International Nuclear Information System (INIS)
Boehlecke, Robert F.
2004-01-01
This Corrective Action Investigation Plan (CAIP) contains project-specific information for conducting site investigation activities at Corrective Action Unit (CAU) 554: Area 23 Release Site, Nevada Test Site, Nevada. Information presented in this CAIP includes facility descriptions, environmental sample collection objectives, and criteria for the selection and evaluation of environmental samples. Corrective Action Unit 554 is located in Area 23 of the Nevada Test Site, which is 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 554 is comprised of one Corrective Action Site (CAS), which is: 23-02-08, USTs 23-115-1, 2, 3/Spill 530-90-002. This site consists of soil contamination resulting from a fuel release from underground storage tanks (USTs). Corrective Action Site 23-02-08 is being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives. Additional information will be obtained by conducting a corrective action investigation prior to evaluating corrective action alternatives and selecting the appropriate corrective action for this CAS. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document for CAU 554. Corrective Action Site 23-02-08 will be investigated based on the data quality objectives (DQOs) developed on July 15, 2004, by representatives of the Nevada Division of Environmental Protection; U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office; and contractor personnel. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 554. Appendix A provides a detailed discussion of the DQO methodology and the DQOs specific to CAS 23-02-08. The scope of the corrective action investigation
Energy Technology Data Exchange (ETDEWEB)
A. T. Urbon
2003-07-01
This Closure Report (CR) documents the activities performed to close Corrective Action Unit (CAU) 330: Areas 6, 22, and 23 Tanks and Spill Sites, in accordance with the Federal Facility Agreement and Consent Order (FFACO of 1996), and the Nevada Division of Environmental Protection (NDEP)-approved Streamlined Approach for Environmental Restoration (SAFER) Plan for CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites, Nevada Test Site (NTS), Nevada (U.S. Department of Energy, National Nuclear Security Administration Nevada Operation Office [NNSA/NV], 2001). CAU 330 consists of the following four Corrective Action Sites (CASs): 06-02-04, 22-99-06, 23-01-02, and 23-25-05 (Figure 1).
2010-10-01
... Service Corps site's reimbursement obligation to the Federal Government be waived? 23.10 Section 23.10... National Health Service Corps site's reimbursement obligation to the Federal Government be waived? (a) The Secretary may waive in whole or in part the reimbursement requirements of section 334(a)(3) of the Act if he...
Hb taradale [beta82(EF6)Lys-->Arg]: a novel mutation at a 2,3-diphosphoglycerate binding site.
Brennan, Stephen O; Sheen, Campbell; Chan, Tim; George, Peter M
2005-01-01
Hb Taradale [beta82(EF6)Lys-->Arg] was initially detected as a split Hb A0 peak on Hb A1c, monitoring. Red cell parameters, hemoglobin (Hb) electrophoresis and stability tests were normal. Mass spectrometry (ms) clearly identified a variant beta chain with a mass increase of 28 Da and peptide mapping located the mutation site to peptide betaT-9. DNA sequencing confirmed the presence of a novel beta82(EF6)Lys-->Arg mutation. This conservative substitution at a 2,3-diphosphoglycerate (2,3-DPG) binding site did not, however, appear to affect the P50 for oxygen binding.
Pomponi, Massimo; Bertonati, Claudia; Patamia, Maria; Marta, Maurizio; Derocher, Andrew E; Lydersen, Christian; Kovacs, Kit M; Wiig, Oystein; Bårdgard, Astrid J
2002-11-01
Polar bear (Ursus maritimus) hemoglobin (Hb) shows a low response to 2,3-diphosphoglycerate (2,3-DPG), compared to human Hb A0, even though these proteins have the same 2,3-DPG-binding site. In addition, polar bear Hb shows a high response to chloride and an alkaline Bohr effect (deltalog P50/deltapH) that is significantly greater than that of human Hb A0. The difference in sequence Pro (Hb A0)-->Gly (polar bear Hb) at position A2 in the A helix seems to be critical for reduced binding of 2,3-DPG. Our results also show that the A2 position may influence not only the flexibility of the A helix, but that differences in flexibility of the first turn of the A helix may affect the unloading of oxygen for the intrinsic ligand affinities of the alpha and beta chains. However, preferential binding to either chain can only take place if there is appreciable asymmetric binding of the phosphoric effector. Regarding this point, 31P NMR data suggest a loss of symmetry of the 2,3-DPG-binding site in the deoxyHb-2,3-DPG complex.
Energy Technology Data Exchange (ETDEWEB)
T. M. Fitzmaurice
2001-08-01
This Streamlined Approach for Environmental restoration (SAFER) plan addresses the action necessary for the closure of Corrective Action Unit (CAU) 330, Areas 6,22, and 23 Tanks and Spill Sites. The CAUs are currently listed in Appendix III of the Federal Facility Agreement and Consent Order (FFACO). This CAU is located at the Nevada Test Site (NTS) (Figure 1). CAU 330 consists of the following Corrective Action Sites (CASs): (1) CAS 06-02-04 - Consists of an underground tank and piping. This CAS is close to an area that was part of the Animal Investigation Program (AIP), conducted under the U.S. Public Health Service. Its purpose was to study and perform tests on the cattle and wild animals in and around the NTS that were exposed to radionuclides. It is unknown if this tank was part of these operations. (2) CAS 22-99-06 - Is a fuel spill that is believed to be a waste oil release which occurred when Camp Desert Rock was an active facility. This CAS was originally identified as being a small depression where liquids were poured onto the ground, located on the west side of Building T-1001. This building has been identified as housing a fire station, radio station, and radio net remote and telephone switchboard. (3) CAS 23-01-02 - Is a large aboveground storage tank (AST) farm that was constructed to provide gasoline and diesel storage in Area 23. The site consists of two ASTs, a concrete foundation, a surrounding earthen berm, associated piping, and unloading stations. (4) CAS 23-25-05 - Consists of an asphalt oil spill/tar release that contains a wash covered with asphalt oil/tar material, a half buried 208-liter (L) (55-gallon [gal]) drum, rebar, and concrete located in the vicinity.
One-site versus two-site phacotrabeculectomy: a prospective randomized study
Directory of Open Access Journals (Sweden)
Moschos MM
2015-08-01
Full Text Available Marilita M Moschos,1 Irini P Chatziralli,2 Michael Tsatsos3 1First Department of Ophthalmology, University of Athens, 2Second Department of Ophthalmology, Ophthalmiatrion Athinon, Athens, Greece; 3Department of Ophthalmology, Cambridge University Hospital NHS, Cambridge, UK Purpose: The purpose of this study is to compare the efficacy and safety of one-site and two-site combined phacotrabeculectomy with foldable posterior chamber intraocular lens implantation.Methods: Thirty-four patients (41 eyes with glaucoma and cataract were randomly assigned to undergo either a one-site (22 eyes or a two-site (19 eyes combined procedure. One-site approach consisted of a standard superior phacotrabeculectomy with a limbus-based conjunctival flap, while two-site approach consisted of a clear cornea phacoemulsification and a separate superior trabeculectomy with a limbus-based conjunctival flap.Results: Mean follow-up period was 54 months (standard deviation [SD] 2.3. Mean preoperative intraocular pressure (IOP in the one-site group was 21.3 mmHg (SD 2.8 and in the two-site group was 21.8 mmHg (SD 3.0 (P>0.1. Mean postoperative IOP significantly decreased in both groups compared to the preoperative level and was 15.6 mmHg (SD 3.5 in the one-site group and 14.9 mmHg (SD 2.7 in the two-site group. Three months later, the difference between the two groups was not statistically significant (P=0.058. The one-site group required significantly more medications than the two-site group (P=0.03. Best-corrected visual acuity (BCVA improved similarly in both groups, but there was less postoperative (induced astigmatism in the two-site group in a marginal statistical level (P=0.058. Intra- and postoperative complications were comparable in the two groups.Conclusion: Both techniques yielded similar results concerning final BCVA and IOP reduction. However, the two-site group had less induced astigmatism and a better postoperative IOP control with less required
International Nuclear Information System (INIS)
T. M. Fitzmaurice
2001-01-01
This Streamlined Approach for Environmental restoration (SAFER) plan addresses the action necessary for the closure of Corrective Action Unit (CAU) 330, Areas 6,22, and 23 Tanks and Spill Sites. The CAUs are currently listed in Appendix III of the Federal Facility Agreement and Consent Order (FFACO). This CAU is located at the Nevada Test Site (NTS) (Figure 1). CAU 330 consists of the following Corrective Action Sites (CASs): (1) CAS 06-02-04 - Consists of an underground tank and piping. This CAS is close to an area that was part of the Animal Investigation Program (AIP), conducted under the U.S. Public Health Service. Its purpose was to study and perform tests on the cattle and wild animals in and around the NTS that were exposed to radionuclides. It is unknown if this tank was part of these operations. (2) CAS 22-99-06 - Is a fuel spill that is believed to be a waste oil release which occurred when Camp Desert Rock was an active facility. This CAS was originally identified as being a small depression where liquids were poured onto the ground, located on the west side of Building T-1001. This building has been identified as housing a fire station, radio station, and radio net remote and telephone switchboard. (3) CAS 23-01-02 - Is a large aboveground storage tank (AST) farm that was constructed to provide gasoline and diesel storage in Area 23. The site consists of two ASTs, a concrete foundation, a surrounding earthen berm, associated piping, and unloading stations. (4) CAS 23-25-05 - Consists of an asphalt oil spill/tar release that contains a wash covered with asphalt oil/tar material, a half buried 208-liter (L) (55-gallon[gal]) drum, rebar, and concrete located in the vicinity
2,3-DPG-Hb complex: a hypothesis for an asymmetric binding.
Pomponi, M; Bertonati, C; Fuglei, E; Wiig, O; Derocher, A E
2000-05-15
This study was undertaken to test the symmetry of 2,3-diphosphoglycerate (2,3-DPG) binding site in hemoglobin (Hb). From Arnone's study [A. Arnone, Nature (London) 237 (1972) 146] the 2,3-DPG binding site is located at the top of the cavity, that runs through the center of the deoxy-Hb molecule. However, it is possible that this symmetry reported by Arnone, for crystals of 2,3-DPG-Hb complex, might not be conserved in solution. In this paper, we report the 31P nuclear magnetic resonances of the 2,3-DPG interaction with Hb. The 2,3-DPG chemical shifts of the P2 and P3 resonance are both pH- and hemoglobin-dependent [protein from man, polar bear (Ursus maritimus), Arctic fox (Alopex lagopus) and bovine]. 2,3-DPG binds tightly to deoxyhemoglobin and weakly, nevertheless significantly, to oxyhemoglobin. In particular, our results suggest similar spatial position of the binding site of 2,3-DPG in both forms of Hb in solutions. However, the most unexpected result was the apparent loss of symmetry in the binding site, which might correlate with the ability of the hemoglobin to modulate its functional behavior. The different interactions of the phosphate groups indicate small differences in the quaternary structure of the different deoxy forms of hemoglobin. Given the above structural perturbation an asymmetric binding in the complex could justify, at least in part, different physiological properties of Hb. Regardless, functionally relevant effects of 2,3-DPG seem to be measured and best elucidated through solution studies.
International Nuclear Information System (INIS)
1998-04-01
The underground storage tank (UST) release site 23-111-1 is located in Mercury, Nevada. The site is in Area 23 of the Nevada Test Site, (NTS) located on the north side of Building 111. The tank associated with the release was closed in place using cement grout on September 6, 1990. The tank was not closed by removal due to numerous active underground utilities, a high-voltage transformer pad, and overhead power lines. Soil samples collected below the tank bottom at the time of tank closure activities exceeded the Nevada Administrative Code Action Level of 100 milligrams per kilogram (mg/kg) for petroleum hydrocarbons. Maximum concentrations detected were 119 mg/kg. Two passive venting wells were subsequently installed at the tank ends to monitor the progress of biodegradation at the site. Quarterly air sampling from the wells was completed for approximately one year, but was discontinued since data indicated that considerable biodegradation was not occurring at the site
Interaction between LSD and dopamine D2/3 binding sites in pig brain.
Minuzzi, Luciano; Nomikos, George G; Wade, Mark R; Jensen, Svend B; Olsen, Aage K; Cumming, Paul
2005-06-15
The psychoactive properties of the hallucinogen LSD have frequently been attributed to high affinity interactions with serotonin 5HT2 receptors in brain. Possible effects of LSD on dopamine D2/3 receptor availability have not previously been investigated in living brain. Therefore, we used PET to map the binding potential (pB) of [11C]raclopride in brain of three pigs, first in a baseline condition, and again at 1 and 4 h after administration of LSD (2.5 microg/kg, i.v.). There was a progressive treatment effect in striatum, where the pB was significantly reduced by 19% at 4 h after LSD administration. Concomitant maps of cerebral blood flow did not reveal significant changes in perfusion during this interval. Subsequent in vitro studies showed that LSD displaced [3H]raclopride (2 nM) from pig brain cryostat sections with an IC50 of 275 nM according to a one-site model. Fitting of a two-site model to the data suggested the presence of a component of the displacement curves with a subnanomolar IC50, comprising 20% of the total [3H]raclopride binding. In microdialysis experiments, LSD at similar and higher doses did not evoke changes in the interstitial concentration of dopamine or its acidic metabolites in rat striatum. Together, these results are consistent with a direct interaction between LSD and a portion of dopamine D2/3 receptors in pig brain, possibly contributing to the psychopharmacology of LSD. (c) 2005 Wiley-Liss, Inc.
