit formerly included a bermed burn pit with four small burn tanks, four large above ground storage tanks an overturned bus, a telephone pole storage area, and areas for burning sheds, pallets, and cables. Closure activities will include excavation of the impacted soil in the aboveground storage tank and burn pit areas to a depth of 1.5 m (5 ft), and excavation of the impacted surface soil downgradient of the former ASTs and burnpit areas to a depth of 0.3 m (1 ft). Excavated soil will be disposed in the Area 6 Hydrocarbon Landfill at the NTS

HHR23A, a human homolog of Saccharomyces cerevisiae Rad23, regulates xeroderma pigmentosum C protein and is required for nucleotide excision repair

International Nuclear Information System (INIS)

Hsieh, Hui-Chuan; Hsieh, Yi-Hsuan; Huang, Yu-Hsin; Shen, Fan-Ching; Tsai, Han-Ni; Tsai, Jui-He; Lai, Yu-Ting; Wang, Yu-Ting; Chuang, Woei-Jer; Huang, Wenya

2005-01-01

HHR23A and hHR23B are the human homologs of Saccharomyces cerevisiae Rad23. hHR23B is associated with the nucleotide excision repair (NER) factor xeroderma pigmentosum C (XPC) protein and is required for global genome repair. The function of hHR23A is not yet clear. In this study, the potential function of the hHR23A protein was investigated using RNA interference techniques. The hHR23A knock-down (KD) construct diminished the RNA level of hHR23A protein by approximately 60%, and it did not interfere with expression of the hHR23B gene. Based on Southwestern immunoblot and host-cell reactivation assays, hHR23A KD cells were found to be deficient in DNA repair activity against the DNA damage caused by UVC irradiation. In these hHR23A KD cells, the XPC gene was not normally induced by UVC irradiation, indicating that the hHR23A protein is involved in NER through regulation of the DNA damage recognition protein XPC. Co-immunoprecipitation experiments revealed that hHR23A was associated with a small portion of hHR23B and the majority of p53 protein, indicating that hHR23A regulates the function of XPC by its association with the NER activator p53

Site characterization studies in the NWTS program

International Nuclear Information System (INIS)

Shipler, D.; Evans, G.

1980-01-01

The US Department of Energy (DOE) has the responsibility to identify sites and construct and operate facilities for the storage or isolation of spent fuel and/or reprocessing radioactive wastes from commercial nuclear power plants. The National Waste Terminal Storage (NWTS) Program has been initiated by the DOE to develop the technology and demonstrate the feasibility of burial and isolation of high level radioactive waste in deep geologic formations. The NTWS Program plan which sets forth the criteria, procedures, and other considerations required to characterize and select a site in a comprehensive stepwise manner is discussed. The plan is not specific to any given geologic medium but serves as a guide for site selection in any geohydrologic system deemed appropriate for consideration for a deep geologic repository. The plan will be used by all NWTS Project Offices in the conduct of their site characterization program. The plan will be updated, as warranted, to reflect technology development, National policies, rulemakings by regulatory agencies, and other changing political, social, and institutional considerations. Site characterization begins with the identification of regions believed to have suitable geologic, hydrologic, and environmental characteristics for repository siting. This is followed by an iterative process of data collection and analysis to identify areas and locations which appear most suitable for further investigations. In addition, screening studies of the DOE's nuclear complexes has led to the selection of the Nevada Test Site and the Hanford Site for further characterization studies. The site characterization process results in a number of candidate sites from which a site will be selected and proposed to the NRC for licensing

Ecological and radioecological studies of nuclear installation sites

International Nuclear Information System (INIS)

Caries, J. C.; Hugon, J.; Grauby, A.

1988-01-01

The site study method consists of a dynamic and estimated analysis and of following up the release impact on all natural or non natural media compartments that take a part in the protection of man and his environment. The stages of knowing a nuclear site include the site preliminary radioecological evaluation, diffusion parameters evaluation, the quantification of factors of radioelements transfer to man, the ecological baseline carrying out, the radioactive baseline establishment, the radioecological synthesis of the results, the site radioactive and ecological control. This method applys to selection and detailed study of site. 1 tab., 7 refs. (F.M.)

Corrosion Studies of Wrought and Cast NASA-23 Alloy

Science.gov (United States)

Danford, M. D.

1997-01-01

Corrosion studies were carried out for wrought and cast NASA-23 alloy using electrochemical methods. The scanning reference electrode technique (SRET), the polarization resistance technique (PR), and the electrochemical impedance spectroscopy (EIS) were employed. These studies corroborate the findings of stress corrosion studies performed earlier, in that the material is highly resistant to corrosion.

Sternoe study site. Scope of activities and main results

International Nuclear Information System (INIS)

Ahlbom, K.; Andersson, J.E.; Nordqvist, R.; Tiren, S.; Ljunggren, C.; Voss, C.

1992-01-01

During the period from 1977-1986 SKB (Swedish Nuclear Fuel and Waste Management Co) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the previously investigated study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favourable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concerns the Sternoe study site. This site was one of the first sites to be investigated by SKB . The studies at Sternoe were made under severe time-constraints and with prototype borehole instrumentations. These limitations should be kept in mind when reading the report. (41 refs., 16 figs., 12 tabs.) (au)

Gideaa study site. Scope of activities and main results

International Nuclear Information System (INIS)

Ahlbom, K.; Andersson, J.E.; Nordqvist, R.; Ljunggren, C.; Tiren, S.; Voss, C.

1991-10-01

During the period from 1977-1986 SKB (Swedish Nuclear Fuel and Waste Management Co) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other site with geological and/or socio-economical characteristics judged more favourable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concerns the Gideaa study site. (au)

Kamlunge study site. Scope of activities and main results

International Nuclear Information System (INIS)

Ahlbom, K.; Andersson, J.E.; Andersson, P.; Ittner, T.; Tiren, S.; Ljunggren, C.

1992-05-01

During the period from 1977-1986 SKB (Swedish nuclear Fuel and Waste Management Co.) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favourable may very well be selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concerns the Kamlunge study site. (79 refs.) (au)

Corrective Action Investigation Plan for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

Grant Evenson

2006-01-01

Corrective Action Unit (CAU) 139 is located in Areas 3, 4, 6, and 9 of the Nevada Test Site, which is 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 139 is comprised of the seven corrective action sites (CASs) listed below: (1) 03-35-01, Burn Pit; (2) 04-08-02, Waste Disposal Site; (3) 04-99-01, Contaminated Surface Debris; (4) 06-19-02, Waste Disposal Site/Burn Pit; (5) 06-19-03, Waste Disposal Trenches; (6) 09-23-01, Area 9 Gravel Gertie; and (7) 09-34-01, Underground Detection Station. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives with the exception of CASs 09-23-01 and 09-34-01. Regarding these two CASs, CAS 09-23-01 is a gravel gertie where a zero-yield test was conducted with all contamination confined to below ground within the area of the structure, and CAS 09-34-01 is an underground detection station where no contaminants are present. Additional information will be obtained by conducting a corrective action investigation (CAI) before evaluating corrective action alternatives and selecting the appropriate corrective action for the other five CASs where information is insufficient. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on January 4, 2006, by representatives of the Nevada Division of Environmental Protection; U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office; Stoller-Navarro Joint Venture; and Bechtel Nevada. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 139

Corrective Action Investigation Plan for Corrective Action Unit 570: Area 9 Yucca Flat Atmospheric Test Sites Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Patrick Matthews

2012-08-01

CAU 570 comprises the following six corrective action sites (CASs): • 02-23-07, Atmospheric Test Site - Tesla • 09-23-10, Atmospheric Test Site T-9 • 09-23-11, Atmospheric Test Site S-9G • 09-23-14, Atmospheric Test Site - Rushmore • 09-23-15, Eagle Contamination Area • 09-99-01, Atmospheric Test Site B-9A These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on April 30, 2012, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 570. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The presence and nature of contamination at CAU 570 will be evaluated based on information collected from a field investigation. Radiological contamination will be evaluated based on a comparison of the total effective dose at sample locations to the dose-based final action level. The total effective dose will be calculated as the total of separate estimates of internal and external dose. Results from the analysis of soil samples will be used to calculate internal radiological

Fjaellveden study site. Scope of activities and main results

International Nuclear Information System (INIS)

Ahlbom, K.; Andersson, J.E.; Nordqvist, R.; Ljunggren, C.; Tiren, S.; Voss, C.

1991-10-01

During the period from 1977-1986 SKB (Swedish Nuclear Fuel and Waste Management CO) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favourable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need for complementary investigations. This report concerns the Fjaellveden study site. (au)

Corrective Action Decision Document for Corrective Action Unit 366: Area 11 Plutonium Valley Dispersion Sites Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Patrick Matthews

2012-09-01

CAU 366 comprises six corrective action sites (CASs): • 11-08-01, Contaminated Waste Dump #1 • 11-08-02, Contaminated Waste Dump #2 • 11-23-01, Radioactively Contaminated Area A • 11-23-02, Radioactively Contaminated Area B • 11-23-03, Radioactively Contaminated Area C • 11-23-04, Radioactively Contaminated Area D The purpose of this CADD is to identify and provide the rationale for the recommendation of corrective action alternatives (CAA) for the six CASs within CAU 366. Corrective action investigation (CAI) activities were performed from October 12, 2011, to May 14, 2012, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 366: Area 11 Plutonium Valley Dispersion Sites.

The antibiotics micrococcin and thiostrepton interact directly with 23S rRNA nucleotides 1067A and 1095A

DEFF Research Database (Denmark)

Rosendahl, G; Douthwaite, S

1994-01-01

The antibiotics thiostrepton and micrococcin bind to the GTPase region in domain II of 23S rRNA, and inhibit ribosomal A-site associated reactions. When bound to the ribosome, these antibiotics alter the accessibility of nucleotides 1067A and 1095A towards chemical reagents. Plasmid......-coded Escherichia coli 23S rRNAs with single mutations at positions 1067 or 1095 were expressed in vivo. Mutant ribosomes are functional in protein synthesis, although those with transversion mutations function less effectively. Antibiotics were bound under conditions where wild-type and mutant ribosomes compete...

Klipperaas study site. Scope of activities and main results

International Nuclear Information System (INIS)

Ahlbom, K.; Andersson, J.E.; Andersson, Peter; Ittner, T.; Tiren, S.; Ljunggren, C.

1992-09-01

During the period from 1977 - 1986 SKB (Swedish Nuclear Fuel and Waste Management Co.) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection rpogramme will be to perform detailed characterisation, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if any of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favorable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concern the Klipperaas study site. The main topics are the scope of activities, geologic model, geohydrological model, groundwater chemistry, assessment of solute transport, and rock mechanics

Lack of effect of dietary nucleotide supplementation on erythrocyte 2,3-diphosphoglycerate concentration. A study on preterm neonates.

Science.gov (United States)

Scopesi, Fabio; Canini, Silvana; Arioni, Cesare; Mazzella, Massimo; Gazzolo, Diego; Lantieri, Pasquale B; Bonacci, Wanda; Serra, Giovanni

2006-06-01

Recently we demonstrated an increased 2,3-diphosphoglycerate (2,3-DPG) erythrocyte concentration in rat pups subjected to nucleotide-enriched artificial feeding. The present study was carried out to test the hypothesis that a possible increase in 2,3-DPG concentration can also be obtained in human neonates who are fed nucleotide-enriched formula. Preterm neonates born or referred to the neonatal intensive care unit of the G. Gaslini Hospital, Genoa University, with a gestational age >30 weeks and <37 weeks were enrolled in our randomized trial. Recruitment took place within 48-72 hours from birth. Only newborns of mothers deciding not to breast-feed were eligible to be randomized for the supplemented group (FN) or non-supplemented group (RF). Breast-fed newborns were considered the control group (C). The study window (for supplementation and blood samples) was restricted to the first two weeks following birth (from the 2nd (t1) to the 16th (t2) day of life). At the end of our study, only 21 neonates were eligible for statistical analysis. The stimulating action of dietary nucleotides on 2,3-DPG concentration failed to be demonstrated; increases in 2,3-DPG concentration that were observed in newborns fed with nucleotide supplemented formula (FN) were comparable to those observed in newborns fed with regular formula (RF) and breast-fed newborns. The EC recommendation for the amount of nucleotides allowed in formula milk does not seem to be high enough to have positive effects on 2,3-DPG synthesis. Whether this possible 'pharmacological' effect can be achieved by a higher intake of ingested nucleotides and/or a change in the proportions of single nucleotides contained in milk formulas remain interesting end points to be elucidated.

Finnsjoen study site. Scope of activities and main results

International Nuclear Information System (INIS)

Ahlbom, K.; Andersson, J.E.; Andersson, Peter; Ittner, T.; Tiren, S.; Ljunggren, C.

1992-12-01

The Finnsjoen study site was selected in 1977 to provide input to the KBS-1 and KBS-2 performance assessments. The site was later used as a test site for testing new instruments and new site characterization methods, as well as a research site for studying mainly groundwater flow and groundwater transport. All together, the Finnsjoen studies have involved 11 cored boreholes, down to max 700 m depth, and extensive borehole geophysical, geochemical and geohydraulic measurements, as well as rock stress measurements and tracer tests. This report presents the scope of the Finnsjoen studies together with main results. Conceptual uncertainties in assumptions and models are discussed with emphasis on the models used for the performance assessment SKB91. Of special interest for the Finnsjoen study site is the strong influence caused by a subhorizontal fracture zone on groundwater flow, transport and chemistry

International Journal of Humanistic Studies: Site Map

African Journals Online (AJOL)

International Journal of Humanistic Studies: Site Map. Journal Home > About the Journal > International Journal of Humanistic Studies: Site Map. Log in or Register to get access to full text downloads.

Molecular Structure of WlbB, a Bacterial N-Acetyltransferase Involved in the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid

Energy Technology Data Exchange (ETDEWEB)

Thoden, James B.; Holden, Hazel M. (UW)

2010-09-08

The pathogenic bacteria Pseudomonas aeruginosa and Bordetella pertussis contain in their outer membranes the rare sugar 2,3-diacetamido-2,3-dideoxy-D-mannuronic acid. Five enzymes are required for the biosynthesis of this sugar starting from UDP-N-acetylglucosamine. One of these, referred to as WlbB, is an N-acetyltransferase that converts UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronic acid (UDP-GlcNAc3NA) to UDP-2,3-diacetamido-2,3-dideoxy-D-glucuronic acid (UDP-GlcNAc3NAcA). Here we report the three-dimensional structure of WlbB from Bordetella petrii. For this analysis, two ternary structures were determined to 1.43 {angstrom} resolution: one in which the protein was complexed with acetyl-CoA and UDP and the second in which the protein contained bound CoA and UDP-GlcNAc3NA. WlbB adopts a trimeric quaternary structure and belongs to the L{beta}H superfamily of N-acyltransferases. Each subunit contains 27 {beta}-strands, 23 of which form the canonical left-handed {beta}-helix. There are only two hydrogen bonds that occur between the protein and the GlcNAc3NA moiety, one between O{sup {delta}1} of Asn 84 and the sugar C-3{prime} amino group and the second between the backbone amide group of Arg 94 and the sugar C-5{prime} carboxylate. The sugar C-3{prime} amino group is ideally positioned in the active site to attack the si face of acetyl-CoA. Given that there are no protein side chains that can function as general bases within the GlcNAc3NA binding pocket, a reaction mechanism is proposed for WlbB whereby the sulfur of CoA ultimately functions as the proton acceptor required for catalysis.

Laparoendoscopic Single-Site Pyelolithotomy With Use of a Carter-Thomason Needle Grasper

OpenAIRE

Seo, Ill Young; Rim, Joung Sik

2013-01-01

Purpose To study the feasibility and safety of the procedure, we present our early experience with laparoendoscopic single-site (LESS) pyelolithotomy performed by use of a Carter-Thomason needle grasper. Materials and Methods Four patients underwent LESS pyelolithotomy for the removal of renal pelvic stones. The patients' mean age was 57.8 years, and their mean body mass index was 23.01. We used a homemade single-port device made with a surgical glove that was inserted into a 2.5-cm periumbil...

Nuclear Energy Center study. Phase II. Site suitability analysis. Final report

International Nuclear Information System (INIS)

Fellows, W.S.; Sharp, J.M.; Benator, B.I.

1978-06-01

A site screening study was conducted to identify a site or sites for detailed, site-specific study as a nuclear energy center. Using technical criteria of water requirements, geotechnical constraints, and projected load center and transmission considerations as well as environmental and institutional considerations, five potential study sites in the State of South Carolina were identified, evaluated against established criteria, and ranked according to their acceptability as potential nuclear energy center study sites. Consideration of what is ''representative'' of a site as well as the ranking score was factored into site recommendations, since the site deemed easiest to license and permit may not be the most desirable site for future study of the technical and institutional feasibility and practicality of a specific site. The sites near Lake Hartwell and the Savannah River Plant (SRP) of the Department of Energy were selected as potential study sites after consideration of the above criteria. Because the Lake Hartwell site offers the opportunity to consider institutional issues which may be more representative of other possible NEC sites, it is recommended that the Lake Hartwell site be studied to establish the feasibility and practicality of the nuclear energy concept on a site-specific basis

Immunoexpression of Interleukin-22 and Interleukin-23 in Oral and Cutaneous Lichen Planus Lesions: A Preliminary Study

Directory of Open Access Journals (Sweden)

Jun Chen

2013-01-01

Full Text Available Interleukin- (IL- 22 is the signature cytokine of T-helper (Th 22 cells, and IL-23 is required for IL-22 production. The objective of this study was to examine the immunoexpression of IL-22 and IL-23 in archival paraffin-embedded biopsy specimens from oral LP (n=42 and cutaneous LP (n=38 against normal control tissues. The results showed that the percentage of cells expressing IL-22 and IL-23 in LP were significantly higher in LP compared to controls, respectively (both P<0.001. The correlation between IL-22 and IL-23 expression was significant (P<0.05. Moreover, the percentage of cells expressing IL-22 and IL-23 in oral LP were significantly higher than cutaneous LP (P<0.05. Collectively, our findings demonstrated that the increased expression of IL-22 and IL-23 in LP lesions could play roles in the pathogenesis of LP. Moreover, oral LP expressing IL-22 and IL-23 was higher than cutaneous LP, probably due to Th22 cells as an important component of oral mucosal host defense against oral microbiota and tissue antigens. This may be associated with the difference in clinical behaviour of the two variants of the disease.

23. ATSR congress - Proceedings

International Nuclear Information System (INIS)

2006-11-01

This document brings together the available presentations given at the 23. congress of the French association for radiation protection techniques and sciences (ATSR): 1 - J-F. Lecomte (CIPR): International commission of radiological protection (ICRP)'s recommendations; 2 - T. Lahaye (DGT): presentation of the 'worker's decree'; 3 - C. Marchal (DGSNR): Nuclear safety authority (ASN) viewpoint: first controllers' experience feedback; 4 - F. Rollinger (IRSN): missions of the IRSN's public expert for workers radiation protection; 5 - J-C. Varin (Areva NC): technical, organisational and managerial aspects of the implementation of new regulatory dispositions about radiation protection technical controls at La Hague facility; 6 - J-J. Radecki (Areva NC): enforcement of the radiological zoning by-law at Areva facilities; 7 - D. Miniere (EDF): implementation of the ALARA approach at EDF's nuclear power plants; 8 - D. Lefer (EAMEA): situation in the army and issues generated by the new decree; 9 - L. Ridel (DGA SPN): waste management aspect in the framework of submarines dismantling; 10 - D. Giordan (CMIR 78): the workers' decree: from practice to intervention; 11 - N. Barrey (CHU Bordeaux): enforcement of the May 2004 by-law and experience feedback; 12 - J-C. Mozziconacci (CH Bourges): zoning, reclassification and implementation of the medical imaging operational dosimetry in a medium size hospital; 13 - J. Bino (AMEST Lille): recommendations and technical instructions for labour doctors; 14 - K. Zarraa (CERAP): decree impact on approved organisations; 15 - D. Morio (COFREND): difficulties encountered with the implementation of radiographical devices; 16 - B. Carrez (Ponts et Chaussees): workplace studies and operational dosimetries: essential tools at public work sites; 17 - G. Imbard (CEA): evolution of workers regulation, adaptation of practices at Marcoule site; 18 - M. Ammerich (CEA): ambiguities and enforcement difficulties of the workers' decree; 19 - H. Mansoux

A study plan for determining recharge rates at the Hanford Site using environmental tracers

International Nuclear Information System (INIS)

Murphy, E.M.; Szercsody, J.E.; Phillips, S.J.

1991-02-01

This report presents a study plan for estimating recharge at the Hanford Site using environmental tracers. Past operations at the Hanford Site have led to both soil and groundwater contamination, and recharge is one of the primary mechanisms for transporting contaminants through the vadose zone and into the groundwater. An alternative to using fixed lysimeters for determining recharge rates in the vadose zone is to use environmental tracers. Tracers that have been used to study water movement in the vadose zone include total chloride, 36 Cl, 3 H, and 2 H/ 18 O. Atmospheric levels of 36 Cl and 3 H increased during nuclear bomb testing in the Pacific, and the resulting ''bomb pulse'' or peak concentration can be measured in the soil profile. Locally, past operations at the Hanford Site have resulted in the atmospheric release of numerous chemical and isotopic tracers, including nitrate, 129 I, and 99 Tc. Seven study sites on the Hanford Site have been selected, in two primary soil types that are believed to represent the extremes in recharge, the Quincy sand and the Warden silt loam. An additional background study site upwind of the Hanford facilities has been chosen at the Yakima Firing Center. Six tracer techniques (total chloride, 36 Cl, 3 H, nitrate, 129 I, and 99 Tc) will be tested on at least one site in the Quincy sand, one site in the Warden silt loam, and the background site, to determine which combination of tracers works best for a given soil type. In subsequent years, additional sites will be investigated. The use of environmental tracers is perhaps the only cost-effective method for estimating the spatial variability of recharge at a site as large as Hanford. The tracer techniques used at Hanford have wide applicability at other arid sites. 166 refs., 41 figs., 16 tabs

Closure Report for Corrective Action Unit 340: NTS Pesticide Release Sites Nevada Test Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

C. M. Obi

2000-05-01

The purpose of this report is to provide documentation of the completed corrective action and to provide data confirming the corrective action. The corrective action was performed in accordance with the approved Corrective Action Plan (CAP) (U.S. Department of Energy [DOE], 1999) and consisted of clean closure by excavation and disposal. The Area 15 Quonset Hut 15-11 was formerly used for storage of farm supplies including pesticides, herbicides, and fertilizers. The Area 23 Quonset Hut 800 was formerly used to clean pesticide and herbicide equipment. Steam-cleaning rinsate and sink drainage occasionally overflowed a sump into adjoining drainage ditches. One ditch flows south and is referred to as the quonset hut ditch. The other ditch flows southeast and is referred to as the inner drainage ditch. The Area 23 Skid Huts were formerly used for storing and mixing pesticide and herbicide solutions. Excess solutions were released directly to the ground near the skid huts. The skid huts were moved to a nearby location prior to the site characterization performed in 1998 and reported in the Corrective Action Decision Document (CADD) (DOE, 1998). The vicinity and site plans of the Area 23 sites are shown in Figures 2 and 3, respectively.

The Violence Prevention Community Meeting: A Multi-Site Study.

Science.gov (United States)

Lanza, Marilyn; Ridenour, Marilyn; Hendricks, Scott; Rierdan, Jill; Zeiss, Robert; Schmidt, Satu; Lovelace, Jeff; Amandus, Harlan

2016-06-01

The Violence Prevention Community Meeting (VPCM) is a specialized form of community meeting in which avoiding violence and promoting non-violent problem solving and interpersonal civility are focal points. A nationwide study to assess the VPCM as an effective intervention to reduce workplace violence was undertaken. Seven acute locked psychiatric units of the Veterans Health Administration (VHA) throughout the United States participated in the study. All patients and all staff on the seven in-patient locked psychiatry units participated in the intervention (VPCM) or as a control (treatment as usual). The study was 21weeks at each site. The three time periods were pre-treatment weeks 1-3, treatment weeks 4-18, and post-treatment weeks 19-21. The VPCM was conducted during the treatment weeks. Overall rates of aggression declined by 0.6% (95% CI: -5.6%, 6.5%; nonsignificant) per week in the intervention hospitals and by 5.1% (95% CI: 0.4%, 9.6%; significant) per week for the control hospitals. Aggression decreased for both the intervention and control hospitals which could be due to enrollment in a research study and thus being more aware of their ability to address workplace violence at their site. Published by Elsevier Inc.

Nuclear Energy Center study. Phase II. Site suitability analysis. Final report

Energy Technology Data Exchange (ETDEWEB)

Fellows, W.S.; Sharp, J.M.; Benator, B.I.

1978-06-01

A site screening study was conducted to identify a site or sites for detailed, site-specific study as a nuclear energy center. Using technical criteria of water requirements, geotechnical constraints, and projected load center and transmission considerations as well as environmental and institutional considerations, five potential study sites in the State of South Carolina were identified, evaluated against established criteria, and ranked according to their acceptability as potential nuclear energy center study sites. Consideration of what is ''representative'' of a site as well as the ranking score was factored into site recommendations, since the site deemed easiest to license and permit may not be the most desirable site for future study of the technical and institutional feasibility and practicality of a specific site. The sites near Lake Hartwell and the Savannah River Plant (SRP) of the Department of Energy were selected as potential study sites after consideration of the above criteria. Because the Lake Hartwell site offers the opportunity to consider institutional issues which may be more representative of other possible NEC sites, it is recommended that the Lake Hartwell site be studied to establish the feasibility and practicality of the nuclear energy concept on a site-specific basis.

A Goal Programming Model for the Siting of Multilevel EMS Systems.

Science.gov (United States)

1980-03-01

Management," unpublished Ph.D. thesis, University of Texas, Austin, Texas, 1971. -23- (11) Daskin , M. and E. Stern, " A Multiobjective Set Covering...GOAL PROGRAM4MING MODEL FOR THE SITING OF MULTILEVEL EMS SYSTE-ETC(U) UNM1AR 80 A CHARNES, J E STORBECK N000iA-75-C-569 WICLASSIFIED CCS-366 N...366 A GOAL PROGRAMMING MODEL FOR THE SITING OF MULTILEVEL EMS SYSTEMS by A . Charnes J. Storbeck March 1980 This project was partially supported by

Conformational plasticity at the IgE-binding site of the B-cell receptor CD23.