Alvarez, Ronald D; Huh, Warner K; Bae, Sejong; Lamb, Lawrence S; Conner, Michael G; Boyer, Jean; Wang, Chenguang; Hung, Chien-Fu; Sauter, Elizabeth; Paradis, Mihaela; Adams, Emily A; Hester, Shirley; Jackson, Bradford E; Wu, T C; Trimble, Cornelia L
2016-02-01
The purpose of this study was to evaluate the safety, efficacy, and immunogenicity of a plasmid vaccine, pNGVL4a-CRT-E7(detox), administered either intradermally, intramuscularly, or directly into the cervical lesion, in patients with HPV16-associated CIN2/3. Eligible patients with HPV16(+) CIN2/3 were enrolled in treatment cohorts evaluating pNGVL4a-CRT-E7(detox), administered by either particle-mediated epidermal delivery (PMED), intramuscular injection (IM), or cervical intralesional injection, at study weeks 0, 4, and 8. Patients were monitored for local injection site and systemic toxicity. A standard therapeutic resection was performed at week 15. The primary endpoints were safety and tolerability. Secondary endpoints included histologic regression and change in cervical HPV viral load. Exploratory endpoints included immune responses in the blood and in the target tissue. Thirty-two patients with HPV16(+) CIN2/3 were enrolled onto the treatment phase of the study, and were vaccinated. Twenty-two of 32 patients (69%) experienced vaccine-specific related adverse events. The most frequent vaccine-related events were constitutional and local injection site in nature, and were grade 1 or less in severity. Histologic regression to CIN 1 or less occurred in 8 of 27 (30%) patients who received all vaccinations and underwent LEEP. In subject-matched comparisons, intraepithelial CD8+ T cell infiltrates increased after vaccination in subjects in the intralesional administration cohort. pNGVL4a-CRT-E7(detox) was well-tolerated, elicited the most robust immune response when administered intralesionally, and demonstrated preliminary evidence of potential clinical efficacy. Copyright © 2015 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Lewis-Ballester, Ariel; Pham, Khoa N.; Batabyal, Dipanwita; Karkashon, Shay; Bonanno, Jeffrey B.; Poulos, Thomas L.; Yeh, Syun-Ru (Einstein); (UCI)
2017-11-22
Human indoleamine 2,3-dioxygenase 1 (hIDO1) is an attractive cancer immunotherapeutic target owing to its role in promoting tumoral immune escape. However, drug development has been hindered by limited structural information. Here, we report the crystal structures of hIDO1 in complex with its substrate, Trp, an inhibitor, epacadostat, and/or an effector, indole ethanol (IDE). The data reveal structural features of the active site (Sa) critical for substrate activation; in addition, they disclose a new inhibitor-binding mode and a distinct small molecule binding site (Si). Structure-guided mutation of a critical residue, F270, to glycine perturbs the Si site, allowing structural determination of an inhibitory complex, where both the Sa and Si sites are occupied by Trp. The Si site offers a novel target site for allosteric inhibitors and a molecular explanation for the previously baffling substrate-inhibition behavior of the enzyme. Taken together, the data open exciting new avenues for structure-based drug design.
International Nuclear Information System (INIS)
1997-03-01
This plan presents the strategy for the characterization of Corrective Action Unit 94, Area 23, Building 650 Leachfield. It is a land disposal unit, located southeast of Building 650, that was in operation from 1965 to October 1992, with an estimated annual discharge rate of less than 984 liters from designated sinks, floor drains, and emergency decontamination showers in Building 650. The objectives of the planned activities are to: obtain sufficient sample analytical data from which further assessment, remediation, and/or closure strategies may be developed for the site: and obtain sufficient sample analytical data for management of investigation-derived waste (IDW). All references to regulations in this plan are to the versions of the regulations that are current at the time of publication of this plan. The scope of the characterization will include subsurface soil boring (i.e., drilling), in situ sampling of the soil within subsurface soil borings, and sample analysis for both site characterization and waste management purposes
Sugihara, J; Imamura, T; Nagafuchi, S; Bonaventura, J; Bonaventura, C; Cashon, R
1985-09-01
We encountered an abnormal hemoglobin (Rahere), with a threonine residue replacing the beta 82 (EF6) lysine residue at the binding site of 2,3-diphosphoglycerate, which was responsible for overt erythrocytosis in two individuals of a Japanese family. Hemoglobin Rahere shows a lower oxygen affinity on the binding of 2,3-diphosphoglycerate or chloride ions than hemoglobin A. Although a decrease in the positive charge density at the binding sites of 2,3-diphosphoglycerate in hemoglobin Rahere apparently shifts the allosteric equilibrium toward the low affinity state, it greatly diminishes the cofactor effects by anions. The oxygen affinity of the patient's erythrocytes is substantially lowered by the presence of bezafibrate, which combines with sites different from those of 2,3-diphosphoglycerate in either hemoglobin Rahere or hemoglobin A.
Sugihara, J; Imamura, T; Nagafuchi, S; Bonaventura, J; Bonaventura, C; Cashon, R
1985-01-01
We encountered an abnormal hemoglobin (Rahere), with a threonine residue replacing the beta 82 (EF6) lysine residue at the binding site of 2,3-diphosphoglycerate, which was responsible for overt erythrocytosis in two individuals of a Japanese family. Hemoglobin Rahere shows a lower oxygen affinity on the binding of 2,3-diphosphoglycerate or chloride ions than hemoglobin A. Although a decrease in the positive charge density at the binding sites of 2,3-diphosphoglycerate in hemoglobin Rahere ap...
Energy Technology Data Exchange (ETDEWEB)
Thoden, James B.; Holden, Hazel M. (UW)
2010-09-08
2,3-Diacetamido-2,3-dideoxy-D-mannuronic acid (ManNAc3NAcA) is an unusual dideoxy sugar first identified nearly 30 years ago in the lipopolysaccharide of Pseudomonas aeruginosa O:3a,d. It has since been observed in other organisms, including Bordetella pertussis, the causative agent of whooping cough. Five enzymes are required for the biosynthesis of UDP-ManNAc3NAcA starting from UDP-N-acetyl-D-glucosamine. Here we describe a structural study of WlbA, the NAD-dependent dehydrogenase that catalyzes the second step in the pathway, namely, the oxidation of the C-3{prime} hydroxyl group on the UDP-linked sugar to a keto moiety and the reduction of NAD{sup +} to NADH. This enzyme has been shown to use {alpha}-ketoglutarate as an oxidant to regenerate the oxidized dinucleotide. For this investigation, three different crystal structures were determined: the enzyme with bound NAD(H), the enzyme in a complex with NAD(H) and {alpha}-ketoglutarate, and the enzyme in a complex with NAD(H) and its substrate (UDP-N-acetyl-D-glucosaminuronic acid). The tetrameric enzyme assumes an unusual quaternary structure with the dinucleotides positioned quite closely to one another. Both {alpha}-ketoglutarate and the UDP-linked sugar bind in the WlbA active site with their carbon atoms (C-2 and C-3{prime}, respectively) abutting the re face of the cofactor. They are positioned {approx}3 {angstrom} from the nicotinamide C-4. The UDP-linked sugar substrate adopts a highly unusual curved conformation when bound in the WlbA active site cleft. Lys 101 and His 185 most likely play key roles in catalysis.
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-03-01
This Corrective Action Investigation Plan (CAIP) has been developed in accordance with the Federal Facility Agreement and Consent Order (FFACO) that was agreed to by the US Department of Energy, Nevada Operations Office (DOE/NV); the State of Nevada Division of Environmental Protection (NDEP); and the US Department of Defense (FFACO, 1996). The CAIP is a document that provides or references all of the specific information for investigation activities associated with Corrective Action Units (CAUs) or Corrective Action Sites (CASs). According to the FFACO, CASs are sites potentially requiring corrective action(s) and may include solid waste management units or individual disposal or release sites (FFACO, 1996). Corrective Action Units consist of one or more CASs grouped together based on geography, technical similarity, or agency responsibility for the purpose of determining corrective actions. This CAIP contains the environmental sample collection objectives and the criteria for conducting site investigation activities at CAU 342, the Area 23 Mercury Fire Training Pit (FTP), which is located in Area 23 at the Nevada Test Site (NTS). The NTS is approximately 88 km (55 mi) northwest of Las Vegas, Nevada. Corrective Action Unit 342 is comprised of CAS 23-56-01. The FTP is an area approximately 100 m by 140 m (350 ft by 450 ft) located west of the town of Mercury, Nevada, which was used between approximately 1965 and 1990 to train fire-fighting personnel (REECo, 1991; Jacobson, 1991). The surface and subsurface soils in the FTP have likely been impacted by hydrocarbons and other contaminants of potential concern (COPC) associated with burn activities and training exercises in the area.
DEFF Research Database (Denmark)
Schjoldager, Katrine Ter-Borch Gram; Vester-Christensen, Malene B.; Goth, Christoffer K.
2011-01-01
Site-specific GalNAc-type O-glycosylation is emerging as an important co-regulator of proprotein convertase (PC) processing of proteins. PC processing is crucial in regulating many fundamental biological pathways and O-glycans in or immediately adjacent to processing sites may affect recognition...... and function of PCs. Thus, we previously demonstrated that deficiency in site-specific O-glycosylation in a PC site of the fibroblast growth factor, FGF23, resulted in marked reduction in secretion of active unprocessed FGF23, which cause familial tumoral calcinosis and hyperostosis hyperphosphatemia. GalNAc......-type O-glycosylation is found on serine and threonine amino acids and up to 20 distinct polypeptide GalNAc transferases catalyze the first addition of GalNAc to proteins making this step the most complex and differentially regulated steps in protein glycosylation. There is no reliable prediction model...
DEFF Research Database (Denmark)
Dam, M; Douthwaite, S; Tenson, T
1996-01-01
Mutations in domain II of Escherichia coli 23 S rRNA that cause resistance to erythromycin do so in a manner fundamentally different from mutations at the drug binding site in domain V of the 23 S rRNA. The domain II mutations are located in a hairpin structure between nucleotides 1198 and 1247...... this hypothesis, a range of point mutations was generated in domain II of 23 S rRNA in the vicinity of the E-peptide open reading frame. We find a correlation between erythromycin resistance of the mutant clones and increased accessibility of the ribosome binding site of the E-peptide gene. Furthermore......, the erythromycin resistance determinant in the mutants was shown to be confined to a small 23 S rRNA segment containing the coding region and the ribosome binding site of the E-peptide open reading frame. It thus appears that the domain II mutations mediate erythromycin resistance by increasing expression...
Closure Report for Corrective Action Unit 107: Low Impact Soil Sites, Nevada Test Site, Nevada
International Nuclear Information System (INIS)
2009-01-01
Corrective Action Unit (CAU) 107 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Low Impact Soil Sites' and consists of the following 15 Corrective Action Sites (CASs), located in Areas 1, 2, 3, 4, 5, 9, 10, and 18 of the Nevada Test Site: CAS 01-23-02, Atmospheric Test Site - High Alt; CAS 02-23-02, Contaminated Areas (2); CAS 02-23-03, Contaminated Berm; CAS 02-23-10, Gourd-Amber Contamination Area; CAS 02-23-11, Sappho Contamination Area; CAS 02-23-12, Scuttle Contamination Area; CAS 03-23-24, Seaweed B Contamination Area; CAS 03-23-27, Adze Contamination Area; CAS 03-23-28, Manzanas Contamination Area; CAS 03-23-29, Truchas-Chamisal Contamination Area; CAS 04-23-02, Atmospheric Test Site T4-a; CAS 05-23-06, Atmospheric Test Site; CAS 09-23-06, Mound of Contaminated Soil; CAS 10-23-04, Atmospheric Test Site M-10; and CAS 18-23-02, U-18d Crater (Sulky). Closure activities were conducted from February through April 2009 according to the FFACO (1996; as amended February 2008) and Revision 1 of the Streamlined Approach for Environmental Restoration Plan for CAU 107 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2009). The corrective action alternatives included No Further Action and Closure in Place with Administrative Controls. Closure activities are summarized.
Cheng, Y; Lin, H; Xue, D; Li, R; Wang, K
2001-02-14
The changes in structure and function of 2,3-diphosphoglycerate-hemoglobin (2,3-DPG-Hb) induced by Ln(3+) binding were studied by spectroscopic methods. The binding of lanthanide cations to 2,3-DPG is prior to that to Hb. Ln(3+) binding causes the hydrolysis of either one from the two phosphomonoester bonds in 2,3-DPG non-specifically. The results using the ultrafiltration method indicate that Ln(3+) binding sites for Hb can be classified into three categories: i.e. positive cooperative sites (N(I)), non-cooperative strong sites (N(S)) and non-cooperative weak sites (N(W)) with binding constants in decreasing order: K(I)>K(S)>K(W). The total number of binding sites amounts to about 65 per Hb tetramer. Information on reaction kinetics was obtained from the change of intrinsic fluorescence in Hb monitored by stopped-flow fluorometry. Fluctuation of fluorescence dependent on Ln(3+) concentration and temperature was observed and can be attributed to the successive conformational changes induced by Ln(3+) binding. The results also reveal the bidirectional changes of the oxygen affinity of Hb in the dependence on Ln(3+) concentration. At the range of [Ln(3+)]/[Hb]<2, the marked increase of oxygen affinity (P(50) decrease) with the Ln(3+) concentration can be attributed to the hydrolysis of 2,3-DPG, while the slight rebound of oxygen affinity in higher Ln(3+) concentration can be interpreted by the transition to the T-state of the Hb tetramer induced by Ln(3+) binding. This was indicated by the changes in secondary structure characterized by the decrease of alpha-helix content.