Science.gov (United States)

Dhaliwal, Balvinder; Pang, Marie O Y; Yuan, Daopeng; Yahya, Norhakim; Fabiane, Stella M; McDonnell, James M; Gould, Hannah J; Beavil, Andrew J; Sutton, Brian J

2013-12-01

IgE antibodies play a central role in allergic disease. They recognize allergens via their Fab regions, whilst their effector functions are controlled through interactions of the Fc region with two principal cell surface receptors, FcɛRI and CD23. Crosslinking of FcɛRI-bound IgE on mast cells and basophils by allergen initiates an immediate inflammatory response, while the interaction of IgE with CD23 on B-cells regulates IgE production. We have determined the structures of the C-type lectin "head" domain of CD23 from seven crystal forms. The thirty-five independent structures reveal extensive conformational plasticity in two loops that are critical for IgE binding. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

Siting of nuclear desalination plants in Saudi Arabia: A seismic study

International Nuclear Information System (INIS)

Aljohani, M.S.; Abdul-Fattah, A.F.; Almarshad, A.I.

2005-01-01

This paper presents the selection criteria generally and seismic criteria specifically to select a suitable site in Saudi Arabia for a nuclear desalination plant. These criteria include geological, meteorological, cooling water supply discharge, transport infrastructure, population, electric grid, water network capacity, environmental impact and airport movement. The seismicity of the Arabian peninsula for the locations of seismic activity along the Red Sea and the Arabian Gulf coastlines from 1973 to 2000 was studied carefully. This study included towns and locations along the east and west coastlines and their distances from the seismic event site. The results showed that Rabigh City along the west coast of Saudi Arabia is a good site to build a nuclear desalination plant. This is because of the following reasons: good seismic stability; good weather statistics; no flooding; mild wave conditions; good supply and discharge; good transportation infrastructure; low population area; very close to the huge electric grid. (author)

National radioactive waste repository site selection study. Phase 2. A report on public comment

International Nuclear Information System (INIS)

1995-11-01

Agreement was reached in principle between State/Territory and the Commonwealth of Australia Governments that a suitable site for a radioactive wastes repository must be found. The discussion papers resulting from the Phase 1 and Phase 2 of the site selection study were released for public comment. The national repository will be for disposal of low level and short-lived intermediate level radioactive wastes streaming from the medical, research and industrial use of radioisotopes in Australia. The purpose of this report is to summarise and respond in general terms to comment received on the discussion paper -Phase 2 of the study. Forty five submissions were received. Of these: 18 supported the Phase 2 study approach and the concept of a national repository; 13 did not state a clear position but either requested more information or provided constructive comment on the siting process; 7 supported the site selection approach and the repository concept but suggested that the repository should not be sited in a particular area; 3 opposed the siting of the repository in their vicinity but not necessarily the repository concept and site selection approach; 4 opposed the concept of a national repository. This compares with 124 submissions on Phase 1 of the study, of which 57 opposed the national repository concept (52 of these were from letters elicited by Greenpeace) and 48 supported the establishment of a national repository and the site selection approach proposed. 3 figs

A comparative study of floor construction on sloping sites: an analysis of cumulative energy demand and greenhouse gas emissions

Directory of Open Access Journals (Sweden)

Grace Ding

2016-03-01

Full Text Available In order to make environmentally aware decisions, there is growing interest in the comparative energy and greenhouse gas (GHG performance of competing construction methods. Little research has been done concerning competing ground floor construction methods, especially given different site variables, such as slope and soil type. A life cycle assessment approach was adopted to analyse environmental impacts, including cumulative energy demand and GHG emissions for detached housing construction in Australia. Data was drawn from 24 case study housing projects, including 12 reinforced concrete and 12 suspended timber floor projects. The data presented in the paper compares cumulative energy demand, GHG and the constituent parts of competing construction methods. The findings indicate that the timber floors use/create significantly less cumulative energy demand and GHG emissions than concrete floors—approximately 2.1 to 2.7 times less energy and 2.3 to 2.9 times less GHG. These findings are limited to the site slope and foundation soil types identified in the paper. The main application of the work is in guidance concerning the lowest environmental impact options for detached housing construction.

CLOSURE REPORT FOR CORRECTIVE ACTION UNIT 204: STORAGE BUNKERS, NEVADA TEST SITE, NEVADA

International Nuclear Information System (INIS)

2006-01-01

Corrective Action Unit (CAU) 330 consists of four Corrective Action Sites (CASs) located in Areas 6, 22, and 23 of the Nevada Test Site (NTS). The unit is listed in the Federal Facility Agreement and Consent Order (FFACO, 1996) as CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites. CAU 330 consists of the following CASs: CAS 06-02-04, Underground Storage Tank (UST) and Piping CAS 22-99-06, Fuel Spill CAS 23-01-02, Large Aboveground Storage Tank (AST) Farm CAS 23-25-05, Asphalt Oil Spill/Tar Release

Closure Report for Corrective Action Unit 537: Waste Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

NSTec Environmental Restoration

2007-01-01

Corrective Action Unit (CAU) 537 is identified in the ''Federal Facility Agreement and Consent Order'' (FFACO) of 1996 as Waste Sites. CAU 537 is located in Areas 3 and 19 of the Nevada Test Site, approximately 65 miles northwest of Las Vegas, Nevada, and consists of the following two Corrective Action Sites (CASs): CAS 03-23-06, Bucket; Yellow Tagged Bags; and CAS 19-19-01, Trash Pit. CAU 537 closure activities were conducted in April 2007 according to the FFACO and Revision 3 of the Sectored Clean-up Work Plan for Housekeeping Category Waste Sites (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2003). At CAS 03-23-06, closure activities included removal and disposal of a 15-foot (ft) by 15-ft by 8-ft tall wooden shed containing wood and metal debris and a 5-gallon plastic bucket containing deteriorated plastic bags with yellow radioactive contamination tape. The debris was transported to the Area 9 U10c Landfill for disposal after being screened for radiological contamination according to the ''NV/YMP Radiological Control Manual'' (NNSA/NSO, 2004). At CAS 19-19-01, closure activities included segregation, removal, and disposal of non-friable, non-regulated asbestos-containing material (ACM) and construction debris. The ACM was determined to be non-friable by waste characterization samples collected prior to closure activities. The ACM was removed and double-bagged by licensed, trained asbestos workers and transported to the Area 9 U10c Landfill for disposal. Construction debris was transported in end-dump trucks to the Area 9 U10c Landfill for disposal. Closure activities generated sanitary waste/construction debris and ACM. Waste generated during closure activities was appropriately managed and disposed. Waste characterization sample results are included as Appendix A of this report, and waste disposition documentation is included as Appendix B of this report. Copies of the Sectored Housekeeping Site Closure

Fibroblast Growth Factor-23—A Potential Uremic Toxin

Directory of Open Access Journals (Sweden)

Piotr Kuczera

2016-12-01

Full Text Available Fibroblast growth factor-23 (FGF23 is a circulating member of the FGF family produced mainly by the osteocytes and osteoblasts that can act as a hormone. The main action of FGF23 is to lower phosphatemia via the reduction of urinary phosphate reabsorption and the decrease of 1,25(OH2-D generation in the kidney. In the course of chronic kidney disease (CKD, plasma FGF23 concentration rises early, most probably to compensate the inability of the deteriorating kidneys to excrete an adequate amount of phosphate. However, this comes at the cost of FGF23-related target organ toxicity. Results of clinical studies suggest that elevated plasma FGF23 concentration is independently associated with the increased risk of CKD progression, occurrence of cardio-vascular complications, and mortality in different stages of CKD. FGF23 also contributes to cardiomyocyte hypertrophy, vascular calcification, and endothelial dysfunction. The impact of FGF23 on heart muscle is not dependent on Klotho, but rather on the PLCγ–calcineurin–NFAT (nuclear factor of activated T-cells pathway. Among the factors increasing plasma FGF23 concentration, active vitamin D analogues play a significant role. Additionally, inflammation and iron deficiency can contribute to the increase of plasma FGF23. Among the factors decreasing plasma FGF23, dietary phosphate restriction, some intestinal phosphate binders, cinacalcet (and other calcimimetics, and nicotinamide can be enumerated. Anti-FGF23 antibodies have also recently been developed to inhibit the action of FGF23 in target organs. Still, the best way to normalize plasma FGF23 in maintenance hemodialysis patients is restoring kidney function by successful kidney transplantation.

A role for INDEPTH Asian sites in translating research to action for non-communicable disease prevention and control: a case study from Ballabgarh, India.

Science.gov (United States)

Krishnan, Anand; Nongkynrih, Baridalyne; Kapoor, Suresh Kumar; Pandav, Chandrakant

2009-09-28

The International Network of field sites with continuous Demographic Evaluation of Populations and Their Health (INDEPTH) has 34 Health and Demographic Surveillance System (HDSS) in 17 different low and middle-income countries. Of these, 23 sites are in Africa, 10 sites are in Asia, and one in Oceania. The INDEPTH HDSS sites in Asia identified chronic non-communicable diseases (NCDs) as a neglected area of attention. As a first step, they conducted NCD risk factor surveys within nine sites in five countries. These sites are now looking to broaden the agenda of research on NCDs using the baseline data to inform policy and practice. A conceptual framework for translating research into action for NCDs at INDEPTH sites was developed. This had five steps - assess the problem, understand the nature of the problem, evaluate different interventions in research mode, implement evidence-based interventions in programme mode, and finally, share knowledge and provide leadership to communities and countries. Ballabgarh HDSS site in India has successfully adopted these steps and is used as a case study to demonstrate how this progress was achieved and what factors were responsible for a successful outcome. Most of the HDSS sites are in the second step of the process of translating research to action (understand the problem). The conduct of NCD risk factor surveys has enabled an assessment of the burden of NCD risk together with determinants in order to understand the burden at the population level. The experience from Ballabgarh HDSS exemplifies that the following steps - pilot testing the interventions, implementing activities in programme mode, and finally, share knowledge and provide leadership - are also possible in rural settings in low-income countries. The critical success factors identified were involvement of a premier medical institution, pre-existing links to policy makers and programme managers, strong commitment of the HDSS team and adequate human resource capacity

Operational Challenges and Solutions with Implementation of an Adaptive Seamless Phase 2/3 Study

Science.gov (United States)

Spencer, Kimberly; Colvin, Kelly; Braunecker, Brad; Brackman, Marcia; Ripley, Joyce; Hines, Paul; Skrivanek, Zachary; Gaydos, Brenda; Geiger, Mary Jane

2012-01-01

A wide variety of operational issues were encountered with the planning and implementation of an adaptive, dose-finding, seamless phase 2/3 trial for a diabetes therapeutic. Compared with a conventional design, significant upfront planning was required, as well as earlier, more integrated cross-functional coordination. The existing infrastructure necessitated greater flexibility to meet the needs of the adaptive design. Rapid data acquisition, analysis, and reporting were essential to support the successful implementation of the adaptive algorithm. Drug supply for nine treatment arms had to be carefully managed across many sites worldwide. Details regarding these key operational challenges and others will be discussed along with resolutions taken to enable successful implementation of this adaptive, seamless trial. PMID:23294774

A crystallographic and spectroscopic study of crystal sites in the 'spinel' structure; Etude cristallographique et spectroscopique des sites cristallins dans la structure 'spinelle'

Energy Technology Data Exchange (ETDEWEB)

Drifford, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1967-06-15

A crystallographic study on magnesium aluminates led to the determination of crystal site average distortion. A spectroscopic study of transition elements doped spinels gave the position of the doping element in tetrahedral (A) or octahedral (B) sites, and the local distortion of the latter. The comparison of average and local parameters points to differences in the behaviour of doping elements and shows the size of (A) sites are independent of the host crystal composition while the average size of (B) sites varies with the composition. (author) [French] Une etude cristallographique des aluminates de magnesium a permis de determiner la deformation moyenne des sites cristallins. Une etude spectroscopique des aluminates de magnesium dopes avec des elements de transition a permis de localiser les dopants entre les sites tetraedriques (A) et octaedriques (B) et d'etudier la deformation locale de ces sites. La comparaison entre les parametres moyens et locaux a caracterise le comportement du dopant et montre que les dimensions des sites (A) sont independantes de la composition de la matrice, alors que les caracteristiques geometriques moyennes des sites (B) varient continument avec la composition. (auteur)

Siting studies for new nuclear power plants in Argentina

International Nuclear Information System (INIS)

Barbaran, Gustavo A.

2008-01-01

This paper is a summary of the thesis prepared by the Group of Prospective and Energy Planning of the National Atomic Energy Commission for the 'Specialization on Applications of Nuclear Technology Course' of the Instituto Balseiro in 2007. It describes the evolution of siting studies through time and the main focus worldwide in this type of studies. Then, it makes a brief review of previous siting studies of nuclear power plants conducted in Argentina. It carries out a description of the methodology to conduct a site evaluation for nuclear power plants according to actual international criteria. Finally, it describes the licensing process that follows every site study. (author) [es

Emerging adults' use of alcohol and social networking sites during a large street festival: A real-time interview study.

Science.gov (United States)

Whitehill, Jennifer M; Pumper, Megan A; Moreno, Megan A

2015-05-20

Emerging adults have high rates of heavy episodic drinking (binge drinking) and related risks including alcohol-impaired driving. To understand whether social networking sites (SNSs) used on mobile devices represent a viable platform for real-time interventions, this study measured emerging adults' use of two popular SNSs (Facebook and Twitter) during the Mifflin Street Block Party. This annual festival is held in Madison, Wisconsin and is known for high alcohol consumption. Event attendees ages 18-23 years were recruited by young adult research assistants (>21 years). Participants completed a brief in-person interview assessing drinking intensity, use of SNSs, and use of SNSs to plan transportation. Analyses included t-tests, chi-squared tests, and Fisher's exact tests. At the event, nearly all of the 200 participants (97 %) consumed alcohol and 18 % met criteria for heavy episodic drinking. Approximately one-third of participants had used Facebook or Twitter on the day of the event. Facebook use (23 %) was more prevalent than Twitter use (18 %), especially among heavy episodic drinkers. Use of either SNS was 41 % among females and 24 % among males (χ (2)=6.01; df=1; p=0.01). Plans to use a SNS to arrange transportation were relatively uncommon (4 %), but this was more frequent among heavy episodic drinkers (11 %) compared to non-heavy episodic drinkers (2 %) (Fisher's exact p=0.02). These results indicate that SNSs are used during alcohol consumption and warrant exploration as a way to facilitate connections to resources like safe ride services.

Corrective Action Investigation Plan for Corrective Action Unit 366: Area 11 Plutonium Valley Dispersion Sites, Nevada National Security Site, Nevada

International Nuclear Information System (INIS)

Matthews, Patrick

2011-01-01

Corrective Action Unit 366 comprises the six corrective action sites (CASs) listed below: (1) 11-08-01, Contaminated Waste Dump No.1; (2) 11-08-02, Contaminated Waste Dump No.2; (3) 11-23-01, Radioactively Contaminated Area A; (4) 11-23-02, Radioactively Contaminated Area B; (5) 11-23-03, Radioactively Contaminated Area C; and (6) 11-23-04, Radioactively Contaminated Area D. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed July 6, 2011, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 366. The presence and nature of contamination at CAU 366 will be evaluated based on information collected from a field investigation. Radiological contamination will be evaluated based on a comparison of the total effective dose (TED) at sample locations to the dose-based final action level (FAL). The TED will be calculated by summing the estimates of internal and external dose. Results from the analysis of soil samples collected from sample plots will be used to calculate internal radiological dose. Thermoluminescent dosimeters placed at each sample location will be used to measure external radiological dose. Based on historical documentation of the releases

Corrective Action Investigation Plan for Corrective Action Unit 567: Miscellaneous Soil Sites, Nevada National Security Site, Nevada, with ROTC 1 Revision 0

Energy Technology Data Exchange (ETDEWEB)

Matthews, Patrick K.

2013-07-01

Corrective Action Unit (CAU) 567 is located in Areas 1, 3, 5, 20, and 25 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 567 is a grouping of sites where there has been a suspected release of contamination associated with nuclear testing. This document describes the planned investigation of CAU 567, which comprises the following corrective action sites (CASs): • 01-23-03, Atmospheric Test Site T-1 • 03-23-25, Seaweed E Contamination Area • 05-23-07, A5b RMA • 20-23-08, Colby Mud Spill • 25-23-23, J-11 Soil RMA These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the investigation report. The sites will be investigated based on the data quality objectives (DQOs) developed on May 6, 2013, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Field Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 567. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The potential contamination sources associated with CAU 567 releases are nuclear test operations and other NNSS operations. The DQO process resulted in an assumption that total effective dose (TED) within a default contamination boundary

The Cottonwood Lake study area, a long-term wetland ecosystem monitoring site

Science.gov (United States)

Mushet, David M.; Euliss, Ned H.

2012-01-01

The Cottonwood Lake study area is one of only three long-term wetland ecosystem monitoring sites in the prairie pothole region of North America; the other two are Orchid Meadows in South Dakota and St. Denis in Saskatchewan. Of the three, Cottonwood Lake has, by far, the longest continuous data-collection record. Research was initiated at the study area in 1966, and intensive investigations of the hydrology, chemistry, and biology of prairie pothole wetlands continue at the site today. This fact sheet describes the study area, provides an overview of wetland ecology research that has been conducted at the site in the past, and provides an introduction to current work being conducted at the study area by USGS scientists.

A 23Na Multiple-Quantum-Filtered NMR Study of the Effect of the Cytoskeleton Conformation on the Anisotropic Motion of Sodium Ions in Red Blood Cells

Science.gov (United States)

Knubovets, Tatyana; Shinar, Hadassah; Eliav, Uzi; Navon, Gil

1996-01-01

Recently, it has been shown that23Na double-quantum-filtered NMR spectroscopy can be used to detect anisotropic motion of bound sodium ions in biological systems. The technique is based on the formation of the second-rank tensor when the quadrupolar interaction is not averaged to zero. Using this method, anisotropic motion of bound sodium in human and dog red blood cells was detected, and the effect was shown to depend on the integrity of the membrane cytoskeleton. In the present study, multiple-quantum-filtered techniques were applied in combination with a quadrupolar echo to measure the transverse-relaxation times,T2fandT2s. Line fitting was performed to obtain the values of the residual quadrupolar interaction, which was measured for sodium in a variety of mammalian erythrocytes of different size, shape, rheological properties, and sodium concentrations. Human unsealed white ghosts were used to study sodium bound at the anisotropic sites on the inner side of the RBC membrane. Modulations of the conformation of the cytoskeleton by the variation of either the ionic strength or pH of the suspending medium caused drastic changes in both the residual quadrupolar interaction andT2fdue to changes in the fraction of bound sodium ions as well as changes in the structure of the binding sites. By combining the two spectroscopic parameters, structural change can be followed. The changes in the structure of the sodium anisotropic binding sites deduced by this method were found to correlate with known conformational changes of the membrane cytoskeleton. Variations of the medium pH affected both the fraction of bound sodium ions and the structure of the anisotropic binding sites. Sodium and potassium were shown to bind to the anisotropic binding sites with the same affinity.

Site study plan for cultural resources, Deaf Smith County site, Texas: Environmental Field Program: Preliminary draft

International Nuclear Information System (INIS)

1987-06-01

The Cultural Resources Site Study Plan describes a field program to identify and evaluate the archaeological, historical, and Native American Indian resources of the site on local and regional perspectives; monitor and manage discovered cultural resources; and establish a worker education program. The archaeological field program consists of three pedestrian surveys: Survey 1 includes two EDBH seismic survey lines and the area within the exploratory shaft facility (ESF); Survey 2 includes the remainder of the site plus a 1/4 to 3/4-mi border area; and Survey 3 includes an assortment of offsite areas. The historical studies will identify and evaluate known and discovered historical sites and structures and the Native American Indian will identify and evaluate cultural and religious concerns expressed by Indian tribal groups. Prehistoric and historic sites will be evaluated to determine if they meet eligibility criteria for listing on the National Register of Historic Places. This site study plan describes the need for each study; its design and design rationale; analysis, management, and use of data; schedule of field activities; organization of field personnel and sample management; and quality assurance requirements. The cultural resource studies will provide data for satisfying the Programmatic Agreement, engineering design needs, and SRP requirements for permits and approvals, and for minimizing effects to any cultural properties discovered during site characterization. 75 refs., 10 figs., 2 tabs

Biochemical and Structural Characterization of WlbA from Bordetella pertussis and Chromobacterium violaceum: Enzymes Required for the Biosynthesis of 2,3-Diacetamido-2,3-dideoxy-d-mannuronic Acid

Energy Technology Data Exchange (ETDEWEB)

Thoden, James B.; Holden, Hazel M. (UW)

2011-12-22

The unusual sugar 2,3-diacetamido-2,3-dideoxy-d-mannuronic acid, or ManNAc3NAcA, has been observed in the lipopolysaccharides of both pathogenic and nonpathogenic Gram-negative bacteria. It is added to the lipopolysaccharides of these organisms by glycosyltransferases that use as substrates UDP-ManNAc3NAcA. Five enzymes are ultimately required for the biosynthesis of UDP-ManNAc3NAcA starting from UDP-N-acetylglucosamine. The second enzyme in the pathway, encoded by the wlba gene and referred to as WlbA, catalyzes the NAD-dependent oxidation of the C-3' hydroxyl group of the UDP-linked sugar. Here we describe a combined structural and functional investigation of the WlbA enzymes from Bordetella pertussis and Chromobacterium violaceum. For this investigation, ternary structures were determined in the presence of NAD(H) and substrate to 2.13 and 1.5 {angstrom} resolution, respectively. Both of the enzymes display octameric quaternary structures with their active sites positioned far apart. The octamers can be envisioned as tetramers of dimers. Kinetic studies demonstrate that the reaction mechanisms for these enzymes are sequential and that they do not require {alpha}-ketoglutarate for activity. These results are in sharp contrast to those recently reported for the WlbA enzymes from Pseudomonas aeruginosa and Thermus thermophilus, which function via ping-pong mechanisms that involve {alpha}-ketoglutarate. Taken together, the results reported here demonstrate that there are two distinct families of WlbA enzymes, which differ with respect to amino acid sequences, quaternary structures, active site architectures, and kinetic mechanisms.

Intrinsic Remediation Treatability Study for Site ST-29 Patrick Air Force Base, Florida

Science.gov (United States)

1995-08-01

of the northeast/southwest (NE/SW) runway. The BX Service Station has been in operation since 1954. The site consists of a small food market (Building... UCg /1 0 86-4-MWD .09 12.4 1.47 0 86-5-MWS .17 23.6 6.86 86-7 .12 30.2 2.52 86-8 .10 44.7 8.51 86-9-MWD .11 34.7 15.3 86-9-MWD Dup .11 86-9-MWS .10

Coaching at the Building Site – A Feasibility Study

DEFF Research Database (Denmark)

Koch, Christian; Alsdorf, Morten; Sander, Dag

2006-01-01

successfully at a building site, in certain specific situations. The feeling of security is important for the focus persons at the building site and is best obtained in the open air. The way the leader acts towards the employee/focus person is decisive. Consciousness and responsibility is developed......Coaching has become widely used in business, and is well described. However it is rarely used in construction. This makes a contrast to the poor performance of site interaction, leading to a vast amount of reported cooperation and coordination problems. This paper investigates the feasibility...... observations in a building site operating with lean construction, where the managers did not use coaching consciously in their interaction with employees. 29 participant observations of five of the managers at the building site were carried out, at individual- and group meetings. Coaching can be used...

Design of an environmental site assessment template for open radioactive site contamination : a radioecological risk approach and case study

International Nuclear Information System (INIS)

Nguyen, T.

2004-01-01

To reduce redundancy, cost, and time, while at the same time ultimately increasing the effectiveness of the radioactive risk management process, a logical framework incorporating risk assessments (human cancer and environmental risks) into the environmental site assessment process was designed for radioactive open site contamination. Risk-based corrective action is becoming an increasingly more acceptable approach for the remediation of contaminated sites. In the past, cleanup goals were usually established without any regard to the risk involved, by mandating remediation goals based solely on maximum contamination levels. Now, a multi-stage environmental site assessment template has been developed on a radioecological approach. The template gives a framework for making environmentally sound decisions based on relevant regulations and guidelines. The first stage involves the comparison of the background screening activity level to the regulated activity level, the second stage involves the use of site-specific information to determine the risk involved with the contamination, and the third stage provides a remediation decision matrix based on results from the first two stages. This environmental site assessment template is unique because it incorporates the modified Canadian National Classification System for radioactive contaminated sites and two different types of risk assessments (human cancer risks and the newly designed ecological risk) into the decision making process. The template was used to assess a radiologically contaminated site at the Canadian Forces Base at Suffield (Alberta) as a case study, and it reaffirms the Department of National Defence's action as appropriate. This particular site is a Class 3, has an overall insignificant human cancer risk ( -6 ) and a low environmental risk, and conforms to all regulated guidelines. Currently, it is restricted and should be left as is, provided that the subsurface is not disturbed. (author)

Adsorption of the diazo dye Direct Red 23 onto a zinc oxide surface: A spectroscopic study

Science.gov (United States)

Lucilha, Adriana Campano; Bonancêa, Carlos Eduardo; Barreto, Wagner José; Takashima, Keiko

2010-01-01

The adsorption of the diazo dye Direct Red 23 onto a zinc oxide surface at 30 °C in the dark was investigated. The color reduction was monitored by spectrophotometry at 503 nm. The FTIR and Raman spectra of the Direct Red 23 adsorption as a function of ZnO concentration were registered. From the PM3 semi-empirical calculations of the atomic charge density and dipole moment of the Direct Red 23 molecule, it was demonstrated that the azo dye molecule may be adsorbed onto the ZnO surface through molecule geometry modifications, enhancing the interfacial area causing a variation in the bonding frequencies.

Site study plan for routine laboratory rock mechanics, Deaf Smith County Site, Texas: Revision 1

International Nuclear Information System (INIS)

1987-12-01

This Site Study Plan for Routine Laboratory Rock Mechanics describes routine laboratory testing to be conducted on rock samples collected as part of the characterization of the Deaf Smith County site, Texas. This study plan describes the early laboratory testing. Additional testing may be required and the type and scope of testing will be dependent upon the results of the early testing. This study provides for measurements of index, hydrological, mechanical, and chemical properties with tests which are standardized and used widely in geotechnical investigations. Another Site Study Plan for Nonroutine Laboratory Rock Mechanics describes laboratory testing of samples from the site to determine mechanical, thermomechanical, and thermal properties by less widely used methods, many of which have been developed specifically for characterization of the site. Data from laboratory tests will be used for characterization of rock strata, design of shafts and underground facilities, and modeling of repository behavior in support of resolution of both preclosure and postclosure issues. A tentative testing schedule and milestone log are given. A quality assurance program will be utilized to assure that activities affecting quality are performed correctly and that appropriate documentation is maintained. 18 refs., 8 figs., 3 tabs

Corrective Action Decision Document for Corrective Action Unit 568. Area 3 Plutonium Dispersion Sites, Nevada National Security Site, Nevada Revision 0

Energy Technology Data Exchange (ETDEWEB)

Matthews, Patrick [Nevada Field Ofice, Las Vegas, NV (United States). National Nuclear Security Administration

2015-08-01

The purpose of this Corrective Action Decision Document is to identify and provide the rationale for the recommendation of corrective action alternatives (CAAs) for the 14 CASs within CAU 568. Corrective action investigation (CAI) activities were performed from April 2014 through May 2015, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 568: Area 3 Plutonium Dispersion Sites, Nevada National Security Site, Nevada; and in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices. The purpose of the CAI was to fulfill data needs as defined during the DQO process. The CAU 568 dataset of investigation results was evaluated based on a data quality assessment. This assessment demonstrated that the dataset is complete and acceptable for use in fulfilling the DQO data needs. Based on the evaluation of analytical data from the CAI, review of future and current operations at the 14 CASs, and the detailed and comparative analysis of the potential CAAs, the following corrective actions are recommended for CAU 568: • No further action is the preferred corrective action for CASs 03-23-17, 03-23-22, 03-23-26. • Closure in place is the preferred corrective action for CAS 03-23-19; 03-45-01; the SE DCBs at CASs 03-23-20, 03-23-23, 03-23-31, 03-23-32, 03-23-33, and 03-23-34; and the Pascal-BHCA at CAS 03-23-31. • Clean closure is the preferred corrective action for CASs 03-08-04, 03-23-30, and 03-26-04; and the four well head covers at CASs 03-23-20, 03-23-23, 03-23-31, and 03-23-33.

7 CFR 15a.23 - Recruitment.

Science.gov (United States)

2010-01-01

... 7 Agriculture 1 2010-01-01 2010-01-01 false Recruitment. 15a.23 Section 15a.23 Agriculture Office... FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 15a.23 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which this subpart applies shall...

History of Tank 23, 1962 through 1974

International Nuclear Information System (INIS)

McNatt, F.G.

1979-04-01

Tank 23 was placed in service in April 1964 receiving contaminated water from Buildings 244-H, the Receiving Basin for Off-Site Fuel (RBOF), and 245-H, the Resin Regeneration Facility (RRF). Tank 23 also provided emergency storage space for 500,000 gallons in the event of a severe contamination incident in Building 244-H. The tank has remained in this service since that time. The Tank 23 waste was processed initially by the 242-H evaporator, but since mid-1966 the waste has been processed through a zeolite bed to remove 137 C and other radioisotopes by ion exchange, and discarded to seepage basins. Inspections of the tank interior were made by using a 40-ft optical periscope and the thickness of the steel bottom of the tank was measured ultrasonically. Samples of the waste in the tank and liquid collected in the side wall and bottom sumps were analyzed. Several equipment modifications and repairs were made

Corrective Action Investigation Plan for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada, Rev. No.: 0

Energy Technology Data Exchange (ETDEWEB)

Grant Evenson

2006-04-01

Corrective Action Unit (CAU) 139 is located in Areas 3, 4, 6, and 9 of the Nevada Test Site, which is 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 139 is comprised of the seven corrective action sites (CASs) listed below: (1) 03-35-01, Burn Pit; (2) 04-08-02, Waste Disposal Site; (3) 04-99-01, Contaminated Surface Debris; (4) 06-19-02, Waste Disposal Site/Burn Pit; (5) 06-19-03, Waste Disposal Trenches; (6) 09-23-01, Area 9 Gravel Gertie; and (7) 09-34-01, Underground Detection Station. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives with the exception of CASs 09-23-01 and 09-34-01. Regarding these two CASs, CAS 09-23-01 is a gravel gertie where a zero-yield test was conducted with all contamination confined to below ground within the area of the structure, and CAS 09-34-01 is an underground detection station where no contaminants are present. Additional information will be obtained by conducting a corrective action investigation (CAI) before evaluating corrective action alternatives and selecting the appropriate corrective action for the other five CASs where information is insufficient. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on January 4, 2006, by representatives of the Nevada Division of Environmental Protection; U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office; Stoller-Navarro Joint Venture; and Bechtel Nevada. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 139.

POST-CLOSURE INSPECTION AND MONITORING REPORT FOR CORRECTIVE ACTION UNIT 112: AREA 23 HAZARDOUS WASTE TRENCHES, NEVADA TEST SITE, NEVADA; FOR THE PERIOD OCTOBER 2003 - SEPTEMBER 2004

International Nuclear Information System (INIS)

BECHTEL NEVADA

2004-01-01

Corrective Action Unit (CAU) 112, Area 23 Hazardous Waste Trenches, Nevada Test Site (NTS), Nevada, is a Resource Conservation and Recovery Act (RCRA) unit located in Area 23 of the NTS. This annual Post-Closure Inspection and Monitoring Report provides the results of inspections and monitoring for CAU 112. This report includes a summary and analysis of the site inspections, repair and maintenance, meteorological information, and neutron soil moisture monitoring data obtained at CAU 112 for the current monitoring period, October 2003 through September 2004. Inspections of the CAU 112 RCRA unit were performed quarterly to identify any significant physical changes to the site that could impact the proper operation of the waste unit. The overall condition of the covers and facility was good, and no significant findings were observed. The annual subsidence survey of the elevation markers was conducted on August 23, 2004, and the results indicated that no cover subsidence4 has occurred at any of the markers. The elevations of the markers have been consistent for the past 11 years. The total precipitation for the current reporting period, october 2003 to September 2004, was 14.0 centimeters (cm) (5.5 inches [in]) (National Oceanographic and Atmospheric Administration, Air Resources Laboratory, Special Operations and Research Division, 2004). This is slightly below the average rainfall of 14.7 cm (5.79 in) over the same period from 1972 to 2004. Post-closure monitoring verifies that the CAU 112 trench covers are performing properly and that no water is infiltrating into or out of the waste trenches. Sail moisture measurements are obtained in the soil directly beneath the trenches and compared to baseline conditions for the first year of post-closure monitoring, which began in october 1993. neutron logging was performed twice during this monitoring period along 30 neutron access tubes to obtain soil moisture data and detect any changes that may indicate moisture movement

23. ATSR congress - Proceedings; 23eme congres de l'ATSR - Recueil des conferences

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-11-15

This document brings together the available presentations given at the 23. congress of the French association for radiation protection techniques and sciences (ATSR): 1 - J-F. Lecomte (CIPR): International commission of radiological protection (ICRP)'s recommendations; 2 - T. Lahaye (DGT): presentation of the 'worker's decree'; 3 - C. Marchal (DGSNR): Nuclear safety authority (ASN) viewpoint: first controllers' experience feedback; 4 - F. Rollinger (IRSN): missions of the IRSN's public expert for workers radiation protection; 5 - J-C. Varin (Areva NC): technical, organisational and managerial aspects of the implementation of new regulatory dispositions about radiation protection technical controls at La Hague facility; 6 - J-J. Radecki (Areva NC): enforcement of the radiological zoning by-law at Areva facilities; 7 - D. Miniere (EDF): implementation of the ALARA approach at EDF's nuclear power plants; 8 - D. Lefer (EAMEA): situation in the army and issues generated by the new decree; 9 - L. Ridel (DGA SPN): waste management aspect in the framework of submarines dismantling; 10 - D. Giordan (CMIR 78): the workers' decree: from practice to intervention; 11 - N. Barrey (CHU Bordeaux): enforcement of the May 2004 by-law and experience feedback; 12 - J-C. Mozziconacci (CH Bourges): zoning, reclassification and implementation of the medical imaging operational dosimetry in a medium size hospital; 13 - J. Bino (AMEST Lille): recommendations and technical instructions for labour doctors; 14 - K. Zarraa (CERAP): decree impact on approved organisations; 15 - D. Morio (COFREND): difficulties encountered with the implementation of radiographical devices; 16 - B. Carrez (Ponts et Chaussees): workplace studies and operational dosimetries: essential tools at public work sites; 17 - G. Imbard (CEA): evolution of workers regulation, adaptation of practices at Marcoule site; 18 - M. Ammerich (CEA): ambiguities and enforcement difficulties of

A Study Plan for Determining Recharge Rates at the Hanford Site Using Environmental Tracers

Energy Technology Data Exchange (ETDEWEB)

Murphy, E. M.; Szecsody, J. E.; Phillips, S. J.

1991-02-01

This report presents a study plan tor estimating recharge at the Hanford Site using environmental tracers. Past operations at the Hanford Site have led to both soil and groundwater contamination, and recharge is one of the primary mechanisms for transporting contaminants through the vadose zone and into the groundwater. The prediction of contaminant movement or transport is one aspect of performance assessment and an important step in the remedial investigation/feasibility study (RI/FS) process. In the past, recharge has been characterized by collecting lysimeter data. Although lysimeters can generate important and reliable data, their limitations include 1) fixed location, 2) fixed sediment contents, 3) edge effects, 4) low rates, and 5) relatively short duration of measurement. These limitations impact the ability to characterize the spatial distribution of recharge at the Hanford Site, and thus the ability to predict contaminant movement in the vadose zone. An alternative to using fixed lysimeters for determining recharge rates in the vadose zone is to use environmental tracers. Tracers that have been used to study water movement in the vadose zone include total chloride, {sup 36}CI, {sup 3}H, and {sup 2}H/{sup 18}O. Atmospheric levels of {sup 36}CI and {sup 3}H increased during nuclear bomb testing in the Pacific, and the resulting "bomb pulse" or peak concentration can be measured in the soil profile. Locally, past operations at the Hanford Site have resu~ed in the atmospheric release of numerous chemical and isotopic tracers, including nitrate, {sup 129}I, and {sup 99}Tc. The radionuclides, in particular, reached a well-defined atmospheric peak in 1945. Atmospheric releases of {sup 129}I and {sup 99}Tc were greatly reduced by mid-1946, but nitrogen oxides continued to be released from the uranium separations facilities. As a result, the nitrate concentrations probably peaked in the mid-1950s, when the greatest number of separations facilities were operating

Case study of siting technology for underground nuclear power plant

International Nuclear Information System (INIS)

Hibino, Satoshi; Komada, Hiroya; Honsho, Shizumitsu; Fujiwara, Yoshikazu; Motojima, Mutsumi; Nakagawa, Kameichiro; Nosaki, Takashi

1991-01-01

Underground siting method is one of new feasible siting methods for nuclear power plants. This report presents the results on case studies on underground siting. Two sites of a steeply inclined and plateau like configurations were selected. 'Tunnel type cavern; all underground siting' method was applied for the steeply inclined configuration, and 'shaft type semi-cavern; partial underground siting' method was applied for the plateau like configuration. The following designs were carried out for these two sites as case studies; (1) conceptual designs, (2) geological surveys and rock mechanics tests, (3) stability analysis during cavern excavations, (4) seismic stability analysis of caverns during earthquake, (5) reinforcement designs for caverns, (6) drainage designs. The case studies showed that these two cases were fully feasible, and comparison between two cases revealed that the 'shaft type semi-cavern; partial underground siting' method was more suitable for Japanese islands. As a first step of underground siting, therefore, the authors recommend to construct a nuclear power plant by this method. (author)

Parental mental health after the accidental death of a son during military service: 23-year follow-up study.

Science.gov (United States)

Kristensen, Pål; Heir, Trond; Herlofsen, Pål H; Langsrud, Øyvind; Weisæth, Lars

2012-01-01

We prospectively studied parental mental health after suddenly losing a son in a military training accident. Parents (N = 32) were interviewed at 1, 2 and 23 years after the death of their son. The General Health Questionnaire and Expanded Texas Inventory of Grief were self-reported at 1, 2, 5, and 23 years; the Inventory of Complicated Grief was self-reported at 23 years. We observed a high prevalence of psychiatric disorders at 1- and 2-year follow-ups (57% and 45%, respectively), particularly major depression (43% and 31%, respectively). Only one mental disorder was diagnosed at the 23-year follow-up. Grief and psychological distress were highest at 1- and 2-year follow-ups. Spouses exhibited a high concordance of psychological distress. Mothers reported more intense grief reactions than did fathers. The loss of a son during military service may have a substantial impact on parental mental health particularly during the first 2 years after death. Spouses' grief can be interrelated and may contribute to their psychological distress.

Ablation of the Galnt3 Gene Leads to Low-Circulating Intact Fibroblast Growth Factor 23 (Fgf23) Concentrations and Hyperphosphatemia Despite Increased Fgf23 Expression

OpenAIRE

Ichikawa, Shoji; Sorenson, Andrea H.; Austin, Anthony M.; Mackenzie, Donald S.; Fritz, Timothy A.; Moh, Akira; Hui, Siu L.; Econs, Michael J.

2009-01-01

Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia. The disease is caused by inactivating mutations in fibroblast growth factor 23 (FGF23), Klotho (KL), and uridine diphosphate-N-acetyl-α-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). In vitro studies indicate that GALNT3 O-glycosylates a phosphaturic hormone, FGF23, and prevents its proteolytic processing, thereby allowing secretion of intact FGF23. In this study we generat...

Iron site occupancies in magnetite-ulvospinel solid solution: A new approach using XMCD

Energy Technology Data Exchange (ETDEWEB)

Pearce, C. I.; Henderson, C. M. B.; Telling, N. D.; Pattrick, R. A.D.; Vaughan, D. J.; Charnock, J. M.; Arenholz, E.; Tuna, F.; Coker, V.S.; Laan, G. van der

2009-06-22

Ordering of Fe{sup 3+} and Fe{sup 2+} between octahedral (Oh) and tetrahedral (Td) sites in synthetic members of the magnetite (Fe{sub 3}O{sub 4}) - ulvoespinel (Fe{sub 2}TiO{sub 4}) solid-solution series was determined using Fe L{sub 2,3}-edge X-ray magnetic circular dichroism (XMCD) coupled with electron microprobe and chemical analysis, Ti L-edge spectroscopy, Fe K-edge EXAFS and XANES, Fe{sub 57} Moessbauer spectroscopy, and unit cell parameters. Microprobe analysis, cell edges and chemical FeO determinations showed that the bulk compositions of the samples were stoichiometric magnetite-ulvoespinel solid-solutions. Surface sensitive XMCD showed that the surfaces of these oxide minerals were more sensitive to redox conditions and some samples required re-equilibration with suitable solid-solid buffers. Detailed site-occupancy analysis of these samples gave XMCD-Fe{sup 2+}/Fe{sup 3+} ratios very close to stoichiometric values. L{sub 2,3}-edge spectroscopy showed that Ti{sup 4+} was restricted to Oh sites. XMCD results showed that significant Fe{sup 2+} only entered Td when the Ti content was > 0.40 apfu while Fe{sup 2+} in Oh increased from 1 a.p.f.u in magnetite to a maximum of {approx}1.4 apfu in USP45. As the Ti content increased from this point, the steady increase in Fe{sup 2+} in Td sites was clearly observable in the XMCD spectra, concurrent with a slow decrease in Fe{sup 2+} in Oh sites. Calculated magnetic moments showed a steady decrease from magnetite (4.06 {mu}{sub B}) to USP45 (1.5 {mu}{sub B}) and then a slower decrease towards the value for ulvoespinel (0 {mu}{sub B}). Two of the synthesized samples were also partially maghemitized by re-equilibrating with an oxidizing Ni-NiO buffer and XMCD showed that Fe{sup 2+} oxidation only occurred at Oh sites, with concomitant vacancy formation restricted to this site. This study shows the advantage of using XMCD as a direct measurement of Fe oxidation state in these complex magnetic spinels. These results

Mortality in employees at a New Zealand agrochemical manufacturing site

Science.gov (United States)

Burns, Carol J.; Herbison, G. Peter; Humphry, Noel F.; Bodner, Kenneth; Collins, James J.

2009-01-01

Background Previous studies at the Dow AgroSciences (Formerly Ivon Watkins-Dow) plant in New Plymouth, New Zealand, had raised concerns about the cancer risk in a subset of workers at the site with potential exposure to 2,3,7,8-tetrachlorodibenzo-p-dioxin. As the plant had been involved in the synthesis and formulation of a wide range of agrochemicals and their feedstocks, we examined the mortality risk for all workers at the site. Aims To quantify the mortality hazards arising from employment at the Dow AgroSciences agrochemical production site in New Plymouth, New Zealand. Methods Workers employed between 1 January 1969 and 1 October 2003 were followed up to the end of 2004. Standardized mortality ratios (SMRs) were calculated using national mortality rates by employment duration, sex, period of hire and latency. Results A total of 1754 employees were followed during the study period and 247 deaths were observed. The all causes and all cancers SMRs were 0.97 (95% CI 0.85–1.10) and 1.01 (95% CI 0.80–1.27), respectively. Mortality due to all causes was higher for short-term workers (SMR 1.23, 95% CI 0.91–1.62) than long-term workers (SMR 0.92, 95% CI 0.80–1.06) and women had lower death rates than men. Analyses by latency and period of hire did not show any patterns consistent with an adverse impact of occupational exposures. Conclusions The mortality experience of workers at the site was similar to the rest of New Zealand. PMID:19297337

Social implications of knowing Yahweh: A study of Jeremiah 9:22�23

Directory of Open Access Journals (Sweden)

Wilhelm J. Wessels

2009-09-01

Full Text Available In the brief passage of Jeremiah 9:22�23, wisdom, might and riches are explicitly rejected as reasons for boasting. The only true reason for boasting is if a person �knows Yahweh�. In verse 23, this is linked with three other concepts: steadfast love, justice and righteousness. Jeremiah described the society of his day as corrupt in every sense of the word. People were stubborn, refused to acknowledge Yahweh and showed no signs of truly knowing him. They had, in fact, deserted the Torah of Yahweh. To know Yahweh has social implications. The rhetorical appeal of Jeremiah 9:22�23 to readers and hearers of this oracle is quite clear. To know Yahweh is not to claim to be wise or be the strongest or have the most possessions but to respond to Yahweh�s way of acting. This implies an understanding of his loving�kindness and acting in a morally correct way.

Primary implant stability in augmented sinuslift-sites after completed bone regeneration: a randomized controlled clinical study comparing four subantrally inserted biomaterials.

Science.gov (United States)

Troedhan, Angelo; Schlichting, Izabela; Kurrek, Andreas; Wainwright, Marcel

2014-07-30

Implant-Insertion-Torque-Value (ITV) proved to be a significant clinical parameter to predict long term implant success-rates and to decide upon immediate loading. The study evaluated ITVs, when four different and commonly used biomaterials were used in sinuslift-procedures compared to natural subantral bone in two-stage-implant-procedures. The tHUCSL-INTRALIFT-method was chosen for sinuslifting in 155 sinuslift-sites for its minimal invasive transcrestal approach and scalable augmentation volume. Four different biomaterials were inserted randomly (easy-graft CRYSTAL n = 38, easy-graft CLASSIC n = 41, NanoBone n = 42, BioOss n = 34), 2 ccm in each case. After a mean healing period of 8,92 months uniform tapered screw Q2-implants were inserted and Drill-Torque-Values (DTV) and ITV were recorded and compared to a group of 36 subantral sites without need of sinuslifting. DTV/ITV were processed for statistics by ANOVA-tests. Mean DTV/ITV obtained in Ncm were: Control Group 10,2/22,2, Bio-Oss 12,7/26,2, NanoBone 17,5/33,3, easy-graft CLASSIC 20,3/45,9, easy-graft CRYSTAL 23,8/56,6 Ncm, significance-level of differences throughout p < 0,05. Within the limits of this study the results suggest self-hardening solid-block-like bone-graft-materials to achieve significantly better DTV/ITV than loose granulate biomaterials for its suspected improvement of vascularization and mineralization of the subantral scaffold by full immobilization of the augmentation site towards pressure changes in the human sinus at normal breathing.

Site study plan for borehole search and characterization, Deaf Smith County Site, Texas: Revision 1

International Nuclear Information System (INIS)

1987-01-01

This site study plan describes the Borehole Search and Characterization field activities to be conducted during the early stages of Site Characterization at the Deaf Smith County site, Texas. The field program has been designed to provide data useful in addressing information/data needs resulting from Federal/State/Local regulatory requirements and repository program requirements. Air and ground surveys, an extensive literature search, and landowner interviews will be conducted to locate wells within and adjacent to the proposed nuclear waste repository site in Deaf Smith County. Initially, the study will center around the planned Exploratory Shaft Facilities location and will expand outward from that location. Findings from this study may lead to preparation of a new site study plan to search suspected borehole locations, and excavate or reenter known boreholes for additional characterization or remedial action. The Salt Repository Project (SRP) Networks specify the schedule under which the program will operate. The Technical Field Services Contractor (TFSC) is responsible for conducting the field program. Data will be handled and reported in accordance with established SRP procedures. A quality assurance program will be utilized to assure that activities affecting quality are performed correctly and that appropriate documentation is maintained. 13 refs., 6 figs., 3 tabs

Is there an improvement on the Web sites of the national and international pharmaceutical companies in Turkey? A follow-up study.

Science.gov (United States)

Yegenoglu, Selen; Aslan, Dilek; Sozen, Bilge

2012-04-01

In this follow-up study, we aimed to assess national and international pharmaceutical companies' Web sites using guidelines of The Association of Research-Based Pharmaceutical Companies (AIFD) and Pharmaceutical Manufacturers Association of Turkey (IEIS) to define whether there has been progress since 2004. We used two national guidelines in order to evaluate the Web sites of pharmaceutical companies in our study. The first guideline was from IEIS, and the second was from AIFD, which was issued recently. We collected our data between February 1 and April 30, 2011. Data analyses were performed using SPSS version 15.0. Chi squared test was done for comparing the two assessments in different years (2004 and 2011). In general, the progress that we were expecting was not satisfactory for both the international and national companies. The percentage of unmet criteria increased for "links" (from 48.0% to 52.0%) and for "mentioning the responsible person/firm for the Web site design" (from 40.6% to 59.4%) among national companies. We observed statistically significant progress only for the "information for the public" criterion (from 52.9% to 100%) among international companies. On the other hand, there was progress and a statistically significant difference in terms of not displaying any "drug ads" on the Web sites of national firms (from 55.9% to 87.5%), availability of "mail address" (from 88.2% to 100%), "telephone number" (from 88.2% to 100%), "indication of the target group" (from 23.5% to 52.1%), and "disclaimer stating the given information cannot replace a physician or pharmacist" (from 29.4% to 53.1%). Our major recommendation to pharmaceutical companies is to update their Web sites with evidence-based scientific information about themselves and their products using international and national standards. From the companies' perspective, this should be a priority responsibility based on the ethical aspect of individual and community health.

Poly[propane-1,3-diammonium [cuprate(II-bis(μ2-pyridine-2,3-dicarboxylato] trihydrate

Directory of Open Access Journals (Sweden)

Shabnam Hooshmand

2008-02-01

Full Text Available The title polymeric compound {(C3H12N2[Cu(C7H3NO42]·3H2O}n or {(pnH2[Cu(py-2,3-dc2]·3H2O}n (pn is propane-1,3-diamine and py-2,3-dcH2 is pyridine-2,3-dicarboxylic acid, was synthesized by reaction of copper(II chloride dihydrate with a proton-transfer compound, propane-1,3-diammonium pyridine-2,3-dicarboxylate or (pnH2(py-2,3-dc, in aqueous solution. The anion is a six-coordinate complex (site symmetry overline{1}, with a distorted octahedral geometry around CuII, consisting of two bidentate pyridine-2,3-dicarboxylate groups and two O atoms of bridging ligands from (py-2,3-dc2− fragments, which are located in trans positions. The (pnH22+ cation is disordered over two sites by the center of inversion. Intermolecular hydrogen bonds, π–π [centroid–centroid distances of 3.539 (3 Å] and C—O...π stacking interactions [O...Cg = 3.240 (5 Å; Cg is the center of the pyridine ring], connect the various components into a supramolecular structure.

Session II-A. Site characterization

International Nuclear Information System (INIS)

McIntosh, W.

1981-01-01

Section II-A on Site Characterization consists of the following papers which describe the progress made during the past fiscal year toward identifying sites for high-level radioactive waste repositories in deep geologic formations: (1) progress in expanded studies for repository sites; (2) evaluation of geologic and hydrologic characteristics in the Basin and Range Province relative to high-level nuclear waste disposal; (3) siting progress: Permian region; (4) Paradox Basin site exploration: a progress report; (5) progress toward recommending a salt site for an exploratory shaft; (6) status of geologic investigations for nuclear waste disposal at the Nevada Test Site; (7) geohydrologic investigation of the Hanford Site, Washington: basalt waste isolation project. Highlights include: expanding studies in crystalline rocks, both in the Appalachian and Lake Superior regions; laying the ground work with the states in the Basin and Range Province to kick off a joint USGS-state province study; narrowing areas of the Permian and Paradox bedded salt regions to a few promising locations; issuing a Gulf Coast Salt Dome Evaluation report (ONWI-109) for public review and comment; narrowing the Nevada Test Site area and Hanford Site area to locations for detailed site investigations and exploratory shafts; progress in developing the subseabed and space disposals alternatives

Corrective Action Investigation Plan for Corrective Action Unit 366: Area 11 Plutonium Valley Dispersion Sites, Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Patrick Matthews

2011-09-01

Corrective Action Unit 366 comprises the six corrective action sites (CASs) listed below: (1) 11-08-01, Contaminated Waste Dump No.1; (2) 11-08-02, Contaminated Waste Dump No.2; (3) 11-23-01, Radioactively Contaminated Area A; (4) 11-23-02, Radioactively Contaminated Area B; (5) 11-23-03, Radioactively Contaminated Area C; and (6) 11-23-04, Radioactively Contaminated Area D. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed July 6, 2011, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 366. The presence and nature of contamination at CAU 366 will be evaluated based on information collected from a field investigation. Radiological contamination will be evaluated based on a comparison of the total effective dose (TED) at sample locations to the dose-based final action level (FAL). The TED will be calculated by summing the estimates of internal and external dose. Results from the analysis of soil samples collected from sample plots will be used to calculate internal radiological dose. Thermoluminescent dosimeters placed at each sample location will be used to measure external radiological dose. Based on historical documentation of the releases

Cutting edge: A critical functional role for IL-23 in psoriasis.