International Nuclear Information System (INIS)
1998-01-01
Corrective Action Unit (CAU) Number 94, Building 650 Leachfield, is an historic laboratory disposal unit located in Area 23 at the Nevada Test Site (NTS) in Nye County, Nevada. The objectives of this project were twofold: characterize subsurface conditions at the CAU with respect to the on-site disposal unit, and provide sufficient information to develop a closure strategy for the leachfield. To this end, subsurface sampling was conducted in the vicinity of the piping above the distribution box, under and around the distribution box, and within the leachfield
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-01-27
Corrective Action Unit (CAU) Number 94, Building 650 Leachfield, is an historic laboratory disposal unit located in Area 23 at the Nevada Test Site (NTS) in Nye County, Nevada. The objectives of this project were twofold: characterize subsurface conditions at the CAU with respect to the on-site disposal unit, and provide sufficient information to develop a closure strategy for the leachfield. To this end, subsurface sampling was conducted in the vicinity of the piping above the distribution box, under and around the distribution box, and within the leachfield.
International Nuclear Information System (INIS)
Berry, H.A.
1981-08-01
This report describes the operations and radiological activities conducted during Phase II and Phase III of the Gnome site decontamination and decommissioning (D/D) project in Carlsbad, New Mexico. The onsite radiological monitoring and documentation activities were performed for the Department of Energy, Nevada Operations (DOE/NV) by Reynolds Electrical and Engineering Co., Inc. (REECo) and EG and G, Inc., from March 28, 1979 to September 23, 1979. The monitoring program included soil sampling and analyses, portable instrument area surveys, thermoluminescent dosimeter (TLD) measurements and a post-operational aerial survey to document the final site status and to insure public and occupational health and safety. Although the analysis of data gathered during the final stages of the D/D project will provide the information necessary for DOE to return the Gnome site to the Department of the Interior, Bureau of Land Management (BLM) for unrestricted use of the land surface, there are permanent restrictions on excavation and/or drilling on the site at any depth between the surface and 1500 feet
International Nuclear Information System (INIS)
Kakiuchi, Takuhiro; Tahara, Masashi; Nagaoka, Shin-ichi; Hashimoto, Shogo; Fujita, Narihiko; Tanaka, Masatoshi; Mase, Kazuhiko
2011-01-01
Valence electronic states of a clean Si(111)-7x7 surface are investigated in a surface-site-selective way using high-resolution coincidence measurements of Si pVV Auger electrons and Si 2p photoelectrons. The Si L 23 VV Auger electron spectra measured in coincidence with energy-selected Si 2p photoelectrons show that the valence band at the highest density of states in the vicinity of the rest atoms is shifted by ∼0.95 eV toward the Fermi level (E F ) relative to that in the vicinity of the pedestal atoms (atoms directly bonded to the adatoms). The valence-band maximum in the vicinity of the rest atoms, on the other hand, is shown to be shifted by ∼0.53 eV toward E F relative to that in the vicinity of the pedestal atoms. The Si 2p photoelectron spectra of Si(111)-7x7 measured in coincidence with energy-selected Si L 23 VV Auger electrons identify the topmost surface components, and suggest that the dimers and the rest atoms are negatively charged while the pedestal atoms are positively charged. Furthermore, the Si 2p-Si L 23 VV photoelectron Auger coincidence spectroscopy directly verifies that the adatom Si 2p component (usually denoted by C 3 ) is correlated with the surface state just below E F (usually denoted by S 1 ), as has been observed in previous angle-resolved photoelectron spectroscopy studies.
International Nuclear Information System (INIS)
1987-08-01
This study identifies and establishes relative guidelines to be used for siting of repository shafts. Weights were determined for the significant factors that impact the selection of shaft locations for a nuclear waste repository in salt. The study identified a total of 45 factors. A panel of experienced mining people utilized the Kepner-Tregoe (K-T) Decision Analysis Process to perform a structured evaluation of each significant shaft siting factor. The evaluation determined that 22 of the factors were absolute constraints and that the other 23 factors were desirable characteristics. The group established the relative weights for each of the 23 desirable characteristics by using a paired comparison method. 8 refs., 2 figs., 5 tabs
Nuclear power plant site selection: a case study
International Nuclear Information System (INIS)
Lugasi, Y.; Mehrez, A.; Sinuany-Stern, Z.
1985-01-01
Selecting the site for a nuclear power plant involves the evaluation of numerous criteria and the professional judgment of various experts. The Israel Atomic Energy Commission has been concerned with the problem of selecting a site for a nuclear power station. Previous studies have been performed by the commission to identify potential sites. There were initial screenings where potential sites were chosen according to various minimal criteria and international standards. Only sites that met all the criteria were chosen. A study was made to find the most preferred site among the potential sites that met all the criteria. Two mathematical approaches were used: Keeney's multiattribute utility function and Saaty's eigenvalue prioritization technique. Both models ranked the same site as the most desirable; however, the models differed in their ranking of the other sites
Rose, A J; Berlowitz, D R; Miller, D R; Hylek, E M; Ozonoff, A; Zhao, S; Reisman, J I; Ash, A S
2012-04-01
Not all clinicians target the same International Normalized Ratio (INR) for patients with a guideline-recommended target range of 2-3. A patient's mean INR value suggests the INR that was actually targeted. We hypothesized that sites would vary by mean INR, and that sites of care with mean values nearest to 2.5 would achieve better anticoagulation control, as measured by per cent time in therapeutic range (TTR). To examine variations among sites in mean INR and the relationship with anticoagulation control in an integrated system of care. We studied 103,897 patients receiving oral anticoagulation with an expected INR target between 2 and 3 at 100 Veterans Health Administration (VA) sites from 1 October 2006 to 30 September 2008. Key site-level variables were: proportion near 2.5 (that is, percentage of patients with mean INR between 2.3 and 2.7) and mean risk-adjusted TTR. Site mean INR ranged from 2.22 to 2.89; proportion near 2.5, from 30 to 64%. Sites' proportions of patients near 2.5, below 2.3 and above 2.7 were consistent from year to year. A 10 percentage point increase in the proportion near 2.5 predicted a 3.8 percentage point increase in risk-adjusted TTR (P < 0.001). Proportion of patients with mean INR near 2.5 is a site-level 'signature' of care and an implicit measure of targeted INR. This proportion varies by site and is strongly associated with site-level TTR. Our study suggests that sites wishing to improve TTR, and thereby improve patient outcomes, should avoid the explicit or implicit pursuit of non-standard INR targets. © 2012 International Society on Thrombosis and Haemostasis.
Observation and simulation of ethane at 23 FTIR sites
Bader, W. M. J.; Mahieu, E.; Franco, B.; Pozzer, A.; Taraborrelli, D.; Prignon, M.; Servais, C. P.; De Maziere, M.; Vigouroux, C.; Mengistu Tsidu, G.; Sufa, G.; Mellqvist, J.; Blumenstock, T.; Hase, F.; Schneider, M.; Sussmann, R.; Nagahama, T.; Sudo, K.; Hannigan, J. W.; Ortega, I.; Morino, I.; Nakajima, H.; Smale, D.; Makarova, M.; Poberovsky, A.; Murata, I.; Grutter de la Mora, M.; Guarin, C. A.; Stremme, W.; Té, Y.; Jeseck, P.; Notholt, J.; Palm, M.; Conway, S. A.; Lutsch, E.; Strong, K.; Griffith, D. W. T.; Jones, N. B.; Paton-Walsh, C.; Friedrich, M.; Smeekes, S.
2017-12-01
Ethane is the most abundant non-methane hydrocarbon (NMHC) in the Earth atmosphere. Its main sources are of anthropogenic origin, with globally 62% from leakage during production and transport of natural gas, 20% from biofuel combustion and 18% from biomass burning. In the Southern hemisphere, anthropogenic emissions are lower which makes biomass burning emissions a more significant source. The main removal process is oxidation by the hydroxyl radical (OH), leading to a mean atmospheric lifetime of 2 months. Until recently, a prolonged decrease of its abundance has been documented, at rates of -1 to -2.7%/yr, with global emissions dropping from 14 to 11 Tg/yr over 1984-2010 owing to successful measures reducing fugitive emissions from its fossil fuel sources. However, subsequent investigations have reported on an upturn in the ethane trend, characterized by a sharp rise from about 2009 onwards. The ethane increase is attributed to the oil and natural gas production boom in North America, although significant changes in OH could also be at play. In the present contribution, we report the trend of ethane at 23 ground-based Fourier Transform Infrared (FTIR) sites spanning the 80ºN to 79ºS latitude range. Over 2010-2015, a significant ethane rise of 3-5%/yr is determined for most sites in the Northern Hemisphere, while for the Southern hemisphere the rates of changes are not significant at the 2-sigma uncertainty level . Dedicated model simulations by EMAC (ECHAM5/MESSy Atmospheric Chemistry; 1.8×1.8 degrees) implementing various emission scenarios are included in order to support data interpretation. The usual underestimation of the NMHCs emissions in the main inventories is confirmed here for RCP85 (Representative Concentration Pathway Database v8.5). Scaling them by 1.5 is needed to capture the background levels of atmospheric ethane. Moreover, additional and significant emissions ( 7 Tg over 2009-2015) are needed to capture the ethane rise in the Northern
Tetragonal Lysozyme Interactions Studied by Site Directed Mutagenesis
Crawford, Lisa; Karr, Laurel J.; Nadarajah, Arunan; Pusey, Marc
1999-01-01
A number of recent experimental and theoretical studies have indicated that tetragonal lysozyme crystal growth proceeds by the addition of aggregates, formed by reversible self association of the solute molecules in the bulk solution. Periodic bond chain and atomic force microscopy studies have indicated that the probable growth unit is at minimum a 43 tetramer, and most likely an octamer composed of two complete turns about the 43 axis. If these results are correct, then there are intermolecular interactions which are only formed in the solution and others only formed at the joining of the growth unit to the crystal surface. We have set out to study these interactions, and the correctness of this hypothesis, using site directed mutagenesis of specific amino acid residues involved in the different bonds. We had initially expressed wild type lysozyme in S. cervasiae with yields of approximately 5 mg/L, which were eventually raised to approximately 40 mg/L. We are now moving the expression to the Pichia system, with anticipated yields of 300 to (3)500 mg/L, comparable to what can be obtained from egg whites. An additional advantage of using recombinant protein is the greater genetic homogeneity of the material obtained and the absence of any other contaminating egg proteins. The first mutation experiments are TYR 23 (Registered) PHE or ALA and ASN 113 (Registered) ALA or ASP. Both TYR 23 and ASN 113 form part of the postulated dimerization intermolecular binding site which lead to the formation of the 43 helix. Tyrosine also participates in an intermolecular hydrogen bond with ARG 114. The results of these and subsequent experiments will be discussed.
A Summary of Rheology Data For SB3 and SB2/3 Blend Simulant Savannah River Site Wastes
International Nuclear Information System (INIS)
KOOPMAN, DAVIDC.
2004-01-01
The purpose of this study was to document the rheological measurements made for Sludge Batch 3 (SB3) and the blend of SB3 with Sludge Batch 2 (SB2). These measurements were primarily made on Slurry Mix Evaporator (SME) products, i.e. melter feeds. Some measurements were made on SB2/3 blend Sludge Receipt and Adjustment Tank (SRAT) products. Measurements on radioactive SB3 and SB2/3 samples have been limited to sludge characterization. SB2/3 measurements studied the impact of changing the SRAT acid addition strategy on the SRAT and SME product rheology. SB2/3 measurements also studied the impact of changing the waste loading target (sludge oxides content in glass) of the SME product. SB3 measurements studied the impact of changes in the wash end point and acid addition strategy on the SME product (melter feed) rheology. A summary of the significant findings is given below: SB3 radioactive sludge and blended SB2/3 radioactive sludge were less viscous than SB2 radioactive sludge. SB2/3 b lend sludge is more viscous than SB3 sludge. SB3 simulant SME product rheology was strongly impacted by changing the noble metal concentrations to more closely match those of the qualification sample. This reduction in noble metals produced a lower pH product that was also considerably less viscous. Increased acid addition in the SB2/3 SRAT generally led to less viscous simulant SRAT products. This trend did not persist in the SME products. SME products became more viscous when increased acid was used in the SRAT cycle from 135 per cent up to 170 per cent of stoichiometry, then became less viscous as total acid was increased further to 185 per cent. A significant increase in hydrogen generation occurred between 170 per cent and 185 per cent. The impact of acid addition on SB3 SME products was also variable. The impact of waste loading changes from 31 to 35 to 40 per cent on SB2/3 simulant SME products led to more viscous melter feeds as waste loading increased at constant wt. per cent
International Nuclear Information System (INIS)
2008-01-01
This Streamlined Approach for Environmental Restoration Plan covers activities associated with Corrective Action Unit (CAU) 107 of the Federal Facility Agreement and Consent Order (FFACO, 1996 (as amended February 2008)). CAU 107 consists of the following Corrective Action Sites (CASs) located in Areas 1, 2, 3, 4, 5, 9, 10, and 18 of the Nevada Test Site. (1) CAS 01-23-02, Atmospheric Test Site - High Alt; (2) CAS 02-23-02, Contaminated Areas (2); (3) CAS 02-23-03, Contaminated Berm; (4) CAS 02-23-10, Gourd-Amber Contamination Area; (5) CAS 02-23-11, Sappho Contamination Area; (6) CAS 02-23-12, Scuttle Contamination Area; (7) CAS 03-23-24, Seaweed B Contamination Area; (8) CAS 03-23-27, Adze Contamination Area; (9) CAS 03-23-28, Manzanas Contamination Area; (10) CAS 03-23-29, Truchas-Chamisal Contamination Area; (11) CAS 04-23-02, Atmospheric Test Site T4-a; (12) CAS 05-23-06, Atmospheric Test Site; (13) CAS 09-23-06, Mound of Contaminated Soil; (14) CAS 10-23-04, Atmospheric Test Site M-10; and (15) CAS 18-23-02, U-18d Crater (Sulky). Based on historical documentation, personnel interviews, site process knowledge, site visits, photographs, engineering drawings, field screening, analytical results, and the results of data quality objectives process (Section 3.0), closure in place with administrative controls or no further action will be implemented for CAU 107. CAU 107 closure activities will consist of verifying that the current postings required under Title 10 Code of Federal Regulations (CFR) Part 835 are in place and implementing use restrictions (URs) at two sites, CAS 03-23-29 and CAS 18-23-02. The current radiological postings combined with the URs are adequate administrative controls to limit site access and worker dose
Human deoxyhaemoglobin-2,3-diphosphoglycerate complex low-salt structure at 2.5 A resolution.