Science.gov (United States)

Tonel, Giulia; Conrad, Curdin; Laggner, Ute; Di Meglio, Paola; Grys, Katarzyna; McClanahan, Terrill K; Blumenschein, Wendy M; Qin, Jian-Zhong; Xin, Hong; Oldham, Elizabeth; Kastelein, Robert; Nickoloff, Brian J; Nestle, Frank O

2010-11-15

Interleukin-23 is a key cytokine involved in the generation of Th17 effector cells. Clinical efficacy of an anti-p40 mAb blocking both IL-12 and IL-23 and disease association with single nucleotide polymorphisms in the IL23R gene raise the question of a functional role of IL-23 in psoriasis. In this study, we provide a comprehensive analysis of IL-23 and its receptor in psoriasis and demonstrate its functional importance in a disease-relevant model system. The expression of IL-23 and its receptor was increased in the tissues of patients with psoriasis. Injection of a mAb specifically neutralizing human IL-23 showed IL-23-dependent inhibition of psoriasis development comparable to the use of anti-TNF blockers in a clinically relevant xenotransplant mouse model of psoriasis. Together, our results identify a critical functional role for IL-23 in psoriasis and provide the rationale for new treatment strategies in chronic epithelial inflammatory disorders.

A study on development of monitoring and assessment module for sites

International Nuclear Information System (INIS)

Park, Se Moon; Yoon, Bong Yo; Kim, Dae Jung; Park, Joo Wan; Kim, Chang Lak

2006-01-01

As the development of total management systems for sites along with site environmental information is becoming standard, the system known as the Site Information and Total Environmental database management System (SITES) has been developed over the last two years. The first result was a database management system for storing data obtained from facilities, and a site characterization in addition to an environmental assessment of a site. The SITES database is designed to be effective and practical for use with facility management and safety assessment in relation to Geographic Information Systems. SITES is a total management program, which includes its database, its data analysis system required for site characterization, a safety assessment modeling system and an environment monitoring system. I can contribute to the institutional management of the facility and to its safety reassessment. SITES is composed of two main modules: the SITES Database Module (SDM) and the Monitoring and Assessment (M and A) module. The M and A module is subdivided into two sub-modules: the Safety Assessment System (SAS) and the Site Environmental Monitoring System (SEMS). SAS controls the data (input and output) from the SITES DB for the site safety assessment, whereas SEMS controls the data obtained from the records of the measuring sensors and facilities. The on-line site and environmental monitoring data is managed in SEMS. The present paper introduces the procedure and function of the M and A modules

[sup 99m]Tc-RBC subtraction scintigraphy; Assessmet of bleeding site and rate

Energy Technology Data Exchange (ETDEWEB)

Inagaki, Syoichi; Tonami, Syuichi; Yasui, Masakazu; Kuranishi, Makoto; Sugishita, Kouki; Nakamura, Mamoru (Toyama Medical and Pharmaceutical Univ. (Japan). Hospital)

1994-03-01

Sequential abdominal scintigrams with [sup 99m]Tc-labelled red blood cells (RBC) were subtracted for observing a site of gastrointestinal bleeding and calculating the bleeding rate. This method is technically very easy and can detect the site of bleeding with the minimum rate, as low as 0.2 ml/min., in a phantom experiment. In 23 cases with final diagnosis of gastrointestinal bleeding, conventional non-subtraction scintigraphy detected only 30% (7/23), but subtraction scintigraphy detected 61% (14/23). It was concluded that subtraction scintigraphy had higher sensitivity than conventional scintigraphy for early diagnosing bleeding. A combination of non-subtraction and subtraction scintigraphy is recommended to detect a site of gastrointestinal bleeding in a clinical setting. (author).

Site attraction as a representation of heritage tourism: Case study of Gunung Padang Site, Cianjur, West - Java

Science.gov (United States)

Subakti, A. G.; Pratomo, Aditya; Triana, Ika; Khrisnanto, Iwan

2018-03-01

Heritage Tourism is used for experiencing the heritage of city, region, state or country. This travel enables the tourist to learn about local customs, traditions, history and culture. One of the tourist attractions in Cianjur, where an ancient historical megalithic site named Situs Gunung Padang could be found. Situs Gunung Padang which consists of five terraces and five levels, completely built stones. This site is the largest megalithic site in Southeast Asia. There is an enormous tourism potential owned by this site because it expresses and preserving ancient Sundanese cultural in the megalithic era. But the potential of this site seems haven’t made as a tourist attraction compared with Borobudur or Prambanan Temple. The purpose of this research is to analyze the existence of Gunung Padang site as a heritage tourism with SWOT approach to discover what factors need to be repaired. The result of this research is showing that Gunung Padang site has a huge potential if the regional governments and the locals can contribute to preserve and making this site as a tourist attraction.

Site Study Plan for land use, Deaf Smith County site, Texas: Environmental Field Program: Preliminary draft

International Nuclear Information System (INIS)

1987-06-01

The Land Use Site Study Plan describes a field program consisting of characterization of the site; seismic survey rights-of-way and transportation and utility corridors, the vicinity, the region, future land use, and monitoring land-use change. Aerial photography will be used to characterize the site, seismic rows and transportation and utility corridors, and the vicinity. The resulting land-use maps and overlays will then be verified in the field. Interviews with farm managers and local experts will provide additional information. A Geographic Information System (GIS) and satellite imagery will be used to characterize the region, monitor land-use change, and provide information to assist with the future land use study. The site study plan describes the study design and rationale, the filed data collection procedures and equipment, the data analysis methods and application of results, the data management strategy, the schedule of field activities, the personnel requirements and management of the study, and the study's quality assurance program. The directives and requirements that drive these studies are derived from the Salt Repository Project Requirements Document. 51 refs; 6 figs; 3 tabs

Danish method study on cervical screening in women offered HPV vaccination as girls (Trial23): a study protocol.

Science.gov (United States)

Thamsborg, Lise Holst; Andersen, Berit; Larsen, Lise Grupe; Christensen, Jette; Johansen, Tonje; Hariri, Jalil; Christiansen, Sanne; Rygaard, Carsten; Lynge, Elsebeth

2018-05-26

The first birth cohorts of women offered human papillomavirus (HPV) vaccination as girls are now entering cervical screening. However, there is no international consensus on how to screen HPV vaccinated women. These women are better protected against cervical cancer and could therefore be offered less intensive screening. Primary HPV testing is more sensitive than cytology, allowing for a longer screening interval. The aim of Trial23 is to investigate if primary HPV testing with cytology triage of HPV positive samples is a reasonable screening scheme for women offered HPV vaccination as girls. Trial23 is a method study embedded in the existing cervical screening programme in four out of five Danish regions. Without affecting the screening programme, women born in 1994 are randomised to present screening with liquid-based cytology every third year (present programme arm) or present screening plus an HPV test (HPV arm). The study started 1 February 2017 and will run over three screening rounds corresponding to 7-8 years. The primary endpoint is cervical intraepithelial neoplasia grade 3 or above. The trial is undertaken as a non-inferiority study including intention-to-treat and per-protocol analyses. The potential effect of primary HPV screening with a 6-year interval will be calculated from the observed data. The study protocol has been submitted to the ethical committee and deemed a method study. All women are screened according to routine guidelines. The study will contribute new evidence on the future screening of HPV vaccinated birth cohorts of women. All results will be published in open-access journal. NCT03049553; Pre-results. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

Establishing a reference rock site for the site effect study in and around the Kathmandu valley, Nepal

Science.gov (United States)

Bhattarai, Mukunda; Adhikari, Lok Bijaya; Gautam, Umesh Prasad; Bollinger, Laurent; Hernandez, Bruno; Yokoi, Toshiaki; Hayashida, Takumi

2016-05-01

We propose a reference site for the site effect study in and around the Kathmandu valley, Nepal. The used data were the accelerograms recorded at two stations, DMG and KKA, and velocity seismograms co-recorded at the PKIN station during nine shallow local and regional earthquakes of local magnitude equal to or greater than 5.0. The DMG station is located on the thick sediments of the Kathmandu valley, whereas the others are rock sites. The KKA station is located on the granite and gneisses of the Shivapuri Lekh about 10 km northwest of the capital, and the PKIN station is in the tunnel of an old iron mine on the southern slope of the Phulchauki Hill about 15 km southeast. The spectral ratios of the ground motion records of the DMG station compared to those of the PKIN station, for all considered earthquakes, confirm that the DMG station has amplification ranging from 1 to 10 in the frequency range of 0.5-10 Hz, and spectral ratios of the KKA station referenced by the PKIN station show that the KKA station has significant amplification in the frequency range of 4-10 Hz and the peak value of the spectral ratio is at most over 25. Therefore, the site amplification in and around Kathmandu valley would be significantly underestimated in the frequency range from 4 to 10 Hz if the records of the KKA station were used as a proxy for input seismic motions to the sediment. Based on the above analysis, we propose that the PKIN station should be considered as a reliable reference site for the assessment of seismic hazards in and around the Kathmandu valley.

A study in usability: redesigning a health sciences library's mobile site.

Science.gov (United States)

Rosario, Jovy-Anne; Ascher, Marie T; Cunningham, Diana J

2012-01-01

A mobile site redesign was conducted at a medium-sized academic health sciences library with the goal of creating a site that meets the mobile information needs of its users. The redesign phases included (1) needs assessment, (2) usability testing, and (3) site design. The survey results showed that Apple devices were the most prevalent; the most desirable activities performed on a mobile site were searching for articles, accessing full-text articles and e-books, searching databases, and searching the catalog. These activities guided the development of the usability testing tasks and the redesign. All phases were completed within six months, and the total project cost was $50 for incentive purchases. Copyright © Taylor & Francis Group, LLC

Studies for site preparation for ITER construction

International Nuclear Information System (INIS)

Fardeau, A.; Blanc, F.; Cardettini, J.D.; Mandine, J.R.; Guerin, R.; Patisson, L.; Bergegere, P.; Santagiustina, A.; Garin, P.

2004-01-01

The implantation of a nuclear facility such as ITER (about 20 buildings on 40 ha) requires many preparatory studies, particularly with respect to: Underground characteristics; Topography, layout; Deforestation, excavations; Networks, fences and roads; Impact of seismic hazard on design. This paper presents the main results of these studies, carried out within the European ITER Site Studies framework. A dedicated paper in the conference deals with the transport studies. To choose the site for ITER implantation, detailed geological, hydrogeological and geophysical investigations have been carried out. Taking into account the meteorological data (particularly the main wind direction), topography, access, electrical supply, fluids needs and constraints (gravity systems), buildings and roads have been implemented. (authors)

Background complementary hydrogeochemical studies. SDM-Site Forsmark

Energy Technology Data Exchange (ETDEWEB)

Kalinowski, Birgitta E. (ed.)

2008-08-15

in geochemistry, hydrochemistry, hydrogeochemistry, microbiology, geomicrobiology, analytical chemistry etc. The resulting site descriptive model version, mainly based on 2.2 data and complementary 2.3 data, was carried out during September 2006 to December 2007. Several groups within ChemNet were involved and the evaluation was conducted independently using different approaches ranging from expert knowledge to geochemical and mathematical modelling including transport modelling. During regular ChemNet meetings the results have been presented and discussed. This report is a compilation of different projects that have been finished independently of each other. Section 1: M3 modelling and 2D visualisation of the hydrochemical parameters by Ioana Gurban. The focus of this part is on updating the hydrochemical model, to make uncertainty tests and to present the final models that can be integrated better with the hydrodynamic models. M3 modelling helps to summarise and understand the measured data, by using the major elements and the isotopes delta18O and delta2H as variables. The visualisation of the mixing proportions along the boreholes helps to understand the distribution of the data in the domain and to check and compare the results of different models; and therefore to choose the model which best describes the measured data. Section 2: Coupled hydrogeological and solute transport, visualisation and supportive detailed reaction modelling by Jorge Molinero, David Arcos, Lara Duro. Reactive mixing and reactive solute transport models are used as quantitative tools in order to evaluate how much disturbance can be allowed for a given groundwater sample at repository depth and still meet the SKB suitability criteria. Spatial analysis and 3D visualisation of available representative samples in Forsmark was performed. The computed M3 mixing fractions show a spatial distribution qualitatively correlated with key hydrochemical signatures, such as strontium (for Deep Saline

Site Specific Ground Response Analysis for Quantifying Site Amplification at A Regolith Site

Directory of Open Access Journals (Sweden)

Bambang Setiawan

2017-08-01

Full Text Available DOI: 10.17014/ijog.4.3.159-167A numerical model has demonstrated that it can simulate reasonably well earthquake motions at the ground level during a seismic event. The most widely used model is an equivalent linear approach. The equivalent linear model was used to compute the free-field response of Adelaide regolith during the 1997 Burra earthquake. The aim of this study is to quantify the amplification at the investigated site. The model computed the ground response of horizontally layered soil deposits subjected to transient and vertically propagating shear waves through a one-dimensional-soil column. Each soil layer was assumed to be homogeneous, visco-elastic, and infinite in the horizontal extent. The results of this study were compared to other studies and forward computation of the geotechnical dynamic parameters of the investigated site. The amplification triggered by the 1997 Burra seismic event was deduced. This study reveals the amplification factor up to 3.6 at the studied site.

Social implications of knowing Yahweh: A study of Jeremiah 9:22�23

OpenAIRE

Wilhelm J. Wessels

2009-01-01

In the brief passage of Jeremiah 9:22�23, wisdom, might and riches are explicitly rejected as reasons for boasting. The only true reason for boasting is if a person �knows Yahweh�. In verse 23, this is linked with three other concepts: steadfast love, justice and righteousness. Jeremiah described the society of his day as corrupt in every sense of the word. People were stubborn, refused to acknowledge Yahweh and showed no signs of truly knowing him. They had, in fact, deserted the Torah of Ya...

Crystallization and preliminary X-ray diffraction studies of the ubiquitin-like (UbL) domain of the human homologue A of Rad23 (hHR23A) protein.

Science.gov (United States)

Chen, Yu Wai; Tajima, Toshitaka; Rees, Martin; Garcia-Maya, Mitla

2009-09-01

Human homologue A of Rad23 (hHR23A) plays dual roles in DNA repair as well as serving as a shuttle vehicle targeting polyubiquitinated proteins for degradation. Its N-terminal ubiquitin-like (UbL) domain interacts with the 19S proteasomal cap and provides the docking mechanism for protein delivery. Pyramidal crystals of the UbL domain of hHR23A were obtained by the hanging-drop vapour-diffusion method with ammonium sulfate as the crystallizing agent. The crystals diffracted to beyond 2 A resolution and belonged to the hexagonal space group P6(5)22, with unit-cell parameters a = b = 78.48, c = 63.57 A. The structure was solved by molecular replacement using the UbL domain of yeast Dsk2 as the search model.

Mapping Suitable Sites for Setting up Wind Farms: A Case Study of ...

African Journals Online (AJOL)

Mapping Suitable Sites for Setting up Wind Farms: A Case Study of Nyanga District. ... Ethiopian Journal of Environmental Studies and Management ... sources and continuous power shortages make wind energy a very attractive alternative to ...

The Wood and Bark of Hardwoods Growing on Southern Pine Sites - A Pictorial Atlas

Science.gov (United States)

Charles W. McMillin; Floyd G. Manwiller

1980-01-01

Provides a pictorial description of the structure and appearance of 23 pine-site hardwoods, an overview of hardwood anatomy, and data on the resource and certain important physical properties of stemwood and bark.

Corrective Action Investigation Plan for Corrective Action Unit 105: Area 2 Yucca Flat Atmospheric Test Sites Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Patrick Matthews

2012-09-01

Corrective Action Unit (CAU) 105 is located in Area 2 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 105 is a geographical grouping of sites where there has been a suspected release of contamination associated with atmospheric nuclear testing. This document describes the planned investigation of CAU 105, which comprises the following corrective action sites (CASs): • 02-23-04, Atmospheric Test Site - Whitney • 02-23-05, Atmospheric Test Site T-2A • 02-23-06, Atmospheric Test Site T-2B • 02-23-08, Atmospheric Test Site T-2 • 02-23-09, Atmospheric Test Site - Turk These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on April 30, 2012, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 105. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The potential contamination sources associated with all CAU 105 CASs are from atmospheric nuclear testing activities. The presence and nature of contamination at CAU

{sup 23}Na nuclear magnetic resonance study of the structure and dynamic of natrolite

Energy Technology Data Exchange (ETDEWEB)

Paczwa, Mateusz; Olszewski, Marcin; Sergeev, Nikolaj [Szczecin Univ. (Poland). Inst. of Physics; Sapiga, Aleksej A.; Sapiga, Aleksej V. [Taurida National V.I. Vernadsky Univ., Simferopol, Crimea (Ukraine)

2015-07-01

The temperature dependences of nuclear magnetic resonance (NMR) and magic angle spinning (MAS) NMR spectra of {sup 23}Na nuclei in natrolite (Na{sub 2}Al{sub 2}Si{sub 3}O{sub 10} . 2H{sub 2}O) have been studied. The temperature dependences of the spin-lattice relaxation times T{sub 1} in natrolite have also been studied. It has been shown that the spin-lattice relaxation of the {sup 23}Na is governed by the electric quadrupole interaction with the crystal electric field gradients modulated by translational motion of H{sub 2}O molecules in the natrolite pores. The dipolar interactions with paramagnetic impurities become significant as a relaxation mechanism of the {sup 23}Na nuclei only at low temperature (<270 K).

CDH23 mutation and phenotype heterogeneity: a profile of 107 diverse families with Usher syndrome and nonsyndromic deafness.

Science.gov (United States)

Astuto, L M; Bork, J M; Weston, M D; Askew, J W; Fields, R R; Orten, D J; Ohliger, S J; Riazuddin, S; Morell, R J; Khan, S; Riazuddin, S; Kremer, H; van Hauwe, P; Moller, C G; Cremers, C W R J; Ayuso, C; Heckenlively, J R; Rohrschneider, K; Spandau, U; Greenberg, J; Ramesar, R; Reardon, W; Bitoun, P; Millan, J; Legge, R; Friedman, T B; Kimberling, W J

2002-08-01

Usher syndrome type I is characterized by congenital hearing loss, retinitis pigmentosa (RP), and variable vestibular areflexia. Usher syndrome type ID, one of seven Usher syndrome type I genetic localizations, have been mapped to a chromosomal interval that overlaps with a nonsyndromic-deafness localization, DFNB12. Mutations in CDH23, a gene that encodes a putative cell-adhesion protein with multiple cadherin-like domains, are responsible for both Usher syndrome and DFNB12 nonsyndromic deafness. Specific CDH23 mutational defects have been identified that differentiate these two phenotypes. Only missense mutations of CDH23 have been observed in families with nonsyndromic deafness, whereas nonsense, frameshift, splice-site, and missense mutations have been identified in families with Usher syndrome. In the present study, a panel of 69 probands with Usher syndrome and 38 probands with recessive nonsyndromic deafness were screened for the presence of mutations in the entire coding region of CDH23, by heteroduplex, single-strand conformation polymorphism, and direct sequence analyses. A total of 36 different CDH23 mutations were detected in 45 families; 33 of these mutations were novel, including 18 missense, 3 nonsense, 5 splicing defects, 5 microdeletions, and 2 insertions. A total of seven mutations were common to more than one family. Numerous exonic and intronic polymorphisms also were detected. Results of ophthalmologic examinations of the patients with nonsyndromic deafness have found asymptomatic RP-like manifestations, indicating that missense mutations may have a subtle effect in the retina. Furthermore, patients with mutations in CDH23 display a wide range of hearing loss and RP phenotypes, differing in severity, age at onset, type, and the presence or absence of vestibular areflexia.

CDH23 Mutation and Phenotype Heterogeneity: A Profile of 107 Diverse Families with Usher Syndrome and Nonsyndromic Deafness

Science.gov (United States)

Astuto, L. M.; Bork, J. M.; Weston, M. D.; Askew, J. W.; Fields, R. R.; Orten, D. J.; Ohliger, S. J.; Riazuddin, S.; Morell, R. J.; Khan, S.; Riazuddin, S.; Kremer, H.; van Hauwe, P.; Moller, C. G.; Cremers, C. W. R. J.; Ayuso, C.; Heckenlively, J. R.; Rohrschneider, K.; Spandau, U.; Greenberg, J.; Ramesar, R.; Reardon, W.; Bitoun, P.; Millan, J.; Legge, R.; Friedman, T. B.; Kimberling, W. J.

2002-01-01

Usher syndrome type I is characterized by congenital hearing loss, retinitis pigmentosa (RP), and variable vestibular areflexia. Usher syndrome type ID, one of seven Usher syndrome type I genetic localizations, have been mapped to a chromosomal interval that overlaps with a nonsyndromic-deafness localization, DFNB12. Mutations in CDH23, a gene that encodes a putative cell-adhesion protein with multiple cadherin-like domains, are responsible for both Usher syndrome and DFNB12 nonsyndromic deafness. Specific CDH23 mutational defects have been identified that differentiate these two phenotypes. Only missense mutations of CDH23 have been observed in families with nonsyndromic deafness, whereas nonsense, frameshift, splice-site, and missense mutations have been identified in families with Usher syndrome. In the present study, a panel of 69 probands with Usher syndrome and 38 probands with recessive nonsyndromic deafness were screened for the presence of mutations in the entire coding region of CDH23, by heteroduplex, single-strand conformation polymorphism, and direct sequence analyses. A total of 36 different CDH23 mutations were detected in 45 families; 33 of these mutations were novel, including 18 missense, 3 nonsense, 5 splicing defects, 5 microdeletions, and 2 insertions. A total of seven mutations were common to more than one family. Numerous exonic and intronic polymorphisms also were detected. Results of ophthalmologic examinations of the patients with nonsyndromic deafness have found asymptomatic RP–like manifestations, indicating that missense mutations may have a subtle effect in the retina. Furthermore, patients with mutations in CDH23 display a wide range of hearing loss and RP phenotypes, differing in severity, age at onset, type, and the presence or absence of vestibular areflexia. PMID:12075507

Corrective Action Decision Document/Closure Report for Corrective Action Unit 504: 16a-Tunnel Muckpile, Nevada Test Site

Energy Technology Data Exchange (ETDEWEB)

NSTec Environmental Restoration

2010-03-15

This Corrective Action Decision Document (CADD)/Closure Report (CR) was prepared by the Defense Threat Reduction Agency (DTRA) for Corrective Action Unit (CAU) 504, 16a-Tunnel Muckpile. This CADD/CR is consistent with the requirements of the Federal Facility Agreement and Consent Order (FFACO) agreed to by the State of Nevada; U.S. Department of Energy (DOE), Environmental Management; U.S. Department of Defense; and DOE, Legacy Management. Corrective Action Unit 504 is comprised of four Corrective Action Sites (CASs): • 16-06-01, Muckpile • 16-23-01, Contaminated Burial Pit • 16-23-02, Contaminated Area • 16-99-01, Concrete Construction Waste Corrective Action Site 16-23-01 is not a burial pit; it is part of CAS 16-06-01. Therefore, there is not a separate data analysis and assessment for CAS 16-23-01; it is included as part of the assessment for CAS 16-06-01. In addition to these CASs, the channel between CAS 16-23-02 (Contaminated Area) and Mid Valley Road was investigated with walk-over radiological surveys and soil sampling using hand tools. The purpose of this CADD/CR is to provide justification and documentation supporting the recommendation for closure in place with use restrictions for CAU 504. A CADD was originally submitted for CAU 504 and approved by the Nevada Division of Environmental Protection (NDEP). However, following an agreement between NDEP, DTRA, and the DOE, National Nuclear Security Administration Nevada Site Office to change to a risk-based approach for assessing the corrective action investigation (CAI) data, NDEP agreed that the CAU could be re-evaluated using the risk-based approach and a CADD/CR prepared to close the site.

Web vulnerability study of online pharmacy sites.

Science.gov (United States)

Kuzma, Joanne

2011-01-01

Consumers are increasingly using online pharmacies, but these sites may not provide an adequate level of security with the consumers' personal data. There is a gap in this research addressing the problems of security vulnerabilities in this industry. The objective is to identify the level of web application security vulnerabilities in online pharmacies and the common types of flaws, thus expanding on prior studies. Technical, managerial and legal recommendations on how to mitigate security issues are presented. The proposed four-step method first consists of choosing an online testing tool. The next steps involve choosing a list of 60 online pharmacy sites to test, and then running the software analysis to compile a list of flaws. Finally, an in-depth analysis is performed on the types of web application vulnerabilities. The majority of sites had serious vulnerabilities, with the majority of flaws being cross-site scripting or old versions of software that have not been updated. A method is proposed for the securing of web pharmacy sites, using a multi-phased approach of technical and managerial techniques together with a thorough understanding of national legal requirements for securing systems.

WHAMM links actin assembly via the Arp2/3 complex to autophagy.