Richard, V; Dodson, G G; Mauguen, Y
1993-09-20
The haemoglobin-2,3-diphosphoglycerate complex structure has been solved at 2.5 A resolution using crystals grown from low-salt solutions. The results show some important differences with the precedent haemoglobin-2,3-diphosphoglycerate high-salt structure solved by Arnone. First, we observe a loss of symmetry in the binding site, secondly both of the lysine residues 82 beta interact with 2,3-diphosphoglycerate at the same time, each making two contacts. This level of interaction is in agreement with the functional behaviour of natural haemoglobin mutants with mutations at the 2,3-diphosphoglycerate binding site.
General siting study 95. Siting of a deep repository for spent nuclear fuel
International Nuclear Information System (INIS)
1995-10-01
General Siting Study 95 is a detailed description of the work carried out to put the siting of a deep repository in a national and regional context. The report is based on SKB's siting factors, which have been applied on a national scale. Different factors of importance or of possible importance for the long-term radiological safety, technology, land and environment as well as society are described and evaluated. This report is the overall description on general siting studies which the government considered that SKB should report in connection with the RD and D Programme 95. 121 refs, 40 figs
General siting study 95. Siting of a deep repository for spent nuclear fuel
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-10-01
General Siting Study 95 is a detailed description of the work carried out to put the siting of a deep repository in a national and regional context. The report is based on SKB`s siting factors, which have been applied on a national scale. Different factors of importance or of possible importance for the long-term radiological safety, technology, land and environment as well as society are described and evaluated. This report is the overall description on general siting studies which the government considered that SKB should report in connection with the RD and D Programme 95. 121 refs, 40 figs.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI
International Nuclear Information System (INIS)
NSTec Environmental Restoration
2006-01-01
This report provides a summary and analysis of visual site inspections and soil gas sampling results for Corrective Action Unit (CAU) 342, Area 23 Mercury Fire Training Pit. CAU 342 is identified in the Federal Facility Agreement and Consent Order of 1996 and consists of Corrective Action Site 23-56-01, Former Mercury Fire Training Pit. This report covers calendar years 2004 and 2005. Visual site inspections were conducted on May 20 and November 14, 2004, and May 17 and November 15, 2005. No significant findings were observed during these inspections. The site was in good condition, and no repair activities were required. Soil gas samples were collected on November 29, 2005, for analysis of volatile organic compounds (VOCs) and semivolatile organic compounds (SVOCs), and samples were collected on December 1, 2005, for analysis of base gases. Base gas concentrations in the monitoring well show a high concentration of carbon dioxide and a low concentration of oxygen, which is an indication of biodegradation of total petroleum hydrocarbons (TPH) in the soil. Results for VOCs and SVOCs are unchanged, with VOCs below or near laboratory method detection limits and no SVOCs detected above laboratory method detection limits. Post-closure monitoring was required for six years after closure of the site. Therefore, since 2005 was the sixth year of monitoring, the effectiveness of natural attenuation of the TPH-impacted soil by biodegradation was evaluated. The base gas concentrations indicate that biodegradation of TPH in the soil is occurring; therefore, it is recommended that monitoring be discontinued. Visual site inspections should continue to be performed biannually to ensure that the signs are in place and readable and that the use restriction has been maintained. The results of the site inspections will be documented in a letter report and submitted annually
International Nuclear Information System (INIS)
2009-01-01
This Streamlined Approach for Environmental Restoration Plan covers activities associated with Corrective Action Unit (CAU) 107 of the Federal Facility Agreement and Consent Order (1996 (as amended February 2008)). CAU 107 consists of the following Corrective Action Sites (CASs) located in Areas 1, 2, 3, 4, 5, 9, 10, and 18 of the Nevada Test Site. (sm b ullet) CAS 01-23-02, Atmospheric Test Site - High Alt(sm b ullet) CAS 02-23-02, Contaminated Areas (2)(sm b ullet) CAS 02-23-03, Contaminated Berm(sm b ullet) CAS 02-23-10, Gourd-Amber Contamination Area(sm b ullet) CAS 02-23-11, Sappho Contamination Area(sm b ullet) CAS 02-23-12, Scuttle Contamination Area(sm b ullet) CAS 03-23-24, Seaweed B Contamination Area(sm b ullet) CAS 03-23-27, Adze Contamination Area(sm b ullet) CAS 03-23-28, Manzanas Contamination Area(sm b ullet) CAS 03-23-29, Truchas-Chamisal Contamination Area(sm b ullet) CAS 04-23-02, Atmospheric Test Site T4-a(sm b ullet) CAS 05-23-06, Atmospheric Test Site(sm b ullet) CAS 09-23-06, Mound of Contaminated Soil(sm b ullet) CAS 10-23-04, Atmospheric Test Site M-10(sm b ullet) CAS 18-23-02, U-18d Crater (Sulky) Based on historical documentation, personnel interviews, site process knowledge, site visits, photographs, engineering drawings, field screening, analytical results, and the results of data quality objectives process (Section 3.0), closure in place with administrative controls or no further action will be implemented for CAU 107.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BR23 (Link to dictyBase) - - - Contig-U15008-1 FC-BR23Z (Li...nk to Original site) - - FC-BR23Z 641 - - - - Show FC-BR23 Library FC (Link to library) Clone ID FC-BR23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR23Q.Seq.d/ Representative seq. ID FC-BR2...3Z (Link to Original site) Representative DNA sequence >FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR23Q.Seq....9 0.0 SLA211 (SLA211Q) /CSM/SL/SLA2-A/SLA211Q.Seq.d/ 1029 0.0 FC-BR23 (FC-BR23Q) /CSM/FC/FC-BR/FC-BR2
International Nuclear Information System (INIS)
Caries, J.C.; Hugon, J.; Grauby, A.
1980-01-01
This methodology consists in an essentially dynamic, estimated and follow-up analysis of the impact of discharges on all the environment compartments, whether natural or not, that play a part in the protection of man and his environment. It applies at two levels, to wit: the choice of site, or the detailed study of the site selected. Two examples of its application will be developed, namely: at the choice of site level in the case of marine sites, and of the detailed study level of the chosen site in that of a riverside site [fr
Characteristics of plant concentration ratios assessed in a 64-site field survey of 23 elements
International Nuclear Information System (INIS)
Sheppard, S.C.; Evenden, W.G.
1990-01-01
Many of the statistical characteristics of plant concentration ratios (CRs) and translocation factors (TFs) have not been critically assessed, especially in field surveys. The statistical characteristics, particularly the measures of variation, are important for stochastic modelling of plant uptake. The CR and TF values for 23 naturally occurring elements throughout the geographic range of one plant species, blueberries (Vaccinium angustifolium), in Canada were surveyed. Although the ratios imply linear relationships, the numerator concentrations were not closely correlated with the denominator concentrations. The variation in the ratios was not clearly related to the means or to characteristics of the elements. The overall geometric standard deviation for CRs was 2.5 and for TFs was 1.6. The values of CR were intercorrelated for certain groups of elements and these groups reflected the periodic classification of elements. Thus, correlation between elements in stochastic models, which may reduce overall variability, is valid. Site variables such as soil pH, soil bulk density, soil fertility and plant growth condition were only slightly useful in statistically explaining some of the variation in CR values. (author)
Study of site layout in the Rokkasho site
International Nuclear Information System (INIS)
Sato, Kazuyoshi; Tamura, Kousaku; Yagenji, Akira; Sekiya, Shigeki; Takahashi, Hideo; Neyatani, Yuzuru; Uehara, Masaharu; Motohashi, Keiichi; Hashimoto, Masayoshi; Ogino, Shunji; Nagamatsu, Nobuhide
2006-03-01
The Final Design Report (FDR) of the International Thermonuclear Experimental Reactor (ITER) was published on July 2001 as a summary of the Engineering Design Activity (EDA). After the EDA, site dependent design has been investigated for the invitation of ITER toward Rokkasho Site (Iyasakadai area) in Aomori prefecture. This report describes the results of site layout of major buildings and structures of ITER in the Rokkasho-Site. The data of the ground near the site and the results of site dependent design in Japan were applied to this study. Through this study, the most appropriate site layout has been constructed with satisfaction of following conditions. (1) Bedrock level at the tokamak complex building is relatively high and it can be reduced the cost of excavation and foundation work. (2) Total amount of excavation soil for site preparation is minimized and the flexibility of the layout is ensured with flat ground level. (3) Accessibility of human and equipments, reduction of noise and vibration to the environment can be obtained. Total length of ducts and piping between buildings in site is minimized. (author)
Energy Technology Data Exchange (ETDEWEB)
Patrick Matthews
2012-10-01
CAU 104 comprises the following corrective action sites (CASs): • 07-23-03, Atmospheric Test Site T-7C • 07-23-04, Atmospheric Test Site T7-1 • 07-23-05, Atmospheric Test Site • 07-23-06, Atmospheric Test Site T7-5a • 07-23-07, Atmospheric Test Site - Dog (T-S) • 07-23-08, Atmospheric Test Site - Baker (T-S) • 07-23-09, Atmospheric Test Site - Charlie (T-S) • 07-23-10, Atmospheric Test Site - Dixie • 07-23-11, Atmospheric Test Site - Dixie • 07-23-12, Atmospheric Test Site - Charlie (Bus) • 07-23-13, Atmospheric Test Site - Baker (Buster) • 07-23-14, Atmospheric Test Site - Ruth • 07-23-15, Atmospheric Test Site T7-4 • 07-23-16, Atmospheric Test Site B7-b • 07-23-17, Atmospheric Test Site - Climax These 15 CASs include releases from 30 atmospheric tests conducted in the approximately 1 square mile of CAU 104. Because releases associated with the CASs included in this CAU overlap and are not separate and distinguishable, these CASs are addressed jointly at the CAU level. The purpose of this CADD/CAP is to evaluate potential corrective action alternatives (CAAs), provide the rationale for the selection of recommended CAAs, and provide the plan for implementation of the recommended CAA for CAU 104. Corrective action investigation (CAI) activities were performed from October 4, 2011, through May 3, 2012, as set forth in the CAU 104 Corrective Action Investigation Plan.
Studies on the intracellular localization of hHR23B
International Nuclear Information System (INIS)
Katiyar, Samiksha; Lennarz, William J.
2005-01-01
Yeast Rad23, originally identified as a DNA repair protein, has been proposed to participate in other cellular functions, i.e., the proteasome-degradation pathway, the process of spindle pole body duplication and as a component of the anaphase checkpoint. Two human homologs of yeast Rad23, hHR23A and hHR23B, exhibit high sequence homology with yRad23 and also have been shown to be involved in DNA repair and proteasome-dependent degradation. Previous studies on the intracellular localization of hHR23A and hHR23B revealed their predominant localization in the nucleus during interphase and in the cytoplasm during mitosis. We have analyzed the localization of hHR23B during all the phases of the cell cycle using immunofluorescence. Unlike previous studies, our results suggest localization of hHR23B in the nucleus as well as in the cytoplasm during G1 phase. The nuclear levels of hHR23B decrease during S-phase of the cell cycle. When the cell enters mitosis, hHR23B relocalizes in the cytoplasm without association with chromatin. These results indicate that the intracellular distribution hHR23B is cell cycle dependent
Herlyn, Philipp K E; Cornelius, Norina; Haffner, Dieter; Zaage, Franziska; Kasch, Cornelius; Schober, Hans-Christof; Mittlmeier, Thomas; Fischer, Dagmar-C
2016-01-01
This cross-sectional observational cohort study was designed to simultaneously investigate bone microarchitecture and serum markers of bone metabolism in elderly osteoporotic patients experiencing a trochanteric or femoral neck fracture. Special emphasis was put on renal function, sclerostin and fibroblast growth factor-23 (FGF-23). Eighty-two patients (median age: 84 years; 49 trochanteric fractures) scheduled for emergency surgery due to an osteoporotic fracture participated. Bone specimens for ex vivo microcomputed X-ray tomography were sampled during surgery. Blood samples for laboratory workup were collected before surgery (t0) and 1 day afterward (t1). Fifty-eight patients consented to dual-energy X-ray absorptiometry scanning of the lumbar spine and/or contralateral femoral neck after recovery during the in-patient stay. Samples were grouped according to the site of fracture. Regression coefficients were controlled for age and/or estimated glomerular filtration rate (eGFR), if appropriate. Patients experiencing a femoral neck fracture presented with better preserved renal function (eGFR) and lower C-terminal fragment of fibroblast growth factor-23 (cFGF-23) concentrations compared to those with trochanteric fractures. By contrast, serum sclerostin was similar at both time points and did not differ between groups. Age-adjusted correlation analysis revealed negative associations between eGFR and cFGF-23 determined at t1 (R=-0.34; ptrochanteric and femoral neck fractures, respectively. Our study provides evidence that not only an age-related decline of renal function but also the type of skeletal injury may contribute to the circulating concentrations of cFGF-23. Copyright © 2016 The International Society for Clinical Densitometry. Published by Elsevier Inc. All rights reserved.