Science.gov (United States)

Kast, David J; Dominguez, Roberto

2015-01-01

Macroautophagy (hereafter autophagy) is the process by which cytosolic material destined for degradation is enclosed inside a double-membrane cisterna known as the autophagosome and processed for secretion and/or recycling. This process requires a large collection of proteins that converge on certain sites of the ER membrane to generate the autophagosome membrane. Recently, it was shown that actin accumulates around autophagosome precursors and could play a role in this process, but the mechanism and role of actin polymerization in autophagy were unknown. Here, we discuss our recent finding that the nucleation-promoting factor (NPF) WHAMM recruits and activates the Arp2/3 complex for actin assembly at sites of autophagosome formation on the ER. Using high-resolution, live-cell imaging, we showed that WHAMM forms dynamic puncta on the ER that comigrate with several autophagy markers, and propels the spiral movement of these puncta by an Arp2/3 complex-dependent actin comet tail mechanism. In starved cells, WHAMM accumulates at the interface between neighboring autophagosomes, whose number and size increases with WHAMM expression. Conversely, knocking down WHAMM, inhibiting the Arp2/3 complex or interfering with actin polymerization reduces the size and number of autophagosomes. These findings establish a link between Arp2/3 complex-mediated actin assembly and autophagy.

Salmon Site Remediation Investigation Report, Appendix A

International Nuclear Information System (INIS)

1999-01-01

installation of a water supply system that will provide potable water to the site and residence in the proximity to the site; (2) continued maintenance of surface institutional controls and subsurface restrictions; and (3) continue to implement the long-term hydrologic monitoring program. The Salmon Site will be relinquished the State of Mississippi as mandated by Public Law 104-201-September 23, 1996, to be used as a demonstration forest/wildlife refuge. Should the land use change in the future and/or monitoring information indicates a change in the site conditions, the DOE will reassess the risk impacts to human health and the environment

Role of grass-legume communities in revegetation of a subalpine mine site in British Columbia

Energy Technology Data Exchange (ETDEWEB)

Yamanaka, K

1982-01-01

This study describes an investigation of the potential for pioneer grass-legume communities to stabilize and ameliorate geologically-fresh soil leading to the establishment of a self-sustaining, progressive plant succession on a surface-mined subalpine site. The study area is located 2000 m above sea level in the Canadian Rocky Mountains. Field studies revealed chronological trends in grass-legume communities at four sites revegetated during 1974-1978 including: species composition, legumes (Trifolium repens L., T. hybridum L. and Medicago sativa L.) performing increasingly poorly on the older sites; biomass changes, a shoot to root ratio (S/R) decreasing from 2.3 to 0.2 as the communities aged; and litter accumulation which continued even on the oldest site. Fertilizer (13-16-10) operationally applied at 150-391 kg/ha enhanced the growth of Dactylis gomerata L. and litter degradation, and acidified the soil. Nitrogen fertilization was also associated with two clear inverse relationships identified between D. glomerata and Festuca rubra L. biomass, and between soil pH and phosphorus levels. In greenhouse tests grasses were revealed to be more efficient soil nitrogen consumers than were legumes and nitrogen fixation decreased significantly (P < 0.01) and linearly with increasing grass seeding rates.

Site study plan for regional hydrologic sampling and monitoring: Preliminary draft

International Nuclear Information System (INIS)

Dutton, A.R.

1987-01-01

The purpose of the Regional Hydrologic Studies Plan is to describe those field activities required for completion of the objectives of hydrologic activities. Many of these activities are regional in scope and are designed to provide a framework for understanding the hydrologic setting of the site and the hydrologic processes that influence site characteristics. Site Study Plans (SSPs) define activates at and in the immediate vicinity of the site. The activities specified in the Regional Hydrologic Studies Plan are performed beyond the confines of the site because the hydrologic systems extend beyond the site boundaries, because pertinent data that bear on site suitability are available outside of the site, and because natural analogues exist outside of the site that allow analysis of processes that are expected to operate within the site. 15 refs., 5 figs., 1 tab

Single crystal magnetic, dielectric and thermal studies of the relaxor ferroelectric Pb(Fe2/3W1/3)O3

International Nuclear Information System (INIS)

Ye, Z.G.; Sato, M.; Kita, E.; Bursill, L.A.; Schmid, H.

1998-01-01

The magnetic, dielectric and thermal properties of the complex perovskite Pb(Fe 2/3 W 1/3 )O 3 [PFW] have been studied on single crystals by means of a SQUID magnetometer, dielectric measurements and thermal analysis. Anomalies in the temperature dependence of the magnetization have revealed magnetic phase transitions at T N1 =350 K and T N2 =20 K. These two steps of antiferromagnetic ordering are attributed to the microstructural feature of the complex perovskite, characterized by ordered and disordered arrangements on the B-site, giving rise to a strong superexchange interaction of - Fe 3 + - O - Fe 3+ - type with a higher ordering temperature, and to a weak superexchange interaction of the B-site ordered elpasolite type - Fe 3+ + - O - W - O - Fe 3+ - with a lower Neel temperature. The low temperature antiferromagnetic phase exhibits a weak ferromagnetism. The dielectric properties of PFW show a relaxor ferroelectric behaviour with a dispersive maximum of permittivity at Tm (170 -190 K). The magnetic phase transition at T N2 =20 K results in anomalies both of the real part of permittivity and the dissipation factor, suggesting a magneto-electric coupling via magneto-structural interactions

Closure Report for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

NSTec Environmental Restoration

2009-07-31

Corrective Action Unit (CAU) 139 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Waste Disposal Sites' and consists of the following seven Corrective Action Sites (CASs), located in Areas 3, 4, 6, and 9 of the Nevada Test Site: CAS 03-35-01, Burn Pit; CAS 04-08-02, Waste Disposal Site; CAS 04-99-01, Contaminated Surface Debris; CAS 06-19-02, Waste Disposal Site/Burn Pit; CAS 06-19-03, Waste Disposal Trenches; CAS 09-23-01, Area 9 Gravel Gertie; and CAS 09-34-01, Underground Detection Station. Closure activities were conducted from December 2008 to April 2009 according to the FFACO (1996, as amended February 2008) and the Corrective Action Plan for CAU 139 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2007b). The corrective action alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. Closure activities are summarized. CAU 139, 'Waste Disposal Sites,' consists of seven CASs in Areas 3, 4, 6, and 9 of the NTS. The closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. This CR provides a summary of completed closure activities, documentation of waste disposal, and confirmation that remediation goals were met. The following site closure activities were performed at CAU 139 as documented in this CR: (1) At CAS 03-35-01, Burn Pit, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (2) At CAS 04-08-02, Waste Disposal Site, an administrative UR was implemented. No postings or post-closure monitoring are required. (3) At CAS 04-99-01, Contaminated Surface Debris, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (4) At CAS 06-19-02, Waste Disposal Site/Burn Pit, no work was performed. (5) At CAS 06-19-03, Waste Disposal Trenches, a native soil cover was installed

Closure Report for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

2009-01-01

Corrective Action Unit (CAU) 139 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Waste Disposal Sites' and consists of the following seven Corrective Action Sites (CASs), located in Areas 3, 4, 6, and 9 of the Nevada Test Site: CAS 03-35-01, Burn Pit; CAS 04-08-02, Waste Disposal Site; CAS 04-99-01, Contaminated Surface Debris; CAS 06-19-02, Waste Disposal Site/Burn Pit; CAS 06-19-03, Waste Disposal Trenches; CAS 09-23-01, Area 9 Gravel Gertie; and CAS 09-34-01, Underground Detection Station. Closure activities were conducted from December 2008 to April 2009 according to the FFACO (1996, as amended February 2008) and the Corrective Action Plan for CAU 139 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2007b). The corrective action alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. Closure activities are summarized. CAU 139, 'Waste Disposal Sites,' consists of seven CASs in Areas 3, 4, 6, and 9 of the NTS. The closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. This CR provides a summary of completed closure activities, documentation of waste disposal, and confirmation that remediation goals were met. The following site closure activities were performed at CAU 139 as documented in this CR: (1) At CAS 03-35-01, Burn Pit, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (2) At CAS 04-08-02, Waste Disposal Site, an administrative UR was implemented. No postings or post-closure monitoring are required. (3) At CAS 04-99-01, Contaminated Surface Debris, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (4) At CAS 06-19-02, Waste Disposal Site/Burn Pit, no work was performed. (5) At CAS 06-19-03, Waste Disposal Trenches, a native soil cover was installed, and a UR was

Renewable energy potential on brownfield sites: A case study of Michigan

International Nuclear Information System (INIS)

Adelaja, Soji; Shaw, Judy; Beyea, Wayne; Charles McKeown, J.D.

2010-01-01

Federal priorities are increasingly favoring the replacement of conventional sources of energy with renewable energy. With the potential for a federal Renewable Electricity Standard (RES) legislation, many states are seeking to intensify their renewable energy generation. The demand for wind, solar, geothermal and bio-fuels-based energy is likely to be rapidly expressed on the landscape. However, local zoning and NIMBYism constraints slow down the placement of renewable energy projects. One area where land constraints may be lower is brownfields; whose development is currently constrained by diminished housing, commercial, and industrial property demand. Brownfield sites have the potential for rapid renewable energy deployment if state and national interests in this area materialize. This study investigates the application of renewable energy production on brownfield sites using Michigan as a case study. Wind and solar resource maps of Michigan were overlaid with the brownfield locations based on estimates of brownfield land capacity. The total estimated energy potential available on Michigan's brownfield sites is 4320 megawatts (MW) of plate capacity for wind and 1535for solar, equating to 43% of Michigan's residential electricity consumption (using 30% capacity factor). Estimated economic impacts include over $15 billion in investments and 17,500 in construction and long-term jobs.

23 CFR 450.318 - Transportation planning studies and project development.

Science.gov (United States)

2010-04-01

... on the human and natural environment, or mitigation of these impacts; and (2) The systems-level... study into the draft Environmental Impact Statement (EIS) or Environmental Assessment, or other means... Environmental Policy Act (NEPA) of 1969 (42 U.S.C. 4321 et seq.) and associated implementing regulations (23 CFR...

CD/MCD/VTVH-MCD Studies of Escherichia coli Bacterioferritin Support a Binuclear Iron Cofactor Site.

Science.gov (United States)

Kwak, Yeonju; Schwartz, Jennifer K; Huang, Victor W; Boice, Emily; Kurtz, Donald M; Solomon, Edward I

2015-12-01

Ferritins and bacterioferritins (Bfrs) utilize a binuclear non-heme iron binding site to catalyze oxidation of Fe(II), leading to formation of an iron mineral core within a protein shell. Unlike ferritins, in which the diiron site binds Fe(II) as a substrate, which then autoxidizes and migrates to the mineral core, the diiron site in Bfr has a 2-His/4-carboxylate ligand set that is commonly found in diiron cofactor enzymes. Bfrs could, therefore, utilize the diiron site as a cofactor rather than for substrate iron binding. In this study, we applied circular dichroism (CD), magnetic CD (MCD), and variable-temperature, variable-field MCD (VTVH-MCD) spectroscopies to define the geometric and electronic structures of the biferrous active site in Escherichia coli Bfr. For these studies, we used an engineered M52L variant, which is known to eliminate binding of a heme cofactor but to have very minor effects on either iron oxidation or mineral core formation. We also examined an H46A/D50A/M52L Bfr variant, which additionally disrupts a previously observed mononuclear non-heme iron binding site inside the protein shell. The spectral analyses define a binuclear and an additional mononuclear ferrous site. The biferrous site shows two different five-coordinate centers. After O2 oxidation and re-reduction, only the mononuclear ferrous signal is eliminated. The retention of the biferrous but not the mononuclear ferrous site upon O2 cycling supports a mechanism in which the binuclear site acts as a cofactor for the O2 reaction, while the mononuclear site binds the substrate Fe(II) that, after its oxidation to Fe(III), migrates to the mineral core.

Ablation of the Galnt3 gene leads to low-circulating intact fibroblast growth factor 23 (Fgf23) concentrations and hyperphosphatemia despite increased Fgf23 expression.

Science.gov (United States)

Ichikawa, Shoji; Sorenson, Andrea H; Austin, Anthony M; Mackenzie, Donald S; Fritz, Timothy A; Moh, Akira; Hui, Siu L; Econs, Michael J

2009-06-01

Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia. The disease is caused by inactivating mutations in fibroblast growth factor 23 (FGF23), Klotho (KL), and uridine diphosphate-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). In vitro studies indicate that GALNT3 O-glycosylates a phosphaturic hormone, FGF23, and prevents its proteolytic processing, thereby allowing secretion of intact FGF23. In this study we generated mice lacking the Galnt3 gene, which developed hyperphosphatemia without apparent calcifications. In response to hyperphosphatemia, Galnt3-deficient mice had markedly increased Fgf23 expression in bone. However, compared with wild-type and heterozygous littermates, homozygous mice had only about half of circulating intact Fgf23 levels and higher levels of C-terminal Fgf23 fragments in bone. Galnt3-deficient mice also exhibited an inappropriately normal 1,25-dihydroxyvitamin D level and decreased alkaline phosphatase activity. Furthermore, renal expression of sodium-phosphate cotransporters and Kl were elevated in Galnt3-deficient mice. Interestingly, there were sex-specific phenotypes; only Galnt3-deficient males showed growth retardation, infertility, and significantly increased bone mineral density. In summary, ablation of Galnt3 impaired secretion of intact Fgf23, leading to decreased circulating Fgf23 and hyperphosphatemia, despite increased Fgf23 expression. Our findings indicate that Galnt3-deficient mice have a biochemical phenotype of tumoral calcinosis and provide in vivo evidence that Galnt3 plays an essential role in proper secretion of Fgf23 in mice.

Corrective Action Investigation Plan for Corrective Action Unit 573: Alpha Contaminated Sites, Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Matthews, Patrick

2014-05-01

Corrective Action Unit (CAU) 573 is located in Area 5 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 573 is a grouping of sites where there has been a suspected release of contamination associated with non-nuclear experiments and nuclear testing. This document describes the planned investigation of CAU 573, which comprises the following corrective action sites (CASs): • 05-23-02, GMX Alpha Contaminated Area • 05-45-01, Atmospheric Test Site - Hamilton These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives.

Topoisomerase I tyrosine phosphorylation site and the DNA-interactive site

International Nuclear Information System (INIS)

Roll, D.; Durban, E.

1986-01-01

Phosphorylation of topoisomerase I (topo I) at serine by NII kinase is accompanied by stimulation of enzymatic activity. In contrast, phosphorylation at tyrosine by tyrosine kinase seems to inhibit enzymatic activity. This inhibition may be caused by interference of the phosphorylated tyrosine residue with the interaction of topo I with DNA. To test this, topo I was labeled with crude membrane fraction enriched for EGF-receptor kinase in presence of γ-P32-ATP and electrophoresed on SDS-polyacrylamide gels. Stained topo I bands were excised, dried, digested with trypsin and analyzed on a C18 reverse-phase HPLC column. One major peak of radioactivity eluted at fraction 23 with 20% acetonitrile. To obtain the DNA-interactive site, topo I was incubated with pBR322 DNA labeled by nick-translation followed by DNase I treatment, and electrophoresis on SDS-polyacrylamide gels. Tryptic peptides were generated and analyzed by reverse-phase HPLC. A major peak of radioactivity eluted at fraction 16-18 with 15.5-17% acetonitrile. Studies are in progress to resolve whether (a) the two peptides are different, i.e. the tyrosine-P site and DNA-tyrosine interactive site are localized at different regions of the topo I or (b) the peptide sequences are identical but the covalent attachment of deoxynucleotides altered the peptide's elution from the HPLC column

Experimental Analysis of Temperature Differences During Implant Site Preparation: Continuous Drilling Technique Versus Intermittent Drilling Technique.

Science.gov (United States)

Di Fiore, Adolfo; Sivolella, Stefano; Stocco, Elena; Favero, Vittorio; Stellini, Edoardo

2018-02-01

Implant site preparation through drilling procedures may cause bone thermonecrosis. The aim of this in vitro study was to evaluate, using a thermal probe, overheating at implant sites during osteotomies through 2 different drilling methods (continuous drilling technique versus intermittent drilling technique) using irrigation at different temperatures. Five implant sites 13 mm in length were performed on 16 blocks (fresh bovine ribs), for a total of 80 implant sites. The PT-100 thermal probe was positioned 5 mm from each site. Two physiological refrigerant solutions were used: one at 23.7°C and one at 6.0°C. Four experimental groups were considered: group A (continuous drilling with physiological solution at 23.7°C), group B (intermittent drilling with physiological solution at 23.7°C), group C (continuous drilling with physiological solution at 6.0°C), and group D (intermittent drilling with physiological solution at 6.0°C). The Wilcoxon rank-sum test (2-tailed) was used to compare groups. While there was no difference between group A and group B (W = 86; P = .45), statistically significant differences were observed between experimental groups A and C (W = 0; P =.0001), B and D (W = 45; P =.0005), and C and D (W = 41; P = .003). Implant site preparation did not affect the overheating of the bone. Statistically significant differences were found with the refrigerant solutions. Using both irrigating solutions, bone temperature did not exceed 47°C.

Read-through transcript from NM23-H1 into the neighboring NM23-H2 gene encodes a novel protein, NM23-LV

NARCIS (Netherlands)

Valentijn, Linda J.; Koster, Jan; Versteeg, Rogier

2006-01-01

NM23-H1 and NM23-H2 are neighboring genes on chromosome 17q. They encode nucleoside diphosphate kinases that have additional roles in signal transduction, transcription, and apoptosis. NM23-H1 expression is a strong marker for prognosis and metastatic behavior in many tumor types. A new

A Comparative Study of Blood Culture Sampling from Umbilical Catheter Line versus Peripheral Site

Directory of Open Access Journals (Sweden)

Abdolkarim Hamedi

2010-08-01

Full Text Available Neonatal sepsis is an important cause of death and morbidity in newborns and is diagnosed by isolation of organism in blood culture. In several reports,reliablity of blood cultures were done from umbi lical catheters,have been demonstrated. The objective of the present study was to determine,wether an inde welling umbilical catheter, could be an alternative site for blood culture. In a prospective study over 6 months during 2006,141 paired blood cultures from 134 infant,were done simultaneously from peripheral site and umbilical catheter (mostly U. V. C,during the first four days of life. Majority of these infants were preterm and admitted to NICU for special care. these infants had indwelling umbilical line and had indication of sepsis workup. A total of 141 pairs of blood cultures were obtained from 134 infants. In 16 infants blood culture pairs were positive for one organism in both peripheral vein and umbilical site. 71. 6% of total cultures (n=11pairs were negative in boths site. A total of 22 pairs were positive in one site only,with 5 positive from peripheral vein only and the other 17 from umblical site. Two pairs were positve in boths site with two different organism. In over all 16 infant (11%of blood were considered to be contaminated. Contamination rate were 2. 4% and 9. 2% for peripheral and umbilical catheter site. Contamination rate increased after 48 hours of age in umbilical catheter. The result showed that after 2 days contamination rate for blood culture taken from catheter line increased and specifity decreased. We recommended that blood culture via umblical catheter in first 2 days in sick neonates with indwelling catheter can be a alternate site of blood culture sampelling.

An integrated approach for estimating oil volume in petroleum-contaminated sites: a North American case study

International Nuclear Information System (INIS)

Chen, Z.; Huang, G.H.; Chakma, A.

1999-01-01

An integrated approach for estimating the distribution of light nonaqueous phase liquids (LNAPLs) such as oil spill and leakage in a porous media is proposed, based on a study at a site located in western Canada. The site has one original release source that is a flare pit, with on-site soil and groundwater seriously contaminated by petroleum products spilled over the past two decades. Results of the study show that soil properties and site characteristics have significant impact on the spreading of contaminants which affect the estimation of contaminant volume. Although the LNAPLs in the subsurface do not appear as a distinct layer, and the volume and distribution differ from site to site, the proposed method offers insight into the contamination details and is, therefore, considered to be an effective and convenient tool for obtaining a reasonable estimate of residual oil volume in the subsurface. Results could also be used in designing an enhanced recovery scheme for the site under study, as well as in designing multi-component models of the subsurface contamination for the purpose of risk assessment. 13 refs., 2 tabs., 2 figs

Low-spin states of 23Na

International Nuclear Information System (INIS)

Bakkum, E.L.

1987-01-01

A study of 23 Na via the 22 Ne(p,γ) 23 Na and 23 Na(γ,γ) 23 Na reactions is presented. Only a limited number of resonances has been studied, selected on the basis of strong excitation of the lowest levels of which the spin was unknown. As a result the spins are now known of all levels of 23 Na with excitation energies up to 7 MeV, except for a few high-spin states which are too weakly excited in the decay of the known 22 Ne(p,γ) resonances. The mean lifetimes of the 23 Na levels at 4.43 and 7.89 MeV were found to be 350±70 and 220±17 attoseconds (1 attosecond = 10 -18 seconds) respectively. 97 refs.; 22 figs.; 12 tabs

Federated Search and the Library Web Site: A Study of Association of Research Libraries Member Web Sites

Science.gov (United States)

Williams, Sarah C.

2010-01-01

The purpose of this study was to investigate how federated search engines are incorporated into the Web sites of libraries in the Association of Research Libraries. In 2009, information was gathered for each library in the Association of Research Libraries with a federated search engine. This included the name of the federated search service and…

Downregulated miR-23b-3p expression acts as a predictor of hepatocellular carcinoma progression: A study based on public data and RT-qPCR verification

Science.gov (United States)

Xiang, Xue-Lian; Yang, Xia; Liang, Hai-Wei; Qiu, Xiao-Hui; Yang, Li-Hua; Peng, Zhi-Gang; Chen, Gang

2018-01-01

Mounting evidence has shown that miR-23b-3p, which is associated with cell proliferation, invasion, and apoptosis, acts as a biomarker for diagnosis and outcomes in numerous cancers. However, the clinicopathological implication of miR-23b-3p in hepatocellular carcinoma (HCC) remains unclear. Our study evaluated the role of miR-23b-3p in HCC and investigated its potential application as a marker for preliminary diagnosis and therapy in HCC. High-throughput data from the NCBI Gene Expression Omnibus (GEO) and The Cancer Genome Atlas (TCGA) were collected and analyzed. One hundred and one tissue sections of HCC were paired with adjacent non-cancerous HCC as further supplements. miR-23b-3p expression was detected using quantitative real-time PCR. Additionally, the relationship between miR-23b-3p expression and HCC progression and Time-to-recurrence (months) was explored. Ten algorithms were applied to predict the prospective target genes of miR-23b-3p. Next, we conducted bioinformatics analysis for further study. miR-23b-3p expression was pronouncedly decreased in HCC tissues in contrast with their paired adjacent non-cancerous HCC (PAKT1, EGFR, CTNNB1, BCL2, SMAD3, PTEN and KDM6A, were located in the key nodes with high degree (>35). In conclusion, this study provides impressive illumination of the potential role of miR-23b-3p in HCC tumorigenesis and progression. Furthermore, miR-23b-3p may act as a predictor of HCC and could be a new treatment target. PMID:29484429

Corrective Action Decision Document/Closure Report for Corrective Action Unit 545: Dumps, Waste Disposal Sites, and Buried Radioactive Materials Nevada Test Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Alfred Wickline

2008-04-01

This Corrective Action Decision Document (CADD)/Closure Report (CR) has been prepared for Corrective Action Unit (CAU) 545, Dumps, Waste Disposal Sites, and Buried Radioactive Materials, in Areas 2, 3, 9, and 20 of the Nevada Test Site, Nevada, in accordance with the Federal Facility Agreement and Consent Order that was agreed to by the State of Nevada; U.S. Department of Energy (DOE), Environmental Management; U.S. Department of Defense; and DOE, Legacy Management (1996, as amended February 2008). Corrective Action Unit 545 is comprised of the following eight Corrective Action Sites (CASs): • 02-09-01, Mud Disposal Area • 03-08-03, Mud Disposal Site • 03-17-01, Waste Consolidation Site 3B • 03-23-02, Waste Disposal Site • 03-23-05, Europium Disposal Site • 03-99-14, Radioactive Material Disposal Area • 09-23-02, U-9y Drilling Mud Disposal Crater • 20-19-01, Waste Disposal Site While all eight CASs are addressed in this CADD/CR, sufficient information was available for the following three CASs; therefore, a field investigation was not conducted at these sites: • For CAS 03-08-03, though the potential for subsidence of the craters was judged to be extremely unlikely, the data quality objective (DQO) meeting participants agreed that sufficient information existed about disposal and releases at the site and that a corrective action of close in place with a use restriction is recommended. Sampling in the craters was not considered necessary. • For CAS 03-23-02, there were no potential releases of hazardous or radioactive contaminants identified. Therefore, the Corrective Action Investigation Plan for CAU 545 concluded that: “Sufficient information exists to conclude that this CAS does not exist as originally identified. Therefore, there is no environmental concern associated with CAS 03-23-02.” This CAS is closed with no further action. • For CAS 03-23-05, existing information about the two buried sources and lead pig was considered to be

Veteran Teacher Engagement in Site-Based Professional Development: A Mixed Methods Study

Science.gov (United States)

Houston, Biaze L.

2016-01-01

This research study examined how teachers self-report their levels of engagement, which factors they believe contribute most to their engagement, and which assumptions of andragogy most heavily influence teacher engagement in site-based professional development. This study employed a convergent parallel mixed methods design to study veteran…

A Study On The Applicability Of SERVQUAL Dimensions Of Web Sites

NARCIS (Netherlands)

A. van der Wiele (Ton); J.D. van Iwaarden (Jos)

2002-01-01

textabstractA survey has been undertaken amongst students of two universities (Erasmus University Rotterdam, The Netherlands, and Northeastern University Boston, USA) to study what quality factors are perceived as important in relation to their use of web sites. The results of the questionnaire

Evaluation and modelling of a potential repository site - Olkiluoto case study

International Nuclear Information System (INIS)

Saksa, P.; Ahokas, H.; Loefman, J.; Pitkaenen, P.; Paulamaeki, S.; Snellman, M.