Socioeconomic Site Study Plan: Draft
International Nuclear Information System (INIS)
1987-07-01
Social and economic issues and concerns of the Deak Smith County site area will be evaluated during site characterization. Effects that the area could experience from a repository project include demographic, economic, community service, fiscal, and social impacts. The Socioeconomic Site Study Plan is designed to provide a strategy to assess the potential for those impacts. The Socioeconomic Site Study Plan is structured to provide an overview of the socioeconomic program requirements, objectives, and activities to be conducted during site characterization. This report will describe the study design and its rationale; data collection, management, and reporting; program schedules and milestones; site study organization and management; and quality assurance issues. 43 refs
The Involvement of miR-23a/APAF1 Regulation Axis in Colorectal Cancer
Directory of Open Access Journals (Sweden)
Fung Lin Yong
2014-07-01
Full Text Available Recent advances in microRNAome have made microRNAs (miRNAs a compelling novel class of biomarker in cancer biology. In the present study, the role of miR-23a in the carcinogenesis of colorectal cancer (CRC was investigated. Cell viability, apoptosis, and caspase 3/7 activation analyses were conducted to determine the potentiality of apoptosis resistance function of miR-23a in CRC. Luciferase assay was performed to verify a putative target site of miR-23a in the 3'-UTR of apoptosis protease activating factor 1 (APAF1 mRNA. The expression levels of miR-23a and APAF1 in CRC cell lines (SW480 and SW620 and clinical samples were assessed using reverse transcription-quantitative real-time PCR (RT-qPCR and Western blot. We found that the inhibition of miR-23a in SW480 and SW620 cell lines resulted in significant reduction of cell viability and promotion of cell apoptosis. Moreover, miR-23a up-regulation was coupled with APAF1 down-regulation in CRC tissue samples. Taken together, miR-23a was identified to regulate apoptosis in CRC. Our study highlights the potential application of miR-23a/APAF1 regulation axis in miRNA-based therapy and prognostication.
Analysis of laparoscopic port site complications: A descriptive study.
Karthik, Somu; Augustine, Alfred Joseph; Shibumon, Mundunadackal Madhavan; Pai, Manohar Varadaraya
2013-04-01
The rate of port site complications following conventional laparoscopic surgery is about 21 per 100,000 cases. It has shown a proportional rise with increase in the size of the port site incision and trocar. Although rare, complications that occur at the port site include infection, bleeding, and port site hernia. To determine the morbidity associated with ports at the site of their insertion in laparoscopic surgery and to identify risk factors for complications. Prospective descriptive study. In the present descriptive study, a total of 570 patients who underwent laparoscopic surgeries for various ailments between August 2009 and July 2011 at our institute were observed for port site complications prospectively and the complications were reviewed. Descriptive statistical analysis was carried out in the present study. The statistical software, namely, SPSS 15.0 was used for the analysis of the data. Of the 570 patients undergoing laparoscopic surgery, 17 (3%) had developed complications specifically related to the port site during a minimum follow-up of three months; port site infection (PSI) was the most frequent (n = 10, 1.8%), followed by port site bleeding (n = 4, 0.7%), omentum-related complications (n = 2; 0.35%), and port site metastasis (n = 1, 0.175%). Laparoscopic surgeries are associated with minimal port site complications. Complications are related to the increased number of ports. Umbilical port involvement is the commonest. Most complications are manageable with minimal morbidity, and can be further minimized with meticulous surgical technique during entry and exit.
Analysis of laparoscopic port site complications: A descriptive study
Directory of Open Access Journals (Sweden)
Somu Karthik
2013-01-01
Full Text Available Context: The rate of port site complications following conventional laparoscopic surgery is about 21 per 100,000 cases. It has shown a proportional rise with increase in the size of the port site incision and trocar. Although rare, complications that occur at the port site include infection, bleeding, and port site hernia. Aims: To determine the morbidity associated with ports at the site of their insertion in laparoscopic surgery and to identify risk factors for complications. Settings and Design: Prospective descriptive study. Materials and Methods: In the present descriptive study, a total of 570 patients who underwent laparoscopic surgeries for various ailments between August 2009 and July 2011 at our institute were observed for port site complications prospectively and the complications were reviewed. Statistical Analysis Used: Descriptive statistical analysis was carried out in the present study. The statistical software, namely, SPSS 15.0 was used for the analysis of the data. Results: Of the 570 patients undergoing laparoscopic surgery, 17 (3% had developed complications specifically related to the port site during a minimum follow-up of three months; port site infection (PSI was the most frequent (n = 10, 1.8%, followed by port site bleeding (n = 4, 0.7%, omentum-related complications (n = 2; 0.35%, and port site metastasis (n = 1, 0.175%. Conclusions: Laparoscopic surgeries are associated with minimal port site complications. Complications are related to the increased number of ports. Umbilical port involvement is the commonest. Most complications are manageable with minimal morbidity, and can be further minimized with meticulous surgical technique during entry and exit.
Analysis of laparoscopic port site complications: A descriptive study
Karthik, Somu; Augustine, Alfred Joseph; Shibumon, Mundunadackal Madhavan; Pai, Manohar Varadaraya
2013-01-01
CONTEXT: The rate of port site complications following conventional laparoscopic surgery is about 21 per 100,000 cases. It has shown a proportional rise with increase in the size of the port site incision and trocar. Although rare, complications that occur at the port site include infection, bleeding, and port site hernia. AIMS: To determine the morbidity associated with ports at the site of their insertion in laparoscopic surgery and to identify risk factors for complications. SETTINGS AND DESIGN: Prospective descriptive study. MATERIALS AND METHODS: In the present descriptive study, a total of 570 patients who underwent laparoscopic surgeries for various ailments between August 2009 and July 2011 at our institute were observed for port site complications prospectively and the complications were reviewed. STATISTICAL ANALYSIS USED: Descriptive statistical analysis was carried out in the present study. The statistical software, namely, SPSS 15.0 was used for the analysis of the data. RESULTS: Of the 570 patients undergoing laparoscopic surgery, 17 (3%) had developed complications specifically related to the port site during a minimum follow-up of three months; port site infection (PSI) was the most frequent (n = 10, 1.8%), followed by port site bleeding (n = 4, 0.7%), omentum-related complications (n = 2; 0.35%), and port site metastasis (n = 1, 0.175%). CONCLUSIONS: Laparoscopic surgeries are associated with minimal port site complications. Complications are related to the increased number of ports. Umbilical port involvement is the commonest. Most complications are manageable with minimal morbidity, and can be further minimized with meticulous surgical technique during entry and exit. PMID:23741110
Universal Access in Heritage Sites: A Case Study on Historic Sites in Jaipur, India.
Vardia, Shweta; Khare, Rachna; Khare, Ajay
2016-01-01
A nation is recognized by a range of its significant historical, cultural and natural properties. These properties are generally preserved and maintained either by national administration or by private owners and charitable trusts due to higher value of their cultural inheritance and termed globally as heritage or historic sites. Heritage sites are a significant asset, a unique and irreplaceable resource which reflects a rich and diverse expression of past societies and forms an integral part of local, regional and national cultural identity. Today, heritage sites also play an important role in communication and knowledge exchange. Thus the rapidly increasing heritage tourism industry faces several challenges too. One of the challenges is that there is a segment of society who is not yet able to equally enjoy the visit to historic structures/sites and attractions, facilities and services. This paper aims to study the experience and develop understanding regarding the heritage structures/sites approached and interacted by diverse users. This study is an outcome of a hands on workshop conducted with diverse users at various historic sites in the city of Jaipur viz. at The City Palace Complex, Jaipur, Jaigarh Fort and the Haveli at Kanota near to Jaipur India.
International Nuclear Information System (INIS)
Hume, H.
1987-12-01
This site study plan describes seismic reflection surveys to run north-south and east-west across the Deaf Smith County site, and intersecting near the Engineering Design Boreholes (EDBH). Both conventional and shallow high-resolution surveys will be run. The field program has been designed to acquire subsurface geologic and stratigraphic data to address information/data needs resulting from Federal and State regulations and Repository program requirements. The data acquired by the conventional surveys will be common-depth- point, seismic reflection data optimized for reflection events that indicate geologic structure near the repository horizon. The data will also resolve the basement structure and shallow reflection events up to about the top of the evaporite sequence. Field acquisition includes a testing phase to check/select parameters and a production phase. The field data will be subjected immediately to conventional data processing and interpretation to determine if there are any anamolous structural for stratigraphic conditions that could affect the choice of the EDBH sites. After the EDBH's have been drilled and logged, including vertical seismic profiling, the data will be reprocessed and reinterpreted for detailed structural and stratigraphic information to guide shaft development. The shallow high-resulition seismic reflection lines will be run along the same alignments, but the lines will be shorter and limited to immediate vicinity of the EDBH sites. These lines are planned to detect faults or thick channel sands that may be present at the EDBH sites. 23 refs. , 7 figs., 5 tabs
International Nuclear Information System (INIS)
Wickline, Alfred
2005-01-01
This Corrective Action Investigation Plan (CAIP) contains project-specific information including facility descriptions, environmental sample collection objectives, and criteria for conducting site investigation activities at Corrective Action Unit (CAU) 137: Waste Disposal Sites. This CAIP has been developed in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S. Department of Defense. Corrective Action Unit 137 contains sites that are located in Areas 1, 3, 7, 9, and 12 of the Nevada Test Site (NTS), which is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Corrective Action Unit 137 is comprised of the eight corrective action sites (CASs) shown on Figure 1-1 and listed below: (1) CAS 01-08-01, Waste Disposal Site; (2) CAS 03-23-01, Waste Disposal Site; (3) CAS 03-23-07, Radioactive Waste Disposal Site; (4) CAS 03-99-15, Waste Disposal Site; (5) CAS 07-23-02, Radioactive Waste Disposal Site; (6) CAS 09-23-07, Radioactive Waste Disposal Site; (7) CAS 12-08-01, Waste Disposal Site; and (8) CAS 12-23-07, Waste Disposal Site. The Corrective Action Investigation (CAI) will include field inspections, radiological surveys, geophysical surveys, sampling of environmental media, analysis of samples, and assessment of investigation results, where appropriate. Data will be obtained to support corrective action alternative evaluations and waste management decisions. The CASs in CAU 137 are being investigated because hazardous and/or radioactive constituents may be present in concentrations that could potentially pose a threat to human health and the environment. Existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives for the CASs. Additional information will be generated by conducting a CAI before evaluating and selecting corrective action
Energy Technology Data Exchange (ETDEWEB)
Patrick Matthews
2011-08-01
CAU 104 comprises the 15 CASs listed below: (1) 07-23-03, Atmospheric Test Site T-7C; (2) 07-23-04, Atmospheric Test Site T7-1; (3) 07-23-05, Atmospheric Test Site; (4) 07-23-06, Atmospheric Test Site T7-5a; (5) 07-23-07, Atmospheric Test Site - Dog (T-S); (6) 07-23-08, Atmospheric Test Site - Baker (T-S); (7) 07-23-09, Atmospheric Test Site - Charlie (T-S); (8) 07-23-10, Atmospheric Test Site - Dixie; (9) 07-23-11, Atmospheric Test Site - Dixie; (10) 07-23-12, Atmospheric Test Site - Charlie (Bus); (11) 07-23-13, Atmospheric Test Site - Baker (Buster); (12) 07-23-14, Atmospheric Test Site - Ruth; (13) 07-23-15, Atmospheric Test Site T7-4; (14) 07-23-16, Atmospheric Test Site B7-b; (15) 07-23-17, Atmospheric Test Site - Climax These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on April 28, 2011, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 104. The releases at CAU 104 consist of surface-deposited radionuclides from 30 atmospheric nuclear tests. The presence and nature of contamination at CAU 104 will be evaluated based on information collected from a field investigation. Radiological contamination will be evaluated based on a comparison
Site locality identification study: Hanford Site. Volume II. Data cataloging
International Nuclear Information System (INIS)
1980-07-01
Data compilation and cataloging for the candidate site locality identification study were conducted in order to provide a retrievable data cataloging system for the present siting study and future site evaluation and licensng processes. This task occurred concurrently with and also independently of other tasks of the candidate site locality identification study. Work in this task provided the data utilized primarily in the development and application of screening and ranking processes to identify candidate site localities on the Hanford Site. The overall approach included two steps: (1) data acquisition and screening; and (2) data compilation and cataloging. Data acquisition and screening formed the basis for preliminary review of data sources with respect to their probable utilization in the candidate site locality identification study and review with respect to the level of completeness and detail of the data. The important working assumption was that the data to be used in the study be based on existing and available published and unpublished literature. The data compilation and cataloging provided the basic product of the Task; a retrievable data cataloging system in the form of an annotated reference list and key word index and an index of compiled data. The annotated reference list and key word index are cross referenced and can be used to trace and retrieve the data sources utilized in the candidate site locality identification study
E2F1 interactions with hHR23A inhibit its degradation and promote DNA repair.