1998-01-01

The observations, interpretations and estimates resulting from site investigations were developed into conceptual bedrock model of the Olkiluoto area. Model development has been an interdisciplinary process and three major iterations have occurred. Geochemical sampling and a programme of electromagnetic and electrical soundings were carried out and interpreted to model occurrences of groundwater types. The parametrisation and modifications needed between geological models and ground-water flow simulation model is discussed. The latest groundwater flow modelling effort comprises the transient flow analysis taking into account the effects of density variations, the repository, post-glacial land uplift and global sea level rise. The main flow modeling result quantities (the amount, direction, velocity and routes as well as concentration of water) are used for evaluation of the investigation sites and of the preconditions for safe final disposal of spent nuclear fuel. Integration of hydrological and hydrogeochemical methods and studies has provided the primary method for investigating the evolution. Testing of flow models with hydro-geochemical information is considered to improve the hydrogeological understanding of a site and increases confidence in conceptual hydrogeological models. Bedrock model allows also comparisons to be made between its time-varying versions. The evolution of fracture frequency, fracture zone structures and hydraulic conductivity has been studied. A prediction-outcome comparison was made in selected boreholes and showed that the rock type was the easiest parameter to predict

Cancer incidence in Italian contaminated sites

Directory of Open Access Journals (Sweden)

Pietro Comba

2014-06-01

Full Text Available INTRODUCTION. The incidence of cancer among residents in sites contaminated by pollutants with a possible health impact is not adequately studied. In Italy, SENTIERI Project (Epidemiological study of residents in National Priority Contaminated Sites, NPCSs was implemented to study major health outcomes for residents in 44 NPCSs. METHODS. The Italian Association of Cancer Registries (AIRTUM records cancer incidence in 23 NPCSs. For each NPCSs, the incidence of all malignant cancers combined and 35 cancer sites (coded according to ICD-10, was analysed (1996-2005. The observed cases were compared to the expected based on age (5-year period,18 classes, gender, calendar period (1996-2000; 2001-2005, geographical area (North-Centre and Centre-South and cancer sites specific rates. Standardized Incidence Ratios (SIR with 90% Confidence Intervals were computed. RESULTS. In both genders an excess was observed for overall cancer incidence (9% in men and 7% in women as well as for specific cancer sites (colon and rectum, liver, gallbladder, pancreas, lung, skin melanoma, bladder and Non Hodgkin lymphoma. Deficits were observed for gastric cancer in both genders, chronic lymphoid leukemia (men, malignant thyroid neoplasms, corpus uteri and connective and soft-tissue tumours and sarcomas (women. DISCUSSION. This report is, to our knowledge, the first one on cancer risk of residents in NPCSs. The study, although not aiming to estimate the cancer burden attributable to the environment as compared to occupation or life-style, supports the credibility of an etiologic role of environmental exposures in contaminated sites. Ongoing analyses focus on the interpretation of risk factors for excesses of specific cancer types overall and in specific NPCSs in relation to the presence of carcinogenic pollutants.

Corrective Action Investigation Plan for Corrective Action Unit 571: Area 9 Yucca Flat Plutonium Dispersion Sites, Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Bailey, Bernadine; Matthews, Patrick

2013-07-01

CAU 571 is a grouping of sites where there has been a suspected release of contamination associated with nuclear testing. This document describes the planned investigation of CAU 571, which comprises the following corrective action sites (CASs): • 09-23-03, Atmospheric Test Site S-9F • 09-23-04, Atmospheric Test Site T9-C • 09-23-12, Atmospheric Test Site S-9E • 09-23-13, Atmospheric Test Site T-9D • 09-45-01, Windrows Crater These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the investigation report. The sites will be investigated based on the data quality objectives (DQOs) developed on March 6, 2013, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office (now the Nevada Field Office). The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 571. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The potential contamination sources associated with CAU 571 CASs are from nuclear testing activities. The DQO process resulted in an assumption that total effective dose (TED) within a default contamination boundary exceeds the final action level (FAL) and requires corrective action. The presence and nature of contamination outside the default

Study of a metallurgical site in Tuscany (Italy) by radiocarbon dating

International Nuclear Information System (INIS)

Cartocci, A.; Fedi, M.E.; Taccetti, F.; Benvenuti, M.; Chiarantini, L.; Guideri, S.

2007-01-01

Tuscany represents one of the most important ancient mining districts of Italy. Metalworking activities have been present in the area since ancient times and several mining centres have been active in the region since the Etruscan period. Two of the more notable mining locations are the island of Elba and the towns of Populonia and Massa Marittima. In order to reconstruct the development of metallurgical techniques in the past, a multi-disciplinary approach is required, involving both archaeological study and archaeometric analysis of the sites of interest. One of the most complex problems is establishing the chronological history of metallurgical exploitation in ancient sites: archaeological remains are sometimes incomplete and the stratigraphy of archaeological horizons might have been deeply altered. Thus, direct dating of metallurgical slags and other remains of mining and metalworking activities using radiocarbon measurements is particularly useful for developing site chronologies. Charcoal samples from a recent excavation in Populonia were dated by AMS radiocarbon in order to reconstruct the chronological evolution of ancient metallurgical production; results reported here are consistent with archaeological observations

Study of a metallurgical site in Tuscany (Italy) by radiocarbon dating

Energy Technology Data Exchange (ETDEWEB)

Cartocci, A. [Dipartimento di Fisica dell' Universita e I.N.F.N. Sezione di Firenze, via Sansone 1, 50019 Sesto Fiorentino, Florence (Italy); Fedi, M.E. [Dipartimento di Fisica dell' Universita e I.N.F.N. Sezione di Firenze, via Sansone 1, 50019 Sesto Fiorentino, Florence (Italy)]. E-mail: fedi@fi.infn.it; Taccetti, F. [Dipartimento di Fisica dell' Universita e I.N.F.N. Sezione di Firenze, via Sansone 1, 50019 Sesto Fiorentino, Florence (Italy); Benvenuti, M. [Dipartimento di Scienze della Terra dell' Universita di Firenze, via La Pira 4, 50121 Florence (Italy); Chiarantini, L. [Dipartimento di Scienze della Terra dell' Universita di Firenze, via La Pira 4, 50121 Florence (Italy); Guideri, S. [Societa Parchi Val di Cornia S.p.a., via G. Lerario, Piombino, Livorno (Italy)

2007-06-15

Tuscany represents one of the most important ancient mining districts of Italy. Metalworking activities have been present in the area since ancient times and several mining centres have been active in the region since the Etruscan period. Two of the more notable mining locations are the island of Elba and the towns of Populonia and Massa Marittima. In order to reconstruct the development of metallurgical techniques in the past, a multi-disciplinary approach is required, involving both archaeological study and archaeometric analysis of the sites of interest. One of the most complex problems is establishing the chronological history of metallurgical exploitation in ancient sites: archaeological remains are sometimes incomplete and the stratigraphy of archaeological horizons might have been deeply altered. Thus, direct dating of metallurgical slags and other remains of mining and metalworking activities using radiocarbon measurements is particularly useful for developing site chronologies. Charcoal samples from a recent excavation in Populonia were dated by AMS radiocarbon in order to reconstruct the chronological evolution of ancient metallurgical production; results reported here are consistent with archaeological observations.

Mapping important nucleotides in the peptidyl transferase centre of 23 S rRNA using a random mutagenesis approach

DEFF Research Database (Denmark)

Porse, B T; Garrett, R A

1995-01-01

Random mutations were generated in the lower half of the peptidyl transferase loop in domain V of 23 S rRNA from Escherichia coli using a polymerase chain reaction (PCR) approach, a rapid procedure for identifying mutants and a plasmid-based expression system. The effects of 21 single-site mutati...

The association between chronic airflow obstruction and poverty in 12 sites of the multinational BOLD study.

Science.gov (United States)

Townend, John; Minelli, Cosetta; Mortimer, Kevin; Obaseki, Daniel O; Al Ghobain, Mohammed; Cherkaski, Hamid; Denguezli, Myriam; Gunesekera, Kirthi; Hafizi, Hasan; Koul, Parvaiz A; Loh, Li C; Nejjari, Chakib; Patel, Jaymini; Sooronbayev, Talant; Buist, Sonia A; Burney, Peter G J

2017-06-01

Poverty is strongly associated with mortality from COPD, but little is known of its relation to airflow obstruction.In a cross-sectional study of adults aged ≥40 years from 12 sites (N=9255), participating in the Burden of Obstructive Lung Disease (BOLD) study, poverty was evaluated using a wealth score (0-10) based on household assets. Obstruction, measured as forced expiratory volume in 1 s (FEV 1 )/forced vital capacity (FVC) (%) after administration of 200 μg salbutamol, and prevalence of FEV 1 /FVCwealth scores ranged from 4 in Blantyre (Malawi) and Kashmir (India) to 10 in Riyadh (Saudi Arabia), and the prevalence of obstruction, from 16% in Kashmir to 3% in Riyadh and Penang (Malaysia). Following adjustments for age and sex, FEV 1 /FVC increased by 0.36% (absolute change) (95%CI: 0.22, 0.49; pwealth score. Adjustments for other confounders reduced this effect to 0.23% (0.11, 0.34), but even this value remained highly significant (pwealth scores explained 38% of the variation in mean FEV 1 /FVC between sites (r 2 =0.385, p=0.031).Airflow obstruction is consistently associated with poverty at individual and community levels across several countries. Copyright ©ERS 2017.

A case study of risk assessment in contaminated site remediation in China

Science.gov (United States)

Ye, S.; Guo, J.; Wu, J.; Wang, J.; Chien, C.; Stahl, R.; Mack, E.; Grosso, N.

2013-12-01

A field site in Nanjing, China was selected for a case study of risk assessment in contaminated site remediation. This site is about 100m long and 100m wide. A chemical plant (1999-2010) at the site manufactured optical brightener PF, 2-Amino-4-methylphenol and 2-Nitro-4-methylphenol, totally three products. Soil and groundwater samples were collected and analyzed for PPL 126 (126 pollutants in the 'Priority Pollutants List' issued by US EPA). Values of the Dutch Standards were used as the screening criteria for soil and ground water. Low levels of ethylbenezene, chlorobenzene, 1,3-dichlorobenzene and 1,4- dichlorobenzene were detected in one soil sample. Concentrations above Dutch Target Value (DTV) of benzene, toluene, ethylbenzene, chlorobenzene, 1,2-dichlorobenzene, 1,3-dichlorobenzene, 1,4-dichlorobenzene, and/or 1,2,4-trichlorobenzene, phenol, and/or 2,4-dichlorophenol were exhibited in two groundwater samples. The ground water was especially highly impacted by bichlorobenzenes and trichlorobenzenes. The maximum concentration of impacts was 7.3 mg/L of 1,2,4-trichlorobenzene in groundwater which was 730 times higher than Dutch Intervention Values (DIV). Risk of soil and groundwater at this site was assessed according to the guidelines issued by Chinese MEP and US EPA, respectively. Finally, remedy techniques were selected according to the result of risk assessment and the characteristics of hydrogeology conditions and contaminants.

23 CFR 750.107 - Class 3 and 4 signs outside informational sites.

Science.gov (United States)

2010-04-01

... areas. (6) Not more than one such sign advertising activities being conducted as a single enterprise or... ENVIRONMENT HIGHWAY BEAUTIFICATION National Standards for Regulation by States of Outdoor Advertising Adjacent... traffic not served by an informational site within 12 air miles of the advertised activity; (2) Class 4...

Site Study Plan for laboratory soil mechanics, Deaf Smith County site, Texas: Revision 1

International Nuclear Information System (INIS)

1987-12-01

This Site Study Plan for laboratory soil mechanics describes the laboratory testing to be conducted on soil samples collected as part of the characterization of the Deaf Smith County site, Texas. This study provides for measurements of index, mechanical, thermal, hydrologic, chemical, and mineral properties of soils from boring throughout the site. Samples will be taken from Playa Borings/Trenching, Transportation/Utilities Foundation Borings, Repository Surface Facilities Design Foundation Borings, and Exploratory Shaft Facilities Design Foundation Borings. Data from the laboratory tests will be used for soil strata characterization, design of foundations for surface structures, design of transportation facilities and utility structures, design of impoundments, design of shaft lining, design of the shaft freeze wall, shaft permitting, performance assessment calculations, and other program requirements. A tentative testing schedule and milestone log are given. A quality assurance program will be utilized to assure that activities affecting quality are performed correctly and that appropriate documentation is maintained. 18 refs., 6 figs., 3 tabs

Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.

Science.gov (United States)

Vyhlidal, C; Samudio, I; Kladde, M P; Safe, S

2000-06-01

17beta-Estradiol (E2) induces transforming growth factor alpha (TGFalpha) gene expression in MCF-7 cells and previous studies have identified a 53 bp (-252 to -200) sequence containing two imperfect estrogen responsive elements (EREs) that contribute to E2 responsiveness. Deletion analysis of the TGFalpha gene promoter in this study identified a second upstream region of the promoter (-623 to -549) that is also E2 responsive. This sequence contains three GC-rich sites and an imperfect ERE half-site, and the specific cis-elements and trans-acting factors were determined by promoter analysis in transient transfection experiments, gel mobility shift assays and in vitro DNA footprinting. The results are consistent with an estrogen receptor alpha (ERalpha)/Sp1 complex interacting with an Sp1(N)(30) ERE half-site ((1/2)) motif in which both ERalpha and Sp1 bind promoter DNA. The ER/Sp1-DNA complex is formed using nuclear extracts from MCF-7 cells but not with recombinant human ERalpha or Sp1 proteins, suggesting that other nuclear factor(s) are required for complex stabilization. The E2-responsive Sp1(N)(x)ERE(1/2) motif identified in the TGFalpha gene promoter has also been characterized in the cathepsin D and heat shock protein 27 gene promoters; however, in the latter two promoters the numbers of intervening nucleotides are 23 and 10 respectively.

Risk factors for acute surgical site infections after lumbar surgery: a retrospective study.

Science.gov (United States)

Lai, Qi; Song, Quanwei; Guo, Runsheng; Bi, Haidi; Liu, Xuqiang; Yu, Xiaolong; Zhu, Jianghao; Dai, Min; Zhang, Bin

2017-07-19

Currently, many scholars are concerned about the treatment of postoperative infection; however, few have completed multivariate analyses to determine factors that contribute to the risk of infection. Therefore, we conducted a multivariate analysis of a retrospectively collected database to analyze the risk factors for acute surgical site infection following lumbar surgery, including fracture fixation, lumbar fusion, and minimally invasive lumbar surgery. We retrospectively reviewed data from patients who underwent lumbar surgery between 2014 and 2016, including lumbar fusion, internal fracture fixation, and minimally invasive surgery in our hospital's spinal surgery unit. Patient demographics, procedures, and wound infection rates were analyzed using descriptive statistics, and risk factors were analyzed using logistic regression analyses. Twenty-six patients (2.81%) experienced acute surgical site infection following lumbar surgery in our study. The patients' mean body mass index, smoking history, operative time, blood loss, draining time, and drainage volume in the acute surgical site infection group were significantly different from those in the non-acute surgical site infection group (p operative type in the acute surgical site infection group were significantly different than those in the non-acute surgical site infection group (p operative type, operative time, blood loss, and drainage time were independent predictors of acute surgical site infection following lumbar surgery. In order to reduce the risk of infection following lumbar surgery, patients should be evaluated for the risk factors noted above.

Inter-Site Consistency at a Multi-Site Psychiatry Clerkship

Science.gov (United States)

Shultes von Schlageter, Margo; Park, EunMi; Tucker, Phebe

2006-01-01

Objective: This study examines the effects of clinical site assignment within a multiple-site psychiatry clerkship program on the convergent outcome of the National Board of Medical Examiners (NBME) subject examination. Method: NBME scores, controlled for baseline pre-clerkship knowledge base as measured by second year human behavior scores, were…

Posttranscriptional modifications in the A-loop of 23S rRNAs from selected archaea and eubacteria.

Science.gov (United States)

Hansen, M A; Kirpekar, F; Ritterbusch, W; Vester, B

2002-02-01

Posttranscriptional modifications were mapped in helices 90-92 of 23S rRNA from the following phylogenetically diverse organisms: Haloarcula marismortui, Sulfolobus acidocaldarius, Bacillus subtilis, and Bacillus stearothermophilus. Helix 92 is a component of the ribosomal A-site, which contacts the aminoacyl-tRNA during protein synthesis, implying that posttranscriptional modifications in helices 90-92 may be important for ribosome function. RNA fragments were isolated from 23S rRNA by site-directed RNase H digestion. A novel method of mapping modifications by analysis of short, nucleotide-specific, RNase digestion fragments with Matrix Assisted Laser Desorption/Ionization Mass Spectrometry (MALDI-MS) was utilized. The MALDI-MS data were complemented by two primer extension techniques using reverse transcriptase. One technique utilizes decreasing concentrations of deoxynucleotide triphosphates to map 2'-O-ribose methylations. In the other, the rRNA is chemically modified, followed by mild alkaline hydrolysis to map pseudouridines (psis). A total of 10 posttranscriptionally methylated nucleotides and 6 psis were detected in the five organisms. Eight of the methylated nucleotides and one psi have not been reported previously. The distribution of modified nucleotides and their locations on the surface of the ribosomal peptidyl transferase cleft suggests functional importance.

Effect of four monthly doses of a human monoclonal anti-FGF23 antibody (KRN23 on quality of life in X-linked hypophosphatemia

Directory of Open Access Journals (Sweden)

Mary D. Ruppe

2016-12-01

Full Text Available X-linked hypophosphatemia (XLH is characterized by lower extremity deformities that lead to bone and/or joint pain that result from decreased renal tubular reabsorption leading to hypophosphatemia caused by elevated levels of fibroblast growth factor 23 (FGF23. Objective: Validate the use of SF-36v2 Health Survey (SF-36v2 and the Western Ontario and McMaster Osteoarthritis Index (WOMAC to measure previously unstudied health-related quality of life (HRQoL in XLH patients and determine the change in HRQoL before and after treatment with KRN23, a human monoclonal anti-FGF23 antibody. Methods: Twenty-eight adult outpatients with XLH received up to four doses of KRN23 administered subcutaneously every 28 days. General HRQoL was measured with the SF-36v2 and condition-related HRQoL with the WOMAC at baseline and study endpoint as a secondary outcome of a Phase 1/2, open-label, multicenter, dose-escalation trial. Results: Testing for scale discriminant validity and convergent-divergent validity supported the use of these scales in the assessment of HRQoL in XLH. Both instruments indicated impairment of physical function at baseline with all mean scores showing a trend to improved health at study endpoint compared to baseline. When corrected for multiple comparisons, the score for Role Limitations due to physical health on the SF-36v2 which measures the patient's perception of their own chronic functional impairments due to poor physical health remained significantly improved (P < 0.05, increasing to the mean score of US adults. For the WOMAC, Physical Functioning and Stiffness scores were significantly improved (P < 0.05. Conclusion: KRN23 administration was associated with significantly improved patient perception of their Physical Functioning and Stiffness due to their disease. This study demonstrates that the SF-36v2 and WOMAC are valid tools for assessing HRQoL in XLH. Keywords: X-linked hypophosphatemia, KRN23, Health-related quality of life

Case studies of community relations on DOE's Formerly Utilized Sites Remedial Action Program as models for Superfund sites

International Nuclear Information System (INIS)

Plant, S.W.; Adler, D.G.

1995-01-01

Ever since the US Department of Energy (DOE) created its Formerly Utilized Sites Remedial Action Program (FUSRAP) in 1974, there has been a community relations program. The community relations effort has grown as FUSRAP has grown. With 20 of 46 sites now cleaned up, considerable experience in working with FUSRAP stakeholders has been gained. Why not share that experience with others who labor on the Superfund sites? Many similarities exist between the Superfund sites and FUSRAP. FUSRAP is a large, multiple-site environmental restoration program. The challenges range from small sites requiring remedial actions measurable in weeks to major sites requiring the full remedial investigation/feasibility study process. The numerous Superfund sites throughout the United States offer the same diversity, both geographically and technically. But before DOE offers FUSRAP's community relations experience as a model, it needs to make clear that this will be a realistic model. As experiences are shared, DOE will certainly speak of the efforts that achieved its goals. But many of the problems that DOE encountered along the way will also be related. FUSRAP relies on a variety of one- and two-way communication techniques for involving stakeholders in the DOE decision-making process. Some of the techniques and experiences from the case studies are presented

Innovations in Site Characterization Case Study: The Role of a Conceptual Site Model for Expedited Site Characterization Using the Triad Approach at the Poudre River Site, Fort Collins, Colorado

Science.gov (United States)

This case study examines how systematic planning, an evolving conceptual site model (CSM), dynamic work strategies, and real time measurement technologies can be used to unravel complex contaminant distribution patterns...

Site remediation and risk assessment in Canada: current CPPI activities and a vision for the 21. century - a perspective from the Canadian Petroleum Products Industry

International Nuclear Information System (INIS)

Calder, L.M.

1997-01-01

The scope of site remediation in the Canadian petroleum products industry was discussed. It was estimated that the cost to clean up the nearly 100,000 contaminated sites in Canada would be in the order of $20 billion. One alternative to the high cost of clean up is the use of risk assessment for the development of soil remediation criteria that would be appropriate to the real impact of a given contaminated site, instead of the use of arbitrary criteria that are intended to protect all sites. In this way, most dollars would be spent at cleaning up the highest risk sites. Recommendations were made as to how the science and the administration of risk assessments could be improved. It was suggested that a more holistic approach to site remediation must be taken. The issues of risk, risk trade-offs, cost-benefit, cost-effectiveness and prioritization within the site remediation context was also discussed. A comparative study of two risk assessment models, the ASTM-RBCA model used in Atlantic Canada, and the B.C. Vapour Intrusion Model Validation study was described. 23 refs., 3 tabs

Does Infection Site Matter? A Systematic Review of Infection Site Mortality in Sepsis.

Science.gov (United States)

Motzkus, Christine A; Luckmann, Roger

2017-09-01

Sepsis treatment protocols emphasize source control with empiric antibiotics and fluid resuscitation. Previous reviews have examined the impact of infection site and specific pathogens on mortality from sepsis; however, no recent review has addressed the infection site. This review focuses on the impact of infection site on hospital mortality among patients with sepsis. The PubMed database was searched for articles from 2001 to 2014. Studies were eligible if they included (1) one or more statistical models with hospital mortality as the outcome and considered infection site for inclusion in the model and (2) adult patients with sepsis, severe sepsis, or septic shock. Data abstracted included stage of sepsis, infection site, and raw and adjusted effect estimates. Nineteen studies were included. Infection sites most studied included respiratory (n = 19), abdominal (n = 19), genitourinary (n = 18), and skin and soft tissue infections (n = 11). Several studies found a statistically significant lower mortality risk for genitourinary infections on hospital mortality when compared to respiratory infections. Based on studies included in this review, the impact of infection site in patients with sepsis on hospital mortality could not be reliably estimated. Misclassification among infections and disease states remains a serious possibility in studies on this topic.

A study on air pollution concentration at Desa parkcity construction site

African Journals Online (AJOL)

This study assesses the effect of construction workers exposure towards the air pollution to the correlation between meteorological factor with the particulate matter and other gases concentration at a construction site in DesaParkcity. The concentration of PM was collected by using low volume sampler meanwhile CO, CO2, ...

Site specific study for possible ongoing salt dome movement

International Nuclear Information System (INIS)

Thoms, R.L.; Manning, T.A.; Paille, L.K.; Gehle, R.M.

1977-01-01

U.S. Gulf Coast salt domes, among other geologic structures, currently are being considered for storage of commercial radioactive wastes. A major concern with dome storage of long lived radioactive wastes lies with the possible tectonic movement of the host dome. Any ongoing movement of a salt dome can be monitored with a site specific complementary system of field instrumentation and finite element modelling. Field instrumentation and accompanying finite element analyses for a study dome in northwest Louisiana are described. Site specific data and early experience associated with tiltmeters over the dome are presented. Also, recommendations are made for modifications and extensions of the field instrumentation and finite element modelling appropriate to the specific site under study

Hanford tank initiative test facility site selection study

International Nuclear Information System (INIS)

Staehr, T.W.

1997-01-01

The Hanford Tanks Initiative (HTI) project is developing equipment for the removal of hard heel waste from the Hanford Site underground single-shell waste storage tanks. The HTI equipment will initially be installed in the 241-C-106 tank where its operation will be demonstrated. This study evaluates existing Hanford Site facilities and other sites for functional testing of the HTI equipment before it is installed into the 241-C-106 tank

Predicting treatment response from dopamine D2/3 receptor bnding potential? - A study in antipsychotic-naïve patients with schizophrenia

DEFF Research Database (Denmark)

Wulff, Sanne; Pinborg, Lars Hageman; Svarer, Claus

of antipsychotic compounds on the positive symptoms. Furthermore, blockade of striatal dopamine D2 receptors have in studies shown to associate negatively with subjective well-being. Our main aim was to explore a possible predictive value of striatal dopamine D2/3 receptor binding potential (BPp) for treatment...... of 29 antipsychotic-naïve patients with schizophrenia and 26 matched healthy controls, SPECT with [123l]-IBZM was used to examine the BPP of striatal dopamine D2/3 receptors. The participants were examined at baseline and after 6 weeks of treatment with a selective D2/3 receptor antagonist, amisulpride....... Results: We found a significant inverse correlation between the striatal BPp at baseline and improvement of positive symptoms (p=0.046; R squared = 0.152) after six weeks of treatment with amisulpride. There was no association between the blockade of the D2/3 receptors and improvement of positive symptoms...

A crystallographic and spectroscopic study of crystal sites in the 'spinel' structure; Etude cristallographique et spectroscopique des sites cristallins dans la structure 'spinelle'

Energy Technology Data Exchange (ETDEWEB)

Drifford, M. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1967-06-15

A crystallographic study on magnesium aluminates led to the determination of crystal site average distortion. A spectroscopic study of transition elements doped spinels gave the position of the doping element in tetrahedral (A) or octahedral (B) sites, and the local distortion of the latter. The comparison of average and local parameters points to differences in the behaviour of doping elements and shows the size of (A) sites are independent of the host crystal composition while the average size of (B) sites varies with the composition. (author) [French] Une etude cristallographique des aluminates de magnesium a permis de determiner la deformation moyenne des sites cristallins. Une etude spectroscopique des aluminates de magnesium dopes avec des elements de transition a permis de localiser les dopants entre les sites tetraedriques (A) et octaedriques (B) et d'etudier la deformation locale de ces sites. La comparaison entre les parametres moyens et locaux a caracterise le comportement du dopant et montre que les dimensions des sites (A) sont independantes de la composition de la matrice, alors que les caracteristiques geometriques moyennes des sites (B) varient continument avec la composition. (auteur)

A 125Te and 23Na NMR investigation of the structure and crystallisation of sodium tellurite glasses.

Science.gov (United States)

Holland, D; Bailey, J; Ward, G; Turner, B; Tierney, P; Dupree, R

2005-01-01

125Te static nuclear magnetic resonance (NMR) and 23Na and 125Te magic angle spinning (MAS) NMR have been used, in conjunction with X-ray diffraction, to examine the structure and crystallisation behaviour of glasses of composition xNa2O.(1-x)TeO2 (0.075 x 0.4). The MAS NMR 23Na spectra from the glasses are broad and featureless but shift by approximately +5 ppm with increased x, i.e. as the system becomes more ionic. The static 125Te NMR spectra show an increase in axial symmetry with increasing x, indicating a shift from predominantly [TeO4] to [TeO3] structural units. The 23Na and 125Te spectra from the crystallised samples have been fitted to obtain information on the sites in the metastable crystal phases, which are the first to form on heating and which are therefore more closely related to the glass structure than thermodynamically stable crystal phases. New sodium tellurite phases are reported, including a sodium stabilised, face centred cubic phase related to delta-TeO2; a metastable form of Na2Te4O9 containing 3 sodium and 4 tellurium sites; and a metastable form of Na2Te2O5 containing 2 sodium sites. There is evidence of oxidation of TeIV to TeVI occurring in glasses with high values of x and, at x=0.40 and 0.50 (outside the glass forming range), some sodium metatellurate (Na2TeO4) is formed at the same time as sodium metatellurite (Na2TeO3). The 125Te shift is very sensitive to environment within the sodium tellurite system, covering more than 320 ppm, with anisotropies varying from 640 to 1540 ppm. The lack of features in the 125Te spectra of the glass phases, combined with the large shift range and high but variable anisotropy, means than it is not possible to obtain a unique fit to any presumed species present. Furthermore, the chemical shift anisotropy parameters for three of the four Te sites in the Na2Te4O9 phase are found to lie outside the range used for previous simulations of glass spectra.

45 CFR 213.23a - Discovery.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 2 2010-10-01 2010-10-01 false Discovery. 213.23a Section 213.23a Public Welfare... Discovery. The Department and any party named in the notice issued pursuant to § 213.11 shall have the right to conduct discovery (including depositions) against opposing parties. Rules 26-37 of the Federal...

Site Study Plan for meteorology/air quality, Deaf Smith County site, Texas: Environmental Field Program: Preliminary draft

International Nuclear Information System (INIS)

1987-06-01

The Meteorological/Air Quality Site Study Plan describes a field program consisting of continuous measurements of surface (10-meter) wind speed and direction, temperature, humidity, dew point, pressure, and sensible heat flux (vertical). Air quality measurements will be limited to suspended particulate matter. After the first year of measurements, a 60-meter tower will be added to incorporate measurements needed for later modeling and dose calculations; these will include upper level winds, vertical temperature structure, and vertical wind speed. All of these measurements will be made at a site located within the 9-mi 2 site area but remote from the ESF. A second site, located near and downwind from the ESF, will monitor only particulate matter. The SSP describes the need for each study; its design and design rationale; analysis, management, and use of data, schedule of field activities, organization of field personnel and sample management, and quality assurance requirements. These studies will provide data needed to satisfy requirements contained in, or derived from the Salt Repository Project Requirements Document. 38 refs., 8 figs., 3 tabs

A quantitative analysis of TIMS data obtained on the Learjet 23 at various altitudes

Science.gov (United States)

Jaggi, S.

1992-01-01

A series of Thermal Infrared Multispectral Scanner (TIMS) data acquisition flights were conducted on the NASA Learjet 23 at different altitudes over a test site. The objective was to monitor the performance of the TIMS (its estimation of the brightness temperatures of the ground scene) with increasing altitude. The results do not show any significant correlation between the brightness temperatures and the altitude. The analysis indicates that the estimation of the temperatures is a function of the accuracy of the atmospheric correction used for each altitude.

Towards the Study of the Early Medieval Site Bashanta-II

Directory of Open Access Journals (Sweden)

Ochir-Goryaeva Maria A.

2016-12-01

Full Text Available The authors offer preliminary results on study of a new early medieval site discovered in the Gorodovikovo District (Kalmykia during a field survey near Bashanta-I hillfort at Chapaevskoe Lake (or Tsagan nur in Kalmyk language. The new site is found 8 km to the south-west from Bashanta-I hillfort, on the bank of the Egorlyk River. The site is dated by two radiocarbon dates by the middle of the 7th – late 8th centuries, i.e. by the time of Khazar Khanate. Some preliminary studies on the site included topographical mapping, collection of stray finds and a few prospection pits. These activities yielded numerous ceramic sherds, roof tiles and debris of masonry. Judging by the existing cultural stratum, remains of stone structures made of shell stone blocks and numerous ceramic finds of good quality, the new site was a settlement of Saltovo-Mayaki Culture, presumably a satellite hillfort. The identity of ceramics and construction materials allowed the authors to name this new site as Bashanta-II.

cDNA Cloning, Overexpression, Purification and Pharmacologic Evaluation for Anticancer Activity of Ribosomal Protein L23A Gene (RPL23A from the Giant Panda

Directory of Open Access Journals (Sweden)

Si-Nan Zhang

2012-02-01

Full Text Available RPL23A gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L23P family of ribosomal proteins, which is located in the cytoplasm. The purpose of this paper was to explore the structure and anti-cancer function of ribosomal protein L23A (RPL23A gene of the Giant Panda (Ailuropoda melanoleuca. The cDNA of RPL23A was cloned successfully from the Giant Panda using RT-PCR technology. We constructed a recombinant expression vector containing RPL23A cDNA and over-expressed it in Escherichia coli using pET28a plasmids. The expression product obtained was purified by using Ni chelating affinity chromatography. Recombinant protein of RPL23A obtained from the experiment acted on Hep-2 cells and human HepG-2 cells, then the growth inhibitory effect of these cells was observed by MTT (3-[4,5-dimethyl-2-thiazolyl]-2,5-diphenyl-2H-tetrazolium bromide assay. The result indicated that the length of the fragment cloned is 506 bp, and it contains an open-reading frame (ORF of 471 bp encoding 156 amino acids. Primary structure analysis revealed that the molecular weight of the putative RPL23A protein is 17.719 kDa with a theoretical pI 11.16. The molecular weight of the recombinant protein RPL23A is 21.265 kDa with a theoretical pI 10.57. The RPL23A gene can be really expressed in E. coli and the RPL23A protein, fusioned with the N-terminally His-tagged protein, gave rise to the accumulation of an expected 22 KDa polypeptide. The data showed that the recombinant protein RPL23A had a time- and dose-dependency on the cell growth inhibition rate. The data also indicated that the effect at low concentrations was better than at high concentrations on Hep-2 cells, and that the concentration of 0.185 μg/mL had the best rate of growth inhibition of 36.31%. All results of the experiment revealed that the recombinant protein RPL23A exhibited anti-cancer function on the Hep-2 cells. The study provides a scientific basis and aids

Site Study Plan for Aesthetics, Deaf Smith County Site, Texas: Environmental Field Program: Preliminary draft

International Nuclear Information System (INIS)

1987-06-01

The Aesthetic Site Study Plan describes a field program consisting of identification of the visually affected area; determination of scenic quality, visual sensitivity, and visual management classes of the site and vicinity; and analysis of the level of visual contrast that would be created by the project. Field ratings of scenic quality, visual sensitivity, and visual contrast will be supplemented by a public perception survey designed to incorporate the views of the public. This plan describes the need for the study, the study design, data management and use, schedule for proposed activities, and quality assurance program. This study will provide data needed to satisfy requirements contained in, or derived from, SRPO Requirement Document (SRP-RD). 35 refs., 6 figs., 2 tabs

Potential Predictors of Plasma Fibroblast Growth Factor 23 Concentrations: Cross-Sectional Analysis in the EPIC-Germany Study.

Directory of Open Access Journals (Sweden)

Romina di Giuseppe

Full Text Available Increased fibroblast growth factor 23 (FGF23, a bone-derived hormone involved in the regulation of phosphate and vitamin D metabolism, has been related to the development of cardiovascular disease (CVD in chronic kidney disease patients and in the general population. However, what determines higher FGF23 levels is still unclear. Also, little is known about the influence of diet on FGF23. The aim of this study was therefore to identify demographic, clinical and dietary correlates of high FGF23 concentrations in the general population.We performed a cross-sectional analysis within a randomly selected subcohort of the European Prospective Investigation into Cancer and Nutrition (EPIC-Germany comprising 2134 middle-aged men and women. The Human FGF23 (C-Terminal ELISA kit was used to measure FGF23 in citrate plasma. Dietary data were obtained at baseline via validated food frequency questionnaires including up to 148 food items.Multivariable adjusted logistic regression showed that men had a 66% lower and smokers a 64% higher probability of having higher FGF23 (≥ 90 RU/mL levels compared, respectively, with women and nonsmokers. Each doubling in parathyroid hormone, creatinine, and C-reactive protein was related to higher FGF23. Among the dietary factors, each doubling in calcium and total energy intake was related, respectively, to a 1.75 and to a 4.41 fold increased probability of having higher FGF23. Finally, each doubling in the intake of iron was related to an 82% lower probability of having higher FGF23 levels. Results did not substantially change after exclusion of participants with lower kidney function.In middle-aged men and women traditional and non-traditional CVD risk factors were related to higher FGF23 concentrations. These findings may contribute to the understanding of the potential mechanisms linking increased FGF23 to increased CVD risk.

Sector Retinitis Pigmentosa Associated With Novel Compound Heterozygous Mutations of CDH23.

Science.gov (United States)

Branson, Sara V; McClintic, Jedediah I; Stamper, Tara H; Haldeman-Englert, Chad R; John, Vishak J

2016-02-01

Usher syndrome is an autosomal recessive condition characterized by retinitis pigmentosa (RP) and congenital hearing loss, with or without vestibular dysfunction. Allelic variants of CDH23 cause both Usher syndrome type 1D (USH1D) and a form of nonsyndromic hearing loss (DFNB12). The authors describe here a 34-year-old patient with congenital hearing loss and a new diagnosis of sector RP who was found to have two novel compound heterozygous mutations in CDH23, including one missense (c.8530C > A; p.Pro2844Thr) and one splice-site (c.5820 + 5G > A) mutation. This is the first report of sector RP associated with these types of mutations in CDH23. Copyright 2016, SLACK Incorporated.

Phase, microstructure and microwave dielectric properties of A-site deficient (La, Nd2/3TiO3 perovskite ceramics

Directory of Open Access Journals (Sweden)

Saleem Muhammad

2015-03-01

Full Text Available (La, Nd2/3TiO3 ceramics were prepared through a conventional solid state mixed oxide route. For phase and microstructure analysis, XRD and SEM were used, respectively. Microwave dielectric properties were measured using a network analyzer. XRD patterns revealed the formation of the parent (La, Nd2/3TiO3 phase along with (La, Nd4Ti9O24 as a secondary phase. The microstructure consisted of rectangular and needle shaped grains, which decreased in size from 4 μm to 2 μm with an increase in sintering temperature from 1300 °C to 1350 °C. Decrease in grain size caused an increase in density of the samples from 4.81 g/cm3 to 5.17 g/cm3. Microwave dielectric properties of the samples calcined and sintered in air atmosphere were εr = 40.35, Q × f = 3499 GHz and τf = 0 ppm/°C, whereas for a sample calcined in nitrogen and sintered in air they were εr = 40.18, Q × f = 4077 GHz and τf = +4.9 ppm/°C, respectively.

Siting study for small platform-mounted industrial energy reactors

International Nuclear Information System (INIS)

1975-07-01

Utilizing an existing 313 MW(t) ship propulsion reactor design, a concept has been formulated for a floating platform-mounted nuclear plant and an evaluation has been made to determine reductions in construction time and cost achievable by repetitive platform construction in a shipyard. Concepts and estimates are presented for siting platform-mounted nuclear plants at the location of industrial facilities where the nuclear plants would furnish industrial process heat and/or electrical power. The representative industrial site designated for this study is considered typical of sites that might be used along the extensive network of navigable canals adjacent to the ocean and is similar to potential sites along the inland waterways of the United States

The glass block site radionuclide migration study

International Nuclear Information System (INIS)

Killey, R.W.D.; Champ, D.R.

1990-01-01

In 1960 25 nepheline syenite glass blocks containing 14 TBq of mixed fission products in 50 kg of glass were placed below the water table in a shallow sand aquifer at Chalk River Laboratories. Experimental studies undertaken at the site since 1960 have included detailed mapping of the plume of 90 Sr in 1963, 1966 and 1971. Mathematical modeling studies have employed the radiostrontium plume data in determining the split between ion exchange and chemisorption of 90 Sr, and in obtaining reaction rate data for chemisorption. The distribution of 137 Cs on downgradient soils was mapped in 1963 and 1979. An extended plume of low-level 137 Cs contamination observed in the 1979 study prompted an investigation of the role of particulate materials in radionuclide transport. IN 1983, large volume groundwater sampling and separation of cationic, anionic, and neutral dissolved species, as well as particulates, detected anionic and cationic dissolved europium isotopes (154 and 155), and again encountered particulate 137 Cs. A variety of investigations of cesium and strontium sorption have provided a data base on sediment mineralogy, particle surface features, and information on sorption sites and processes. The year 1990 saw the inauguration of a three-year program to update investigations of radionuclide release, transport, and sorption at the glass block site. The first stage of the program has been a detailed definition and simulation of the hydrogeologic setting. Plume mapping and aqueous speciation studies are in progress. This paper summarizes past investigations, reviews the status of the current program, and discusses components of future studies, including investigations of sediment sorption mechanisms. (Author) (17 refs., 8 figs.)

Is 13-Valent Pneumococcal Conjugate Vaccine (PCV13 Combined With 23-Valent Pneumococcal Polysaccharide Vaccine (PPSV23 Superior to PPSV23 Alone for Reducing Incidence or Severity of Pneumonia in Older Adults? A Clin-IQ

Directory of Open Access Journals (Sweden)

Starla Hayward

2016-04-01

Full Text Available Pneumonia infection is a significant cause of morbidity and mortality worldwide. In addition to the public health concerns, pneumonia also accounts for a significant cost to the health care system. Currently there are two leading vaccines targeted against Streptococcus pneumoniae: 23-valent pneumococcal polysaccharide vaccine (PPSV23 and 13-valent pneumococcal conjugate vaccine (PCV13. Until recently, the recommendation for adult pneumonia vaccination has been a single dose of PPSV23 for all adults aged 65 years or older. However, concerns were raised regarding the vaccine’s efficacy due to the persistent burden of pneumococcal disease in the elderly population. This paper focuses on two trials that evaluated the safety and efficacy of PCV13 in the adult population. The first study reveals improved immune response with the addition of PCV13 to PPSV23, while the second shows PCV13 was effective in the prevention of vaccine-type community-acquired pneumonia. Both studies observed adequate safety profiles for PCV13 in series with PPSV23 and with PCV13 compared to placebo.

Structuring a cost-effective site characterization

International Nuclear Information System (INIS)

Berven, B.A.; Little, C.A.; Swaja, R.E.

1990-01-01

Successful chemical and radiological site characterizations are complex activities which require meticulously detailed planning. Each layer of investigation is based upon previously generated information about the site. Baseline historical, physical, geological, and regulatory information is prerequisite for preliminary studies at a site. Preliminary studies then provide samples and measurements which define the identity of potential contaminants and define boundaries around the area to be investigated. The goal of a full site characterization is to accurately determine the extent and magnitude of contaminants and carefully define the site conditions such that the future movements of site contaminants can be assessed for potential exposure to human occupants and/or environmental impacts. Critical to this process is the selection of appropriate measurement and sampling methodology, selection and use of appropriate instrumentation and management/interpretation of site information. Site investigations require optimization between the need of information to maximize the understanding of site conditions and the cost of acquiring that information. 5 refs., 1 tab

Phlebitis risk varies by peripheral venous catheter site and increases after 96 hours: a large multi-centre prospective study.

Science.gov (United States)

Cicolini, Giancarlo; Manzoli, Lamberto; Simonetti, Valentina; Flacco, Maria Elena; Comparcini, Dania; Capasso, Lorenzo; Di Baldassarre, Angela; Eltaji Elfarouki, Ghaleb

2014-11-01

This multi-centre prospective field study evaluated whether peripheral venous catheter site of insertion influences the risk of catheter-related phlebitis. Potential predictors of phlebitis were also investigated. Millions of patients worldwide use peripheral venous catheters, which frequently cause local complications including phlebitis, infection and obstruction. Although phlebitis predictors have been broadly investigated, uncertainties remain on the potential effect of cannulation anatomical site, duration and the appropriate time for catheter removal. A prospective cohort design was carried out from January-June 2012. The clinical course of each patient who received a new peripheral venous catheter for any cause in five Italian hospitals was followed by trained nurses until catheter removal. The presence of phlebitis was assessed every 24 hours using the Visual Infusion Phlebitis score. Analyses were based upon multilevel mixed-effects regression. The final sample consisted of 1498 patients. The average time for catheters in situ was 65·6 hours and 23·6% of the catheters were in place beyond 96 hours. Overall phlebitis incidence was 15·4%, 94·4% of which were grade 1. The likelihood of phlebitis independently increased with increasing catheter duration, being highest after 96 hours. Compared with patients with catheter placed in the dorsum of the hand (22·8% of the sample), those with the catheter located in the antecubital fossa (34·1%) or forearm were less likely to have a phlebitis of any grade. Antecubital fossa and forearm veins may be preferential sites for peripheral venous cannulation. Our results support Centers for Disease Control and Prevention recommendations to replace catheters in adults no later than 96 hours. A relevant proportion of healthcare personnel did not adhere to such guidelines - more attention to this issue is required. © 2014 John Wiley & Sons Ltd.

Study on natural breeding sites of sand flies (Diptera: Phlebotominae) in areas of Leishmania transmission in Colombia.

Science.gov (United States)

Vivero, Rafael José; Torres-Gutierrez, Carolina; Bejarano, Eduar E; Peña, Horacio Cadena; Estrada, Luis Gregorio; Florez, Fernando; Ortega, Edgar; Aparicio, Yamileth; Muskus, Carlos E

2015-02-22

The location of the microhabitats where immature phlebotomine sand flies of the genus Lutzomyia develop is one of the least-known aspects of this group of medically important insects. For this reason strategies of source reduction approach for their control have not been possible in contrast to other insect vectors (such as mosquitoes), because their juvenile stages in terrestrial microhabitats is difficult to detect. Direct examination of soil samples, incubation of substrates and the use of emergence traps were the methods used to identify juvenile stages in 160 soil samples from urban and forest habitats within the foci of Leishmania transmission in Colombia. Immatures collected were identified subsequent from the rearing and emergence of adults using taxonomic keys or the analysis of the mitochondrial marker cytochrome oxidase I. Plant species associated with the natural breeding sites were identified and physicochemical properties of the soils were analyzed. A total of 38 (23.7%) sampling sites were identified as breeding sites, 142 phlebotomine sand flies were identified, belonging to 13 species of the genus Lutzomyia and two of Brumptomyia. The greatest numbers of immature were found within the tabular roots (51 immature sand flies from eight positive sites) and bases of trees (35 immature sand flies from 11 sites). The characterization and presence of the tree species (mainly Ceiba pentadra, Anacardium excelsum, Pseudosamanea guachapale) and the physicochemical properties (relative humidity and carbon/nitrogen ratio) of the soils associated with these breeding sites are significant factors in explaining the diversity and abundance of phlebotomine sand flies. Immature phlebotomine sand flies of the genus Lutzomyia in Colombia can be found in a wide variety of breeding sites rich in organic matter, high relative humidity and are associated with a typical vegetation of each locality. These results provide new perspectives for the study of the ecology of the

Incorporating cumulative effects into environmental assessments of mariculture: Limitations and failures of current siting methods

International Nuclear Information System (INIS)

King, Sarah C.; Pushchak, Ronald

2008-01-01

Assessing and evaluating the cumulative impacts of multiple marine aquaculture facilities has proved difficult in environmental assessment. A retrospective review of 23 existing mariculture farms in southwestern New Brunswick was conducted to determine whether cumulative interactions would have justified site approvals. Based on current scientific evidence of cumulative effects, six new criteria were added to a set of far-field impacts and other existing criteria were expanded to include regional and cumulative environmental impacts in Hargrave's [Hargrave BT. A traffic light decision system for marine finfish aquaculture siting. Ocean Coast Manag 2002; 45:215-35.] Traffic Light Decision Support System (DSS) presently used in Canadian aquaculture environmental assessments. Before mitigation, 19 of the 23 sites failed the amended set of criteria and after considering mitigation, 8 sites failed. Site and ecosystem indices yielded varying site acceptability scores; however, many sites would not have been approved if siting decisions had been made within a regional management framework and cumulative impact criteria were considered in the site evaluation process

A Case Study of a School Science Department: A Site for Workplace Learning?

OpenAIRE

Heighes, Deborah Anne

2017-01-01

This descriptive and illuminative case study of one science department in a successful, urban, secondary school in the south of England considers the science department as a site of workplace learning and the experience of beginning teachers in this context. Policy change in initial teacher training (ITT) has given schools a major role in the recruitment of trainees and emphasized the schools’ role in their training. Additionally, there continue to be significant challenges to recruit science...

Using a site-specific technical error to establish training responsiveness: a preliminary explorative study.

Science.gov (United States)

Weatherwax, Ryan M; Harris, Nigel K; Kilding, Andrew E; Dalleck, Lance C

2018-01-01

Even though cardiorespiratory fitness (CRF) training elicits numerous health benefits, not all individuals have positive training responses following a structured CRF intervention. It has been suggested that the technical error (TE), a combination of biological variability and measurement error, should be used to establish specific training responsiveness criteria to gain further insight on the effectiveness of the training program. To date, most training interventions use an absolute change or a TE from previous findings, which do not take into consideration the training site and equipment used to establish training outcomes or the specific cohort being evaluated. The purpose of this investigation was to retrospectively analyze training responsiveness of two CRF training interventions using two common criteria and a site-specific TE. Sixteen men and women completed two maximal graded exercise tests and verification bouts to identify maximal oxygen consumption (VO 2 max) and establish a site-specific TE. The TE was then used to retrospectively analyze training responsiveness in comparison to commonly used criteria: percent change of >0% and >+5.6% in VO 2 max. The TE was found to be 7.7% for relative VO 2 max. χ 2 testing showed significant differences in all training criteria for each intervention and pooled data from both interventions, except between %Δ >0 and %Δ >+7.7% in one of the investigations. Training nonresponsiveness ranged from 11.5% to 34.6%. Findings from the present study support the utility of site-specific TE criterion to quantify training responsiveness. A similar methodology of establishing a site-specific and even cohort specific TE should be considered to establish when true cardiorespiratory training adaptations occur.

Investigation of Y6Mn23 and YMn12 intermetallic alloys under high hydrogen pressure

Science.gov (United States)

Filipek, S. M.; Sato, R.; Kuriyama, N.; Tanaka, H.; Takeichi, N.

2010-03-01

Among three intermetallic compounds existing in Y-Mn system the YMn2 and Y6Mn23 can easily form interstitial hydrides while for YMn12 existence of hydride has never been reported. At moderate hydrogen pressure YMn2 and Y6Mn23 transform into YMn2H4.5 and Y6Mn23H25 respectively. At high hydrogen pressure the YMn2 (C15 or C14 parent structure) forms a unique YMn2H6 (s.g. Fm3m) complex hydride of fluorite structure in which one Mn atom Mn(1) and Y randomly occupy the 8c sites while second manganese (Mn2) in position 4a forms complex anion with 6 hydrogen atoms located in positions 24e. Formation of YMn2H6 independently of the structure of parent phase (C14 or C15) as well as occupation of the same site (8c) by Y and Mn(1) atoms suggested that also Y6Mn23 and YMn12 could transform into YMn2H6 - type hydride in which suitable number of Y atoms will be substituted by Mn(1) in the 8c positions. This assumption was confirmed by exposing R6Mn23 and RMn12 to 1 GPa of hydrogen pressure at 1000C. Formation of (RxMn2-x)MnH6 (where x = 18/29 or 3/13 for R6Mn23 and RMn12 hydrides respectively) was confirmed by XRD. Hydrogen concentration in both R6Mn23 and RMn12 based hydrides reached H/Me = 2 thus value two times higher than in R6Mn23H25.

Site Study Plan for salt, Deaf Smith County site, Texas: Environmental Field Program: Preliminary draft

International Nuclear Information System (INIS)

1987-06-01

The Salt Site Study Plan (SSP) describes a program for characterizing the existing salt environment in the site vicinity. A step-by-step approach is described which proceeds from published data and planned theoretical studies, to planned laboratory studies, and finally to planned field studies, to provide the necessary data to meet program requirements contained in the Salt Repository Project - Requirements Document (SRP-RD). The plan also draws on the results of other SSP's for certain data; for example, soil salinity data are to be provided under the Soils SSP. The salt studies consist of evaluation of control and mitigation measures, salt monitoring studies, emission factors development, air models development and validation, and risk assessment. For each study, its design and design rationale; analysis, management, and use of data; schedule of activities; organization of personnel and sample management; and quality assurance requirements are described. 90 refs., 9 figs., 7 tabs

Site qualification studies of the UCG-SDB at North Knobs, Wyoming

Energy Technology Data Exchange (ETDEWEB)

Davis, B.E.; Krajewski, S.A.; Ahner, P.F.; Avasthi, J.M.; Dolde, M.E.; Greenman, C.A.; Miranda, J.E.

1979-01-01

The site qualification program for the North Knobs UCG site near Rawlins, Wyoming has been completed. This site will be the location for the field tests of Underground Coal Gasification of Steeply Dipping Beds undertaken by Gulf Research and Development Company for DOE in a cost shared contract. Site characterization included a comprehensive geotechnical analysis along with vegetation, historical, and archeological studies. The G coal seam chosen for these tests is a subbituminous B coal with a true seam thickness of 22 feet and has thin coal benches above and below the main seam. The water table is at 90 feet below the surface. Hydrologic studies have defined the seam as an aquiclude (non-aquifer). The site is deemed restorable to regulatory requirements. Evaluation of this site indicates total acceptability for the three-test program planned by GR and DC.