Singh, Randeep K; Dagnino, Lina
2016-05-03
Nucleotide excision repair (NER) is a major mechanism for removal of DNA lesions induced by exposure to UV radiation in the epidermis. Recognition of damaged DNA sites is the initial step in their repair, and requires multiprotein complexes that contain XPC and hHR23 proteins, or their orthologues. A variety of transcription factors are also involved in NER, including E2F1. In epidermal keratinocytes, UV exposure induces E2F1 phosphorylation, which allows it to recruit various NER factors to sites of DNA damage. However, the relationship between E2F1 and hHR23 proteins vis-à-vis NER has remained unexplored. We now show that E2F1 and hHR23 proteins can interact, and this interaction stabilizes E2F1, inhibiting its proteasomal degradation. Reciprocally, E2F1 regulates hHR23A subcellular localization, recruiting it to sites of DNA photodamage. As a result, E2F1 and hHR23A enhance DNA repair following exposure to UV radiation, contributing to genomic stability in the epidermis.
A conserved chloramphenicol binding site at the entrance to the ribosomal peptide exit tunnel
DEFF Research Database (Denmark)
Long, Katherine S; Porse, Bo T
2003-01-01
, of E.coli 23S rRNA and G2084 (2058 in E.coli numbering) in domain V of H.halobium 23S rRNA. The modification sites overlap with a portion of the macrolide binding site and cluster at the entrance to the peptide exit tunnel. The data correlate with the recently reported chloramphenicol binding site...... on an archaeal ribosome and suggest that a similar binding site is present on the E.coli ribosome....
Shaft siting decision report: Final report
International Nuclear Information System (INIS)
1985-11-01
The purpose of this study is to identify and establish relative guidelines to be used for siting of repository shafts. Weights were determined for the significant factors which impact the selection of shaft locations for a nuclear waste repository in salt. The study identified a total of 45 factors. A panel of experienced mining people utilized the Kepner-Tregoe (K-T) Decision Analysis Process to perform a structured evaluation of each significant shaft siting factor. The evaluation determined that 22 of the factors were absolute constraints and that the other 23 factors were desirable characteristics. The group established the relative weights for each of the 23 desirable characteristics by using a paired comparison method. 49 refs., 2 figs., 5 tabs
International Nuclear Information System (INIS)
Rios R, C.H.; Romero R, M.; Ponce R, A.; Mendoza H, L.H.
2008-01-01
In this work, it is shown a theoretical quantum study of the active sites distribution on a monocrystalline surface of Cu(100). The copper surface was modeled as finite clusters of 14, 23, 38 and 53 atoms. We performed Hartree-Fock and Density Functional Theory (B3LYP) ab initio calculations employing the pseudopotentials of Hay and Wadt (LANLlMB y LANL2DZ). From calculations, we found a work function value of 4.1 eV. The mapping of the HOMO and LUMO in the frozen core approximation, allowed us finding the electrophilic and nucleophilic active sites distribution, respectively. The results indicated that electrophilic sites on the Cu(100) surface were located on hollow position and its numerical density was 8.6 x 10 16 sites cm -2 . From the nucleophilic local softness study, it was found that the nucleophilic sites were formed by a group of atoms and it had a numerical density of 2.4x 10 16 sitescm -2 . Last results indicated that adsorptions with 2 x 2 and 3 x 3 distributions can be favored onto a Cu(100) surface for the electrophilic and nucleophilic cases, respectively. (Author)
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Reports. 750.308 Section 750.308 Highways FEDERAL... Outdoor Advertising (Acquisition of Rights of Sign and Sign Site Owners) § 750.308 Reports. Periodic reports on site acquisitions and actual sign removals shall be submitted on FHWA Form 1424 and as...
Energy Technology Data Exchange (ETDEWEB)
Waber, H. N. [Rock Water Interaction, University of Bern, Bern (Switzerland); Smellie, J. A. T. [Conterra AB, Partille (Sweden)
2012-04-15
Within the Detum Project (Detailed Investigations in Forsmark) a 'Methodology comparison for porewater extraction and characterisation techniques' was initiated. This has centred on two shallow boreholes drilled at Soederviken within the northern part of the Forsmark characterisation site. The comparison includes different methodologies to characterise the chemical and isotopic composition of porewater residing in the connected pore space of the rock matrix. The present report describes the chemical and isotopic information of the porewater obtained by out-diffusion experiments and the diffusive isotope equilibration technique applied to originally water saturated drillcore samples. In addition, petrophysical data and solute transport properties of the rock matrix, all necessary for porewater characterisation, have also been elaborated. Specially conditioned drillcore samples were obtained from depths of less than 100 m from boreholes KFM22 and KFM23. Porewater has been extracted successfully from seven samples by laboratory out-diffusion and diffusive isotope exchange methods. The methodology to extract and analyse the porewater is outlined and the analytical data are tabulated. The data are critically reviewed for potential experimental artefacts and their significance with respect to in situ conditions. The connected pore space in the core material representing borehole KFM22 and KFM23 was measured on different types of originally saturated drillcore samples using gravimetric and isotope mass balance methods. Out-diffusion experiments were performed on kg-sized drillcore samples to derive the in situ concentration of the chemically conservative compounds chloride and bromide. The attainment of equilibrium conditions in the out-diffusion experiments was monitored by the concentration change of chloride and bromide as a function of time. The water isotope composition of porewater was determined by the diffusive isotope equilibration technique and by
Site locality identification study: Hanford Site. Volume I. Methodology, guidelines, and screening
International Nuclear Information System (INIS)
1980-07-01
Presented in this report are the results of the site locality identification study for the Hanford Site using a screening process. To enable evaluation of the entire Hanford Site, the screening process was applied to a somewhat larger area; i.e., the Pasco Basin. The study consisted of a series of screening steps that progressively focused on smaller areas which are within the Hanford Site and which had a higher potential for containing suitable repository sites for nuclear waste than the areas not included for further study. Five site localities, designated H-1, H-2, H-3, H-4, H-5 (Figure A), varying in size from approximately 10 to 50 square miles, were identified on the Hanford Site. It is anticipated that each site locality may contain one or more candidate sites suitable for a nuclear waste repository. The site locality identification study began with definition of objectives and the development of guidelines for screening. Three objectives were defined: (1) maximize public health and safety; (2) minimize adverse environmental and socioeconomic impacts; and (3) minimize system costs. The screening guidelines have numerical values that provided the basis for the successive reduction of the area under study and to focus on smaller areas that had a higher likelihood of containing suitable sites
Energy Technology Data Exchange (ETDEWEB)
Beyer, Brian M.; Ingram, Richard; Ramanathan, Lata; Reichert, Paul; Le, Hung V.; Madison, Vincent; Orth, Peter (SPRI)
2009-06-25
Interleukin (IL)-23 is a pro-inflammatory cytokine playing a key role in the pathogenesis of several autoimmune and inflammatory diseases. We have determined the crystal structures of the heterodimeric p19-p40 IL-23 and its complex with the Fab (antigen-binding fragment) of a neutralizing antibody at 2.9 and 1.9 {angstrom}, respectively. The IL-23 structure closely resembles that of IL-12. They share the common p40 subunit, and IL-23 p19 overlaps well with IL-12 p35. Along the hydrophilic heterodimeric interface, fewer charged residues are involved for IL-23 compared with IL-12. The binding site of the Fab is located exclusively on the p19 subunit, and comparison with published cytokine-receptor structures suggests that it overlaps with the IL-23 receptor binding site.
Posttranscriptional modifications in the A-loop of 23S rRNAs from selected archaea and eubacteria.
Hansen, M A; Kirpekar, F; Ritterbusch, W; Vester, B
2002-01-01
Posttranscriptional modifications were mapped in helices 90-92 of 23S rRNA from the following phylogenetically diverse organisms: Haloarcula marismortui, Sulfolobus acidocaldarius, Bacillus subtilis, and Bacillus stearothermophilus. Helix 92 is a component of the ribosomal A-site, which contacts the aminoacyl-tRNA during protein synthesis, implying that posttranscriptional modifications in helices 90-92 may be important for ribosome function. RNA fragments were isolated from 23S rRNA by site-...
A Case Study in the Mars Landing Site Selection for Science Objects
Directory of Open Access Journals (Sweden)
Haingja Seo
2012-12-01
Full Text Available It is a crucial matter to select a landing site for landers or rovers in planning the Mars exploration. The landing site must have not only a scientific value as a landing site, but also geographical features to lead a safe landing for Mars probes. In this regard, this study analyzed landing site of Mars probes and rovers in previous studies and discussed the adequacy of the landing site to scientific missions. Moreover, this study also examined domestic studies on the Mars. The frameworks of these studies will guide the selection of exploration sites and a landing site when sending Mars probe to the Mars through our own efforts. Additionally, this paper will be used as the preliminary data for selection of exploration site and a landing site.
Managing a User’s Vulnerability on a Social Networking Site
2015-05-01
aid not only the cyberbullying of teenagers but also the cyberstalking and cyberharassment of adults3. On a social networking site, an individual user...news/2011-07-23-facebook-stalker- sentenced_n.htm 3en.wikipedia.org/wiki/ Cyberbullying 1 posts and subsequent interactions. The owner of the site
Methodology of site protection studies
International Nuclear Information System (INIS)
Farges, L.
1980-01-01
Preliminary studies preceding building of a nuclear facility aim at assessing the choice of a site and establishing operating and control procedures. These studies are of two types. Studies on the impact of environment on the nuclear facility to be constructed form one type and studies on the impact of nuclear facilities on the environment form the second type. A methodology giving a framework to studies of second type is presented. These studies are undertaken to choose suitable sites for nuclear facilities. After a preliminary selection of a site based on the first estimate, a detailed site study is undertaken. The procedure for this consists of five successive phases, namely, (1) an inquiry assessing the initial state of the site, (2) an initial synthesis of accumulated information for assessing the health and safety consequences of releases, (3) laboratory and field studies simulating the movement of waste products for a quantitative assessment of effects, (4) final synthesis for laying down the release limits and radiological control methods, and (5) conclusions based on comparing the data of final synthesis to the limits prescribed by regulations. These five phases are outlined. Role of periodic reassessments after the facility is in operation for same time is explained. (M.G.B.)
International Nuclear Information System (INIS)
Kakiuchi, Takuhiro; Nagaoka, Shinichi; Hashimoto, Shogo; Fujita, Narihiko; Tanaka, Masatoshi; Mase, Kazuhiko
2010-01-01
Valence electronic structures of a clean Si(100)-2x1 surface are investigated in a surface-site-selective way using Si-L 23 VV Auger electron-Si-2p photoelectron coincidence spectroscopy. The Si-L 23 VV Auger electron spectra measured in coincidence with Si-2p photoelectrons emitted from the Si up-atoms or Si 2nd-layer of Si(100)-2x1 suggest that the position where the highest density of valence electronic states located in the vicinity of the Si up-atoms is shifted by 0.8 eV towards lower binding energy relative to that in the vicinity of the Si 2nd-layer. Furthermore, the valence band maximum in the vicinity of the Si up-atoms is indicated to be shifted by 0.1 eV towards lower binding energy relative to that in the vicinity of the Si 2nd-layer. These results are direct evidence of the transfer of negative charge from the Si 2nd-layer to the Si up-atoms. (author)
Quantifying siting difficulty: a case study of US transmission line siting
Energy Technology Data Exchange (ETDEWEB)
Vajjhala, S.P. [Resources for the Future, Washington DC (United States); Fischbeck, P.S. [Carnegie Mellon University, Pittsburgh, PA (United States). Departments of Social and Decision Sciences and Engineering and Public Policy
2007-01-15
The worldwide demand for new energy infrastructures has been paralleled in recent years by the increasing difficulty of siting major facilities. Siting difficulty is the subject of widespread discussion, but because of the complexity of the problem, potential solutions are not obvious or well understood. This paper presents a two-step policy-level framework that first develops an empirical measure of siting difficulty and then qualitatively assesses its major causes. The approach is based on the creation and aggregation of four siting indicators that are independent of the common causes and localized effects of siting problems. The proposed framework is demonstrated for the case of US transmission line siting. Results of the analyses reveal significant variations in state siting difficulty and industry experts' perceptions of its dominant causes, with implications for the long-term success of Regional Transmission Organizations (RTOs) and knowledge transfer among siting professionals in the deregulated industry. (author)
International Nuclear Information System (INIS)
Hadi, M.; Preko, K.; Ashia, T.
2012-01-01
The magnetic susceptibility of soil and water samples from around the Uadara barracks waste site deposit in Bantama, a suburb of Kumasi was measured with the aim of investigating the potential threat of pollution to the soil, streams, fish ponds and other water sources at the site around Armed Forces Senior High School campus which shares the same premises with the barracks. The studied soil samples were picked from the near surface (∼10 cm depth) along profiles taken from the waste site towards the stream and the ponds. Again, water samples were picked along the stream and from ten (10) ponds aligned along the stream. Laboratory measurements of the magnetic susceptibility were done using the Bartington MS2 metre and the MS2B dual frequency sensor for the soil samples, and the MS2G sensor for the water samples. The soil samples from the site registered an average magnetic susceptibility of 180. 04 x 10 -5 SI whereas the water samples recorded an average of -2.3 x 10 -6 SI showing a significant increment in comparison with the standard water magnetic susceptibility of -9.04 x 10 -6 SI. Thus, not withstand the lithology of the area studied, the presence of heavy metals and other chemical waste materials form the Uadara barracks garbage deposit site were found to greatly pollute the soil and particularly the water bodies around the Armed Forces Senior High School. (au)
Energy Technology Data Exchange (ETDEWEB)
Patrick Matthews; Christy Sloop
2012-02-01
Corrective Action Unit (CAU) 569 is located in Area 3 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 569 comprises the nine numbered corrective action sites (CASs) and one newly identified site listed below: (1) 03-23-09, T-3 Contamination Area (hereafter referred to as Annie, Franklin, George, and Moth); (2) 03-23-10, T-3A Contamination Area (hereafter referred to as Harry and Hornet); (3) 03-23-11, T-3B Contamination Area (hereafter referred to as Fizeau); (4) 03-23-12, T-3S Contamination Area (hereafter referred to as Rio Arriba); (5) 03-23-13, T-3T Contamination Area (hereafter referred to as Catron); (6) 03-23-14, T-3V Contamination Area (hereafter referred to as Humboldt); (7) 03-23-15, S-3G Contamination Area (hereafter referred to as Coulomb-B); (8) 03-23-16, S-3H Contamination Area (hereafter referred to as Coulomb-A); (9) 03-23-21, Pike Contamination Area (hereafter referred to as Pike); and (10) Waste Consolidation Site 3A. Because CAU 569 is a complicated site containing many types of releases, it was agreed during the data quality objectives (DQO) process that these sites will be grouped. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each study group. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the DQOs developed on September 26, 2011, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO
Directory of Open Access Journals (Sweden)
Guzmán Sánchez
2014-07-01
Full Text Available The indolo[2,3-a]carbazole scaffold is a fused polyheteroaromatic system bearing two NH groups which suitably converge as hydrogen bond donor sites for the recognition of anions. A simple derivatisation of the indolocarbazole system at positions 1 and 10 with different functional groups, namely alcohols and amides, has contributed to modulate the anion binding selectivity and sensibility. A particularly good response has been obtained for the benzoate anion.