Diffusion, capture and recycling of SCAR/WAVE and Arp2/3 complexes observed in cells by single-molecule imaging

Science.gov (United States)

Millius, Arthur; Watanabe, Naoki; Weiner, Orion D.

2012-01-01

The SCAR/WAVE complex drives lamellipodium formation by enhancing actin nucleation by the Arp2/3 complex. Phosphoinositides and Rac activate the SCAR/WAVE complex, but how SCAR/WAVE and Arp2/3 complexes converge at sites of nucleation is unknown. We analyzed the single-molecule dynamics of WAVE2 and p40 (subunits of the SCAR/WAVE and Arp2/3 complexes, respectively) in XTC cells. We observed lateral diffusion of both proteins and captured the transition of p40 from diffusion to network incorporation. These results suggest that a diffusive 2D search facilitates binding of the Arp2/3 complex to actin filaments necessary for nucleation. After nucleation, the Arp2/3 complex integrates into the actin network and undergoes retrograde flow, which results in its broad distribution throughout the lamellipodium. By contrast, the SCAR/WAVE complex is more restricted to the cell periphery. However, with single-molecule imaging, we also observed WAVE2 molecules undergoing retrograde motion. WAVE2 and p40 have nearly identical speeds, lifetimes and sites of network incorporation. Inhibition of actin retrograde flow does not prevent WAVE2 association and disassociation with the membrane but does inhibit WAVE2 removal from the actin cortex. Our results suggest that membrane binding and diffusion expedites the recruitment of nucleation factors to a nucleation site independent of actin assembly, but after network incorporation, ongoing actin polymerization facilitates recycling of SCAR/WAVE and Arp2/3 complexes. PMID:22349699

High Production of 2,3-Butanediol (2,3-BD by Raoultella ornithinolytica B6 via Optimizing Fermentation Conditions and Overexpressing 2,3-BD Synthesis Genes.

Directory of Open Access Journals (Sweden)

Taeyeon Kim

Full Text Available Biological production of 2,3-butandiol (2,3-BD has received great attention as an alternative to the petroleum-based 2,3-BD production. In this study, a high production of 2,3-BD in fed-batch fermentation was investigated with a newly isolated bacterium designated as Raoultella ornithinolytica B6. The isolate produced 2,3-BD as the main product using hexoses (glucose, galactose, and fructose, pentose (xylose and disaccharide (sucrose. The effects of temperature, pH-control schemes, and agitation speeds on 2,3-BD production were explored to optimize the fermentation conditions. Notably, cell growth and 2,3-BD production by R. ornithinolytica B6 were higher at 25°C than at 30°C. When three pH control schemes (no pH control, pH control at 7, and pH control at 5.5 after the pH was decreased to 5.5 during fermentation were tested, the best 2,3-BD titer and productivity along with reduced by-product formation were achieved with pH control at 5.5. Among different agitation speeds (300, 400, and 500 rpm, the optimum agitation speed was 400 rpm with 2,3-BD titer of 68.27 g/L, but acetic acid was accumulated up to 23.32 g/L. Further enhancement of the 2,3-BD titer (112.19 g/L, yield (0.38 g/g, and productivity (1.35 g/L/h as well as a significant reduction of acetic acid accumulation (9.71 g/L was achieved by the overexpression of homologous budABC genes, the 2,3-BD-synthesis genes involved in the conversion of pyruvate to 2,3-BD. This is the first report presenting a high 2,3-BD production by R.ornithinolytica which has attracted little attention with respect to 2,3-BD production, extending the microbial spectrum of 2,3-BD producers.

30 CFR 282.23 - Testing Plan.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Testing Plan. 282.23 Section 282.23 Mineral... § 282.23 Testing Plan. All testing activities shall be conducted in accordance with a Testing Plan... detailed Mining Plan than is obtainable under an approved Delineation Plan, to prepare feasibility studies...

Closure Report for Corrective Action Unit 465: Hydronuclear Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Mark Burmeister and Patrick Matthews

2012-11-01

The corrective action sites (CASs) within CAU 465 are located within Areas 6 and 27 of the NNSS. CAU 465 comprises the following CASs: • 00-23-01, Hydronuclear Experiment, located in Area 27 of the NNSS and known as the Charlie site. • 00-23-02, Hydronuclear Experiment, located in Area 27 of the NNSS and known as the Dog site. • 00-23-03, Hydronuclear Experiment, located in Area 27 of the NNSS and known as the Charlie Prime and Anja sites. • 06-99-01, Hydronuclear, located in Area 6 of the NNSS and known as the Trailer 13 site. The purpose of this CR is to provide documentation supporting the completed corrective actions and provide data confirming that the closure objectives for CASs within CAU 465 were met. From September 2011 through July 2012, closure activities were performed as set forth in the Streamlined Approach for Environmental Restoration Plan for CAU 465: Hydronuclear, Nevada National Security Site, Nevada.

Hand fractures: A study of their site and type in childhood

International Nuclear Information System (INIS)

Rajesh, Arumugam; Basu, Avi K.; Vaidhyanath, Ramachandran; Finlay, David

2001-01-01

AIM: The purpose of the study was to document the site and type of fractures of the hand in children up to 16 years of age. MATERIALS AND METHODS: The radiographs of 280 children who were found to have a fracture in Accident and Emergency over a one-year period were reviewed. A total of 293 fractures of the hand and 3 distal interphalangeal joint dislocations without fracture were identified. There were 293 fractures as some children had more than one fracture. RESULTS: Distal tuft fractures were commonest in the 0 to 4-year age-group; fractures of distal phalanx (both transverse and tuft) in the 5 to 8-year age-group; transverse fractures of the proximal phalanx of little finger in the 9 to 12-year age-group and transverse fractures of neck of the fifth metacarpal in the 13 to 16-year age-groups. CONCLUSION: Hand fractures are more common in older children, with a male preponderance in most groups except in the 0-4 age-group. The site of injury is different in the various corresponding age-groups, reflecting the differing mechanisms of injury. The management of hand fractures rely on a correct diagnosis and a knowledge of their common site in each age-group should aid diagnosis. Rajesh, A. et al. (2001)

Development of a magnetic resonance sensor for on-line monitoring of 99Tc and 23Na in tank waste cleanup processes: Final report and implementation plan

International Nuclear Information System (INIS)

Dieckman, S. L.; Jendrzejczyk, J. A.; Raptis, A. C.

2000-01-01

In response to US Department of Energy (DOE) requirements for advanced cross-cutting technologies, Argonne National Laboratory is developing an on-line sensor system for the real-time monitoring of 99 Tc and 23 Na in various locations throughout radioactive-waste processing facilities. Based on nuclear magnetic resonance spectroscopy, the highly automated sensor system can provide near-real-time response with minimal sampling. The technology, in the form of a flow-through nuclear-magnetic-resonance-based on-line process sensing and control system, can rapidly monitor 99 Tc speciation and concentration (from 0.1 molar to 10 micro molar) in the feedstocks and eluents of radioactive-waste treatment processes. The system is nonintrusive, capable of withstanding harsh plant environments, and reasonably immune to contaminants. Furthermore, the system is capable of operating over large variations in pH, conductivity, and salinity. This document describes design parameters, results from sensitivity studies, and initial results obtained from oxidation-reduction studies that were conducted on technetium standards and waste specimens obtained from DOE's Hanford site. A cursory investigation of the system's capabilities to monitor 23 Na at high concentrations are also reported, as are descriptions of site requirements, implementation recommendations, and testing techniques

The conformation of 23S rRNA nucleotide A2058 determines its recognition by the ErmE methyltransferase

DEFF Research Database (Denmark)

Vester, B; Hansen, L H; Douthwaite, S

1995-01-01

the effects of mutations around position A2058 on methylation. Mutagenizing A2058 (to G or U) completely abolishes methylation of 23S rRNA by ErmE. No methylation occurred at other sites in the rRNA, demonstrating the fidelity of ErmE for A2058. Breaking the neighboring G2057-C2611 Watson-Crick base pair...... by introducing either an A2057 or a U2611 mutation, greatly reduces the rate of methylation at A2058. Methylation remains impaired after these mutations have been combined to create a new A2057-U2611 Watson-Crick base interaction. The conformation of this region in 23S rRNA was probed with chemical reagents...

A splice site mutation in a gene encoding for PDK4, a mitochondrial protein, is associated with the development of dilated cardiomyopathy in the Doberman pinscher.

Science.gov (United States)

Meurs, Kathryn M; Lahmers, Sunshine; Keene, Bruce W; White, Stephen N; Oyama, Mark A; Mauceli, Evan; Lindblad-Toh, Kerstin

2012-08-01

Familial dilated cardiomyopathy is a primary myocardial disease that can result in the development of congestive heart failure and sudden cardiac death. Spontaneous animal models of familial dilated cardiomyopathy exist and the Doberman pinscher dog is one of the most commonly reported canine breeds. The objective of this study was to evaluate familial dilated cardiomyopathy in the Doberman pinscher dog using a genome-wide association study for a genetic alteration(s) associated with the development of this disease in this canine model. Genome-wide association analysis identified an area of statistical significance on canine chromosome 14 (p(raw) = 9.999e-05 corrected for genome-wide significance), fine-mapping of additional SNPs flanking this region localized a signal to 23,774,190-23,781,919 (p = 0.001) and DNA sequencing identified a 16-base pair deletion in the 5' donor splice site of intron 10 of the pyruvate dehydrogenase kinase 4 gene in affected dogs (p dilation, marked pleomorphic mitochondrial alterations with megamitochondria, scattered mitochondria with whorling and vacuolization and mild aggregates of lipofuscin granules. In conclusion, we report the identification of a splice site deletion in the PDK4 gene that is associated with the development of familial dilated cardiomyopathy in the Doberman pinscher dog.

Site investigations for final disposal of high-level nuclear waste

International Nuclear Information System (INIS)

Aeikaes, T.; Laine, T.

1982-12-01

Research concerning disposal of high-level nuclear waste of the Industrial Power Company Ltd has focused on deep underground disposal in Finnish precambrian bedrock. The present target is to have a repository for high-level waste in operation by 2020. Selection of the repository site is based on site investigations. In addition to geosciences, selection of appropriate site includes many branches of studies; engineering, safety analysis, ecology, transport, demography etc. The investigations required for site selection for high-level waste have been arranged in a sequence of four phases. The aim of the phases is that investigations become more and more detailed as the selection process continues. Phase I of the investigations is the characterization of potential areas. This comprises establishment of criteria for site selection and identification of areas that meet selection criteria. Objective of these studies is to determine areas for phase II field investigations. The studies are largely made by reviewing existing data and remote-sensing techniques. Phase II field investigations will be undertaken between 1986-1992. The number of potential candidates for repository site is reduced to few preferred areas by preceeding generic study. The site selection process culminates in phase III in site confirmation studies carried out at 2...3 most suitable sites during 1992-2010. This is then followed by phase IV, which comprises very detailed investigations at the selected site. An alternative for these investigations is to undertake them by using pilot shaft and drifts. Active development is taking place in all phases concerning investigation methods, criteria, parameters, data processing and modelling. The applicability of the various investigation methods and techniques is tested in a deep borehole in phase I. The co-operation with countries with similar geological conditions makes it possible to compare results obtained by different techniques

Char-recirculation biomass gasification system--a site-specific feasibility study

International Nuclear Information System (INIS)

Purdy, K.R.; Kerr, C.P.; Hensley, B.D.

1991-01-01

A site-specific feasibility study was conducted for a char-recirculation biomass gasification plant which would dispose of the chippable solid residues of the area sawmills. The plant would receive green hardwood chips and convert them into active charcoal while producing process steam and electrical power. An economic analysis was performed on the basis of not-for-profit operation, marketing crushed active charcoal to a broker at a discounted price, and displacing purchased electric power. Given a market for the active charcoal, the plant was judged to be economically viable

SUPERFUND TREATABILITY CLEARINGHOUSE: SOIL STABILIZATION PILOT STUDY, UNITED CHROME NPL SITE PILOT STUDY AND HEALTH AND SAFETY PROGRAM, UNITED CHROME NPL SITE PILOT STUDY

Science.gov (United States)

This document is a project plan for a pilot study at the United Chrome NPL site, Corvallis, Oregon and includes the health and safety and quality assurance/quality control plans. The plan reports results of a bench-scale study of the treatment process as iieasured by the ...

78 FR 26356 - Notice of Environmental Site Review

Science.gov (United States)

2013-05-06

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Notice of Environmental Site Review York Haven Power Company, LLC Project No. 1888-030. Exelon Generation Company, LLC Project No. 405-106. Exelon Generation Company, LLC Project No. 2355-018. On May 21, 22, and 23, 2013, Commission staff will hold an environmental site review for the...

Archaeometric studies on the Hatahara archaeological site

International Nuclear Information System (INIS)

Nunes, Kelly Placa

2009-01-01

The reconstruction of the past and the understanding of historical and cultural aspects of societies that developed at archaeological sites have been enabled by archaeometric studies undertaken on ceramics located at these areas. This study aims to be a contribution to the elucidation of these aspects with the application of three physical methods of analysis: neutron activation analysis (NAA), thermoluminescence dating (TL) an electronic paramagnetic resonance (EPR) to ceramic fragments from the Hatahara archaeological site, located at central Amazon. The elemental concentrations obtained by NAA for 120 ceramic fragments were interpreted by means of cluster analysis and discriminant analysis. The results showed the existence of five distinct ceramic groups. This information, supported by archaeological interpretation, confirm the existence of four distinct occupation Phases at Hatahara site. In order to establish a chronology for the occupations, the ages of three ceramic fragments were determined by TL. The dating of two fragments did not confirm the archaeological interpretation about their occupation Phases. However, the dating of the third fragment allowed the confirmation that it belongs to the Manacapuru Phase. The determination of the burning temperatures of four ceramic fragments was performed by EPR. It was observed that although the analyzed ceramic samples belong to three distinct groups, there was no significant variation on their burning temperatures. (author)

49 CFR 1103.23 - Confidences of a client.

Science.gov (United States)

2010-10-01

... 49 Transportation 8 2010-10-01 2010-10-01 false Confidences of a client. 1103.23 Section 1103.23... Responsibilities Toward A Client § 1103.23 Confidences of a client. (a) The practitioner's duty to preserve his client's confidence outlasts the practitioner's employment by the client, and this duty extends to the...

Feasibility Study of Economics and Performance of Solar Photovoltaics at the Price Landfill Site in Pleasantville, New Jersey. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

Energy Technology Data Exchange (ETDEWEB)

Salasovich, J.; Geiger, J.; Mosey, G.; Healey, V.

2013-05-01

The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Price Landfill site in Pleasantville, New Jersey, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site. This study did not assess environmental conditions at the site.

Feasibility Study of Economics and Performance of Solar Photovoltaics at the Tower Road Site in Aurora, Colorado. A Study Prepared in Partnership with the Environmental Protection Agency for the RE-Powering America's Land Initiative: Siting Renewable Energy on Potentially Contaminated Land and Mine Sites

Energy Technology Data Exchange (ETDEWEB)

Van Geet, O.; Mosey, G.

2013-03-01

The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Tower Road site in Aurora, Colorado, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site. This study did not assess environmental conditions at the site.

A multi-site study on medical school selection, performance, motivation and engagement

NARCIS (Netherlands)

Wouters, A.; Croiset, G.; Schripsema, N. R.; Cohen-Schotanus, J.; Spaai, G. W. G.; Hulsman, R. L.; Kusurkar, R. A.

Medical schools seek ways to improve their admissions strategies, since the available methods prove to be suboptimal for selecting the best and most motivated students. In this multi-site cross-sectional questionnaire study, we examined the value of (different) selection procedures compared to a

Contaminated site investigation using nuclear technique: a case study of temporary transformer storage sites in Ghana

International Nuclear Information System (INIS)

Sanu, J. K.

2013-07-01

2000DX PCB/ Chloride analyser and Instrumentatal Neutron Activation Analysis (INAA) to analyse extractable organochloriine from the soil samples indicated that the nuclear technique is a better analytical technique for contaminated site investigation due to its high sensitivity, selectivity, fast and non-destructive nature. The INAA and gamma spectroscopy using HPGe detector coupled with MAESTRO 32 software provided a fast and efficient way to analyse possible PCB contamination in the soil samples and therefore proved to be very reliable method that could be conveniently used for contaminated site investigation. (au)

Synthesis, biological evaluation and docking studies of 2,3-dihydroquinazolin-4(1H)-one derivatives as inhibitors of cholinesterases.

Science.gov (United States)

Sarfraz, Muhammad; Sultana, Nargis; Rashid, Umer; Akram, Muhammad Safwan; Sadiq, Abdul; Tariq, Muhammad Ilyas

2017-02-01

In search of potent inhibitors of cholinesterases, we have synthesized and evaluate a number of 2,3-dihydroquinazolin-4(1H)-one derivatives. The synthetic approach provided an efficient synthesis of the target molecules with excellent yield. All the tested compounds showed activity against both the enzymes in micromolar range. In many case, the inhibition of both enzymes are higher than or comparable to the standard drug galatamine. With the selectivity index of 2.3 for AChE, compound 5f can be considered as a potential lead compound with a feature of dual AChE/BChE inhibition with IC 50 =1.6±0.10μM (AChE) and 3.7±0.18μM (BChE). Binding modes of the synthesized compounds were explored by using GOLD (Genetic Optimization for Ligand Docking) suit v5.4.1. The computed binding modes of these compounds in the active site of AChE and BChE provide an insight into the mechanism of inhibition of these two enzyme. Copyright © 2017 Elsevier Inc. All rights reserved.

Bioaccumulation of polychlorinated biphenyls in ranid frogs and northern water snakes from a hazardous waste site and a contaminated watershed.

Science.gov (United States)

Fontenot, L W; Noble, G P; Akins, J M; Stephens, M D; Cobb, G P

2000-04-01

Livers of bullfrogs (Rana catesbeiana) from a polychlorinated biphenyl (PCB) contaminated watershed and hazardous waste site located in Pickens County, South Carolina, contained significantly higher concentrations of PCBs (2.33 and 2.26 ppm, respectively) than those from a reference site (0.05 ppm). Green frogs (R. clamitans) from the two contaminated sites also accumulated higher levels of PCBs (2.37 and 3.88 ppm, respectively) than those from the reference site (0.02 ppm). No temporal variation was observed in PCB concentrations of bullfrogs or green frogs from the contaminated sites between 1992 and 1993. Levels of PCBs in the livers of northern water snakes (Nerodia sipedon) were significantly higher in snakes from the contaminated watershed (13.70 ppm) than in those from the waste site (2.29 ppm) and two reference sites (2.50 and 1.23 ppm). When compared to frogs, significantly higher bioaccumulation occurred in water snakes from the contaminated watershed. No significant differences in PCB levels were found with respect to sex or body size (snout-vent length (SVL) or body mass) for frogs or snakes. PCBs were detected also in eggs of both frogs and snakes. Results of this study provide baseline data and document the bioaccumulation of PCB residues in frog and snake tissues; however, the significance of these tissue residues to reproduction, survival, growth/development, and population dynamics in contaminated habitats is unknown.

Grohnde. Documentation of the police operation during the demonstration against the NPP Grohnde on 19.03.1977 and the evacuation of the occupied cooling tower site on 23.08.1977

International Nuclear Information System (INIS)

Stricker, Michael

2014-01-01

The documentation of the police operation during the demonstration against the NPP Grohnde on 16.03.1977 and the evacuation of the occupied cooling tower site on 23.08.1977 covers the following issues: involved action forces: police Niedersachsen, police Nordrhein-Westfalen, police Schleswig-Holstein, police Bremen and the Bundesgrenzschutz; concept of the police operation, provisions (lodging and board) for the police, operating resources, details of the operation sequence; post-processing of the operation; the Grohnde trials.

Status report on geochemical field results from Atlantic study sites

International Nuclear Information System (INIS)

Wilson, T.R.S.; Thomson, J.; Hydes, D.J.; Colley, S.

1983-01-01

This report summarises the results of preliminary geochemical investigations at three North Atlantic study areas. The two eastern sites, on the Cape Verde abyssal plain (CV2) and east of Great Meteor Seamount (GME) were visited during 1982. The results presented are preliminary. Studies in the western Atlantic, close to the Nares Abyssal Plain study site are more detailed and are presented in a separate paper. The report shows for the first time the relative redox status of the three sites. The differences are unexpectedly large, the most reduced cores being recovered at GME and the most oxidised at CV2. The sporadic nature of Recent sediment accumulation at these sites is also emphasised. In order to place these preliminary results in context their relevance to the production of mathematical system models is discussed in a closing section. The necessity for such models to rest on sound foundations of geochemical understanding is noted. Suggestions on future research priorities are offered for discussion. (author)

Study on Site Conditions Based on Topographic Slope

Science.gov (United States)

Wu, X.; Wang, X.; Yuan, X.; Chen, M.; Dou, A.

2018-04-01

The travel-time averaged shear-wave velocity to a depth of 30m (Vs30) below the Earth's surface is widely used to classify sites in many building codes. Vs30 is also used to estimate site classification in recent ground-motion prediction equations (GMPEs), and the distribution of Vs30 has been mapped in a region or country. An alternative method has recently been proposed for evaluating global seismic site conditions or Vs30, from the SRTM (Shuttle Radar Topography Mission) DEMs (digital elevation models). The basic premise of the method is that the topographic slope can be used as a reliable proxy for Vs30 in the absence of geologically and geotechnically based site-condition maps through correlations between Vs30 measurements and topographic gradient. Here, we use different resolutions (3 arcsec, 30 arcsec) DEM data to get Vs30 data separately, analyze and compare the difference of Vs30 data and site conditions obtained from different resolution DEM data. Shandong Province in eastern China and Sichuan Province in Western China are studied respectively. It is found that the higher resolution data is better at defining spatial topographic features than the 30c data, but less improvement in its correlation with Vs30.

STUDY ON SITE CONDITIONS BASED ON TOPOGRAPHIC SLOPE

Directory of Open Access Journals (Sweden)

X. Wu

2018-04-01

Full Text Available The travel-time averaged shear-wave velocity to a depth of 30m (Vs30 below the Earth’s surface is widely used to classify sites in many building codes. Vs30 is also used to estimate site classification in recent ground-motion prediction equations (GMPEs, and the distribution of Vs30 has been mapped in a region or country. An alternative method has recently been proposed for evaluating global seismic site conditions or Vs30, from the SRTM (Shuttle Radar Topography Mission DEMs (digital elevation models. The basic premise of the method is that the topographic slope can be used as a reliable proxy for Vs30 in the absence of geologically and geotechnically based site-condition maps through correlations between Vs30 measurements and topographic gradient. Here, we use different resolutions (3 arcsec, 30 arcsec DEM data to get Vs30 data separately, analyze and compare the difference of Vs30 data and site conditions obtained from different resolution DEM data. Shandong Province in eastern China and Sichuan Province in Western China are studied respectively. It is found that the higher resolution data is better at defining spatial topographic features than the 30c data, but less improvement in its correlation with Vs30.

Pedestrian and motorists' actions at pedestrian hybrid beacon sites: findings from a pilot study.

Science.gov (United States)

Pulugurtha, Srinivas S; Self, Debbie R

2015-01-01

This paper focuses on an analysis of pedestrian and motorists' actions at sites with pedestrian hybrid beacons and assesses their effectiveness in improving the safety of pedestrians. Descriptive and statistical analyses (one-tail two-sample T-test and two-proportion Z-test) were conducted using field data collected during morning and evening peak hours at three study sites in the city of Charlotte, NC, before and after the installation of pedestrian hybrid beacons. Further, an analysis was conducted to assess the change in pedestrian and motorists' actions over time (before the installation; 1 month, 3 months, 6 months, and 12 months after the installation). Results showed an increase in average traffic speed at one of the pedestrian hybrid beacon sites while no specific trends were observed at the other two pedestrian hybrid beacon sites. A decrease in the number of motorists not yielding to pedestrians, pedestrians trapped in the middle of the street, and pedestrian-vehicle conflicts were observed at all the three pedestrian hybrid beacon sites. The installation of pedestrian hybrid beacons did not have a negative effect on pedestrian actions at two out of the three sites. Improvements seem to be relatively more consistent 3 months after the installation of the pedestrian hybrid beacon.

Value engineering study for seletion of verticle barrier technology at a Superfund site

International Nuclear Information System (INIS)

Bryan, E.E.; Guglielmetti, J.L.; Butler, P.B.; Brill, M.P.

1997-01-01

A value engineering (VE) study was conducted to identify and evaluate vertical barrier technologies and alignments for a Superfund project in New Castle County, Delaware. The objective was to select and recommend the most appropriate vertical barrier(s) for two separate landfills and a portion of the manufacturing plant on the site. A VE team was assembled to identify and evaluate site specific issues related to effectiveness, constructability and cost for numerous vertical barrier technologies. Several cost-effective alternatives were identified that met project objectives. The VE study concluded that a composite vertical barrier system consisting of a soil-bentonite slurry trench and steel sheet piles would provide effective containment of the North Landfill. Additionally, the geologic confining unit specified in the Record of Decision (ROD) was found to be unsuitable as a vertical barrier key and a more suitable, shallow confining unit was discovered. This paper describes the value engineering process and results of the VE study for one of the landfills

Energy-conserving site-design case study, Radisson, New York. Final report

Energy Technology Data Exchange (ETDEWEB)

1979-12-01

Radisson is a 2,950-acre new community currently being developed by the New York State Urban Development Corporation and located in central New York, 12 miles north-west of Syracuse. Case-study sites selected for this project are a 95-acre residential site and the 51-acre Town Center of the new community. Development on the Residential Site is a low-density (2.8 dwelling units/acre) mixture of single-family, townhouse and multi-family units. Development on the Town Center site is a mixture of small-scale commercial use (144,000 sq. ft.) and 330+ multi-family dwelling units. Energy-conserving plans developed for both sites have focused on passive measures to reduce energy use for space heating. Utility-system options have been identified for both sites, but require further study as to feasibility and cost. This report summarizes energy savings and cost differentials due to passive measures incorporated in both the residential and Town Center Plans. The future implementation schedule, also discussed, summarizes the procedures an schedule required for implementation of the passive measures, as well as further study required for the development of utility-system options. 4 tables.