Directory of Open Access Journals (Sweden)
Yoshiuchi Kazuhiro
2011-06-01
Full Text Available Abstract Fibroblast growth factor (FGF 23, a circulating 26-kDa peptide produced by osteogenic cells, is a novel phosphaturic factor. In our previous study, binge-eating/purging type anorexia nervosa (AN-BP patients had elevated plasma intact FGF23 (iFGF23 levels, while restricting type (AN-R patients had plasma iFGF23 levels similar to healthy controls. Although bulimia nervosa (BN patients as well as some patients with AN-BP regularly engage in binge eating, there have been no studies regarding plasma iFGF23 levels in BN patients. Therefore, this study was performed to determine plasma iFGF23 concentrations in BN patients and healthy controls. The study population consisted of 13 female BN patients and 11 healthy female controls. Blood samples were collected from all subjects after overnight fasting. Plasma iFGF23 was measured using an ELISA kit in a cross-sectional manner. The two-tailed Mann-Whitney U-test was used to assess differences between BN patients and healthy controls. In addition, BN patients were divided into two groups based on questionnaire-reported binge eating frequency immediately prior to participation in this study: high frequency of binge eating (once a week or more; HF group; n = 8 and low frequency of binge eating (less than once a week; LF group; n = 5. Two-tailed Mann-Whitney U-test with Bonferroni's correction was performed after the Kruskal-Wallis test to assess differences between HF group, LF group, and healthy controls. Median (quartiles plasma iFGF23 levels were greater in BN patients (35.5 [14.8-65.0] pg/ml than in controls (3.8 [not detected-5.3] pg/ml; p = 0.002. In addition, median (quartiles plasma iFGF23 levels were greater in the HF group (62.3 [44.4-73.4] pg/ml than in controls (p
Energy Technology Data Exchange (ETDEWEB)
D. F. Emer
2001-03-01
This annual Neutron Soil Moisture Monitoring report provides an analysis and summary for site inspections, meteorological information, and neutron soil moisture monitoring data obtained at the Area 23 Hazardous Waste Trenches Resource Conservation and Recovery Act (RCRA) unit, located in Area 23 of the Nevada Test Site, Nye County, Nevada, during the October 1999-October 2000 period. Inspections of the Area 23 Hazardous Waste Trenches RCRA unit are conducted to determine and document the physical condition of the covers, facilities, and any unusual conditions that could impact the proper operation of the waste unit closure. Physical inspections of the closure were completed quarterly and indicated that the site is in good condition with no significant findings noted. An annual subsidence survey of the elevation markers was conducted in August 2000. There has been no subsidence at any of the markers since monitoring began seven years ago. The objective of the neutron logging program is to monitor the soil moisture conditions along 30 neutron access tubes and detect changes that maybe indicative of moisture movement at a point located directly beneath each trench. Precipitation for the period October 1999 through October 2000 was 10.44 centimeters (cm) (4.11 inches [in.]) (U.S. National Weather Service, 2000). The prior year annual rainfall (January 1999 through December 1999) was 10.13cm (3.99 in.). The highest 30-day cumulative rainfall occurred on March 8, 2000, with a total of 6.63 cm (2.61 in.). The heaviest daily precipitation occurred on February 23,2000, with a total of 1.70 cm (0.67 in.) falling in that 24-hour period. The recorded average annual rainfall for this site, from 1972 to January 1999, is 15.06 cm (5.93 in.). All monitored access tubes are within the compliance criteria of less than 5 percent residual volumetric moisture content at the compliance point directly beneath each respective trench. Soil conditions remain dry and stable underneath the
Detailed site characterization for final disposal of spent fuel in Finland - Case study Loviisa
Energy Technology Data Exchange (ETDEWEB)
Anttila, P. [IVO Power Engineering Ltd. (Finland); Ahokas, H.; Ruotsalainen, P. [Fintact Oy (Finland); Cosma, C.; Keskinen, J. [Vibrometric Oy (Finland); Hinkkanen, H. [Posiva Oy (Finland); Rouhiainen, P. [PRG-Tec Oy (Finland); Oehberg, A. [Saanio and Riekkola Consulting Engineers (Finland)
1998-09-01
The spent fuel from the Finnish nuclear power plants will be disposed of in the Finnish bedrock. Pos iva Oy is responsible for the site selection programme carried out in accordance with the governmental decisions. Preliminary site investigations were made in five areas in 1987-1992. Based on the results, three areas, Romuvaara in Kuhmo, Kivetty in Aeaenekoski and Olkiluoto in Eurajoki, were selected for the detailed site characterization in 1993-2000. The final site will be selected by the end of the year 2000. The interim reporting of the detailed studies of the three areas was made in 1996. In 1997, the island of Haestholmen, as the host to the Loviisa NPP, was included as a fourth candidate site in the programme for the detailed site investigations. The goal is to characterize this site also in detail by the end of 2000 to attain the same level of knowledge as available from the three other sites. The background information existing from the studies made for the construction of the repository for the low-and intermediate-level wastes will create a good basis to reach the target. The research programme for the detailed site characterization has mainly been focused on groundwater flow and geochemistry due to their importance in terms of long-term safety of the repository. Equipment and methodology development by Posiva has introduced new tools that provide more accurate data on relevant parameters than the ones used in previous stages of site characterization. The programme also contains studies for additional information of the structural and geological properties of the bedrock towards the depth. Also predictive modelling has been made for evaluating the relevance of the assumptions made. The methods applied in the site characterization have comprised, e.g., geological mapping, deep core drilling, groundwater sampling and analyzing, hydraulic testing and geophysical measurements 23 refs, 4 figs
DEFF Research Database (Denmark)
Xiong, L; Kloss, P; Douthwaite, S
2000-01-01
Oxazolidinone antibiotics inhibit bacterial protein synthesis by interacting with the large ribosomal subunit. The structure and exact location of the oxazolidinone binding site remain obscure, as does the manner in which these drugs inhibit translation. To investigate the drug-ribosome interaction......, we selected Escherichia coli oxazolidinone-resistant mutants, which contained a randomly mutagenized plasmid-borne rRNA operon. The same mutation, G2032 to A, was identified in the 23S rRNA genes of several independent resistant isolates. Engineering of this mutation by site-directed mutagenesis...
Energy Technology Data Exchange (ETDEWEB)
Matthews, Patrick
2013-09-01
This Corrective Action Decision Document/Closure Report presents information supporting the closure of Corrective Action Unit (CAU) 105: Area 2 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada. CAU 105 comprises the following five corrective action sites (CASs): -02-23-04 Atmospheric Test Site - Whitney Closure In Place -02-23-05 Atmospheric Test Site T-2A Closure In Place -02-23-06 Atmospheric Test Site T-2B Clean Closure -02-23-08 Atmospheric Test Site T-2 Closure In Place -02-23-09 Atmospheric Test Site - Turk Closure In Place The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation that no further corrective action is needed for CAU 105 based on the implementation of the corrective actions. Corrective action investigation (CAI) activities were performed from October 22, 2012, through May 23, 2013, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 105: Area 2 Yucca Flat Atmospheric Test Sites; and in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices.
Ito, Sanae; Ishida, Hiromi; Uenishi, Kazuhiro
2016-01-01
Phosphorus homeostasis is determined by dietary intake, intestinal absorption, and renal tubular reabsorption of phosphorus. Serum fibroblast growth factor-23 (FGF-23) is considered to be a sensitive early biomarker of disordered phosphorus metabolism in both patients with chronic kidney diseases and healthy subjects. However, the number of studies evaluating serum FGF-23 concentrations in healthy subjects is limited. The objective of this cross-sectional study was to examine the relationship between serum FGF-23 concentrations and phosphorus related factors in 182 young Japanese women (mean age, 19.5±0.4 years). We found that higher serum concentrations of inorganic phosphorus and lower serum concentrations of 1,25-dihydroxy vitamin D as well as lower fat but higher phosphorus and calcium intake were weakly but significantly associated with high serum concentrations of FGF-23, adjusted for postmenarcheal age and body weight. These results suggested that in young Japanese women, serum FGF-23 might be indicative of phosphorus nutrition status. However, it is worthy of note that maturity factors, including postmenarcheal age and physical attributes, such as body weight, might be related to serum FGF-23 concentrations.
Araújo, Ana M; Guimarães, Joana; Nunes, Catarina S; Couto, Paula S; Amadeu, Eduarda
Transversus abdominis plane (TAP) block is useful in reducing post-operative pain in laparoscopic nephrectomy compared to placebo. The purpose of this work is to compare post-operative pain and recovery after TAP block or trocar site infiltration (TSI) in this surgery. A prospective, single blinded study on patients scheduled for laparoscopic nephrectomy. Patients were assigned to two groups: TSI Group: trocar site infiltration at the end of surgery; TAP Group: unilateral ultrasound-guided TAP block after induction. Sevoflurane and remifentanil, in a target controlled infusion mode, were used for maintenance of general anesthesia. Before the end of surgery paracetamol, tramadol and morphine were administered. Visual analogue scale (VAS 0-100mm) at rest and with cough was applied in three moments: in recovery room (T1 at admission and T2 before discharge) and 24h after surgery (T3). Pain scores with incentive spirometer were also evaluated at T3. In recovery, morphine was administered as a rescue drug whenever VAS>30mm. Time to oral intake, chair sitting, ambulation and length of hospital stay were evaluated 24h after surgery. Student's t-test and Chi-square test, and linear regression models. A p-value0.05). VAS at rest (TAP vs. TSI groups) was: T1=33±29 vs. 39±32, T2=10±9 vs. 17±18 and T3=7±12 vs. 10±18. VAS with cough (TAP vs. TSI groups) was: T1=51±34 vs. 45±32, T2=24±24 vs. 33±23 and T3=20±23 vs. 23±23. VAS with incentive spirometer (TAP vs. TSI groups) was: T3=21±27 vs. 21±25. Intraoperative remifentanil consumption was similar between TAP (0.16±0.07mcg.kg -1 .min -1 ) and TSI (0.18±0.9mcg.kg -1 .min -1 ) groups. There were no differences in opioid consumption between TAP (4.4±3.49mg) and TSI (6.87±4.83mg) groups during recovery. Functional recovery parameters were not statistically different between groups. Multimodal analgesia with TAP block did not show a significant clinical benefit compared with trocar site infiltration in laparoscopic
Directory of Open Access Journals (Sweden)
Ana M. Araújo
Full Text Available Abstract Background Transversus abdominis plane (TAP block is useful in reducing post-operative pain in laparoscopic nephrectomy compared to placebo. The purpose of this work is to compare post-operative pain and recovery after TAP block or trocar site infiltration (TSI in this surgery. Methods A prospective, single blinded study on patients scheduled for laparoscopic nephrectomy. Patients were assigned to two groups: TSI Group: trocar site infiltration at the end of surgery; TAP Group: unilateral ultrasound-guided TAP block after induction. Sevoflurane and remifentanil, in a target controlled infusion mode, were used for maintenance of general anesthesia. Before the end of surgery paracetamol, tramadol and morphine were administered. Visual analogue scale (VAS 0-100 mm at rest and with cough was applied in three moments: in recovery room (T1 at admission and T2 before discharge and 24 h after surgery (T3. Pain scores with incentive spirometer were also evaluated at T3. In recovery, morphine was administered as a rescue drug whenever VAS > 30 mm. Time to oral intake, chair sitting, ambulation and length of hospital stay were evaluated 24 h after surgery. Statistical analysis: Student's t-test and Chi-square test, and linear regression models. A p-value 0.05. VAS at rest (TAP vs. TSI groups was: T1 = 33 ± 29 vs. 39 ± 32, T2 = 10 ± 9 vs. 17 ± 18 and T3 = 7 ± 12 vs. 10 ± 18. VAS with cough (TAP vs. TSI groups was: T1 = 51 ± 34 vs. 45 ± 32, T2 = 24 ± 24 vs. 33 ± 23 and T3 = 20 ± 23 vs. 23 ± 23. VAS with incentive spirometer (TAP vs. TSI groups was: T3 = 21 ± 27 vs. 21 ± 25. Intraoperative remifentanil consumption was similar between TAP (0.16 ± 0.07 mcg.kg-1.min-1 and TSI (0.18 ± 0.9 mcg.kg-1.min-1 groups. There were no differences in opioid consumption between TAP (4.4 ± 3.49 mg and TSI (6.87 ± 4.83 mg groups during recovery. Functional recovery parameters were not statistically different between groups. Conclusions Multimodal
Energy Technology Data Exchange (ETDEWEB)
Matthews, Patrick
2014-01-01
CAU 568 is a grouping of sites where there has been a suspected release of contamination associated with nuclear testing. This document describes the planned investigation of CAU 568, which comprises the following corrective action sites (CASs): • 03-23-17, S-3I Contamination Area • 03-23-19, T-3U Contamination Area • 03-23-20, Otero Contamination Area • 03-23-22, Platypus Contamination Area • 03-23-23, San Juan Contamination Area • 03-23-26, Shrew/Wolverine Contamination Area These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the investigation report.
Bacterial meningoencephalomyelitis in dogs: a retrospective study of 23 cases (1990-1999).
Radaelli, Simona T; Platt, Simon R
2002-01-01
The clinical records of 23 dogs (1990-1999) with histopathologically confirmed bacterial meningoencephalomyelitis were evaluated retrospectively. No breed, age, sex, or weight predisposition was found. All the dogs presented with clinical signs of a brain lesion, whereas 5 of 23 had neck pain. Pyrexia was detected in 11 of 23 dogs on admission. CBCs revealed neutrophilic leucocytosis in 7 of 21 dogs and thrombocytopenia in 3 of 21 dogs. The serum chemistry profiles were abnormal in 15 of 21 dogs. The results of cerebrospinal fluid (CSF) analysis were abnormal in 13 of 14 dogs and aerobic CSF culture was positive for bacteria in 1of 8 samples. At postmortem examination, the lesions were localized to the central nervous system. Escherichia coli, Streptococcus, and Klebsiella spp were the most frequently isolated bacteria from cultures collected at postmortem examination. Twelve papers reporting 51 total clinical cases of canine bacterial meningoencephalomyelitis were reviewed. The clinical signs and results of the CBC, serum chemistry, blood culture, and CSF analysis were collated and compared with those of this study. The results of the CSF analysis in this study were similar to those in the literature. CSF cultures documented in the literature were positive for Staphylococcus, Pasteurella. Actinomyces, Nocardia spp, and various anaerobic species including Peptostreptococcus, Eubacterium, and Bacteroides spp.
Nuclear site selection studies
International Nuclear Information System (INIS)
Gharib, A.; Zohoorian Izadpanah, A.A.; Iranmanesh, H.
2000-01-01
It is of special importance, especially from the nuclear safety viewpoint, to select suitable sites for different nuclear structures with the considered future activities. Site selection sometimes involves high costs not necessarily for merely selecting of site but for some preliminary measures to be taken so as the site may have the necessary characteristics. The more suitable the natural characteristics of the site for the considered project, the more successful and efficient the project, the lower the project costs and the longer the project operation period. If so, the project will cause the growth of public culture and sustainable socioeconomic development. This paper is the result of the conclusion of numerous massive reports of this activity in the preliminary phase based on theories, practices and the related safety principles on this ground as well as the application of data and information of the past and a glance to the future. The conception of need for a site for medium structures and nuclear research projects and how to perform this process are presented step by step here with a scientific approach to its selection during the investigations. In this study, it is practically described how the site is selected, by determining and defining the characteristics of research and nuclear projects with medium structures and also its fitting to the optimum site. The discovered sites typically involve the best advantages in technical and economic aspects and no particular contrast with the concerned structures
Directory of Open Access Journals (Sweden)
M. S. Naumtseva
2016-01-01
Full Text Available Objective: to investigate the immunogenicity, safety, and clinical efficacy of 23-valent polysaccharide pneumococcal vaccine in patients with rheumatoid arthritis (RA during a two-year follow-up study.Subjects and methods. The prospective open-label comparative study enrolled 110 people, of them there were 81 (73.6% women and 29 (26.4% men at the age of 23 to 76 years, including 79 patients with RA, as well as 31 subjects without systemic inflammatory rheumatic diseases (RD (a control group. The group of RA patients exhibited a predominance of middle-aged women who had > 3 years’ disease duration and a moderate inflammatory activity (the mean value of DAS28, 4.32. 52 patients received methotrexate (MTX, 14 had Leflunomide (LEF, and 13 were treated with tumor necrosis factor-α (TNF-α inhibitors + MTX.The 23-valent polysaccharide pneumococcal vaccine Pneumo-23 (Sanofi Pasteur, France was administered in a single dose of 0.5 ml subcutaneously during continuous MTX or LEF therapy for the underlying disease or 3–4 weeks before the use of TNF-α inhibitors. Clinical examinations of the patient and conventional clinical and laboratory studies were performed during control visits (1, 3, 12, and 24 months after vaccination. Clinical effectiveness and safety were evaluated in all the patients included in the study. The serum levels of anti-pneumococcal capsular polysaccharide antibodies (Ab were measured in 72 patients with RA and in 30 individuals in the control group during a 12-month follow-up study, including in 25 patients with RA for a 24-month follow-up study by enzyme immunoassay using commercial VaccZymeTM Anti-PCP IgG Enzyme Immunoassay kits (The Binding Site Group Ltd, Birmingham, United Kingdom. Along with this, the post-immunization response coefficient was calculated for each patient as the ratio of postvaccination Ab levels during Visits 2, 3, 4, and 5 to the baseline Ab level. Results and discussion. No clinical and
ITER site selection studies in Spain
International Nuclear Information System (INIS)
Medrano, M.; Alejaldre, C.; Doncel, J.; Garcia, A.; Ibarra, A.; Jimenez, J.A.; Sanchez de Mora, M.A.; Alcala, F.; Diez, J.E.; Dominguez, M.; Albisu, F.
2003-01-01
The studies carried out to evaluate and select a candidate site for International Thermonuclear Experimental Reactor (ITER) construction in Spain are presented in this paper. The ITER design, completed in July 2001, considered a number of technical requirements that must be fulfilled by the selected site. Several assumptions concerning the ITER site were made in order to carry on the design before final site selection. In the studies undertaken for ITER site selection in Spain, the referred technical requirements and assumptions were applied across the whole of Spain and two areas were identified as being preferential. These areas are on the Mediterranean coast and are situated in the Catalan and Valencian regions. A comparative evaluation based on technical characteristics for the concrete plots, proposed within the preferential areas, has been done. The result of these studies was the selection of a site that was deemed to be the most competitive--Vandellos (Tarragona)--and it was proposed to the European Commission for detailed studies in order to be considered as a possible European site for ITER construction. Another key factor for hosting ITER in Spain, is the licensing process. The present status is summarised in this paper
2010-04-01
... highway infrastructure and growing congestion in many locations. Addressing these safety and mobility... the Code of Federal Regulations at 23 CFR part 655. It is available on the FHWA's Web site at http...
Site and feasibility studies of a first nuclear power plant in Morocco
International Nuclear Information System (INIS)
Righi, M.
1988-11-01
Basing on the estimated studies related to the evaluation of future needs of electrical energy, the launching of a nuclear power program in Morocco is confirmed necessary. A complete study of sites and feasibility has been carried out. Taking into account the site selection factors two sites: BIR ELHAR and SIDI BOULBRA have been kept as candidate sites. The evaluation of seismic and geotechnical risks of the power plant impact on the environment and risks related to human activities has led to privilege the SIDI BOULBRA site. The studies for confirming this site are summarized. 4 figs. (F.M.)
Energy Technology Data Exchange (ETDEWEB)
Wickline, Alfred
2005-12-01
This Corrective Action Investigation Plan (CAIP) contains project-specific information including facility descriptions, environmental sample collection objectives, and criteria for conducting site investigation activities at Corrective Action Unit (CAU) 137: Waste Disposal Sites. This CAIP has been developed in accordance with the ''Federal Facility Agreement and Consent Order'' (FFACO) (1996) that was agreed to by the State of Nevada, the U.S. Department of Energy (DOE), and the U.S. Department of Defense. Corrective Action Unit 137 contains sites that are located in Areas 1, 3, 7, 9, and 12 of the Nevada Test Site (NTS), which is approximately 65 miles (mi) northwest of Las Vegas, Nevada (Figure 1-1). Corrective Action Unit 137 is comprised of the eight corrective action sites (CASs) shown on Figure 1-1 and listed below: (1) CAS 01-08-01, Waste Disposal Site; (2) CAS 03-23-01, Waste Disposal Site; (3) CAS 03-23-07, Radioactive Waste Disposal Site; (4) CAS 03-99-15, Waste Disposal Site; (5) CAS 07-23-02, Radioactive Waste Disposal Site; (6) CAS 09-23-07, Radioactive Waste Disposal Site; (7) CAS 12-08-01, Waste Disposal Site; and (8) CAS 12-23-07, Waste Disposal Site. The Corrective Action Investigation (CAI) will include field inspections, radiological surveys, geophysical surveys, sampling of environmental media, analysis of samples, and assessment of investigation results, where appropriate. Data will be obtained to support corrective action alternative evaluations and waste management decisions. The CASs in CAU 137 are being investigated because hazardous and/or radioactive constituents may be present in concentrations that could potentially pose a threat to human health and the environment. Existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives for the CASs. Additional information will be generated by conducting a CAI before evaluating and selecting
Odje, O E; Ramsey, J M
1995-01-01
The literature on the response of erythrocyte 2,3-diphosphoglycerate (2,3-DPG) following exercise is replete with inconsistencies, and recent studies have shown that the time of blood sampling during and following exercise, as well as the duration of exercise, are important in evaluating the response of 2,3-DPG. Experiments were designed to measure the response of 2,3-DPG following short-term strenuous exercise in two groups of untrained men. Twelve men, 19-22 years old (study 1), exercised on a bicycle ergometer at 122.5 W for 10 min and red blood cell (RBC) 2,3-DPG was measured at 0 and 50 min following exercise. The level of 2,3-DPG (mumol.ml-1 RBC) increased after exercise (P < 0.05), but this increase was not significant when 2,3-DPG was expressed as mol.mol-1 hemoglobin (Hb). However, following 50 min of rest, 2,3-DPG (mol.mol-1 Hb) decreased significantly. In a second group (study 2), nine other men, aged 18-19 years, exercised at the same workload for 15 min and 2,3-DPG was measured at 0, 30, 60, 180, and 330 min respectively after exercise, and no significant mean changes in the level of the phosphate were observed. Findings from these studies suggest that 2,3-DPG does not provide a compensatory adjustment to facilitate oxygen delivery in the hypoxia of short-term strenuous exercise in untrained males immediately following exercise and when recovery intervals of up to 330 min are also examined. It is suggested that 2,3-DPG be reported as mol.mol-1 Hb, since the phosphate exists on Hb in an equimolar ratio in normal physiological states.
Lionfish string experiences of an inland poison center: a retrospective study of 23 cases.
Trestrail, J H; al-Mahasneh, Q M
1989-04-01
From January 1979 through March 1988, our regional poison center, located many hundreds of miles from the nearest coastal salt water, documented 23 cases of envenomation by "Lionfish" (members of genus Pterois). All cases involved specimens which were maintained in the homes of amateur aquarists. A study of patient epidemiology showed the following: patient's sex 91.3% male, 8.7% female; patients ages ranged from 17 to 50 years with an average age for males of 29.8 years and 35 years for females; the site of the envenomation accident was always in the home; the only part of the body envenomated was the hand or finger; and all of the patients were symptomatic. Symptoms noted included sharp pain, swelling, redness, bleeding, nausea, numbness, joint pain, anxiety, headache, disorientation, and dizziness. One patient had a complication of cellulitis. Treatment provided included immersion of the effected area in hot water at 40 C for 60 to 90 min, analgesics, tetanus toxoid, and antibiotics. There were no deaths noted and treatment proved effective in all cases. This paper also discusses the natural history, clinical effects, and current treatment for envenomations from these beautiful but dangerous venomous fish, which can cause poisoning exposures that are likely to be encountered by poison centers anywhere in the world.
SITE: a methodology for assessment of energy facility siting patterns. Regional studies program
International Nuclear Information System (INIS)
Frigerio, N.A.; Habegger, L.J.; King, R.F.; Hoover, L.J.; Clark, N.A.; Cobian, J.M.
1975-08-01
The timely development of the nation's energy production capacity in a manner that minimizes potential adverse local and regional impacts associated with energy facilities requires the use of sophisticated techniques for evaluation of siting alternatives and fuel cycle options. This report is a documentation of the computerized SITE methodology that has been developed for evaluating health, environmental, and socioeconomic impacts related to utilization of alternate sites for energy production within a region of interest. The cost, impact, and attribute vectors, which are generated and displayed on density maps, can be used in a multiparameter overlay process to identify preferable siting areas. The assessment of clustered facilities in energy centers is also possible within the SITE analysis framework. An application of the SITE methodology to Northern Illinois is presented. Also included is a description of the ongoing extension of SITE for the accumulative evaluation of alternative regional energy siting patterns and fuel cycle options. An appendix provides documentation and user information for the SITE computer program
Salmonellosis in Equidae: a study of 23 cases.
Morse, E V; Duncan, M A; Page, E A; Fessler, J F
1976-04-01
Salmonellosis in Equidae is a serious global problem. The prevalence may range from 0.36% to 27%. Probably 5% to 10% of the equine population in the U.S. is or has been infected. Over 40 serotypes of Salmonella have been cultured from Equidae. S. typhimurium (66.31%), S. enteritidis (9.6%), S. newport (5.16%) and S. heidelberg (4.89%) have been the most common equine isolates. The clinical and bacteriological studies of 23 naturally occurring infections in a large veterinary hospital were studied. Nine patients were infected with S. typhimurium, 8 with S. anatum, 1 with S. newport, 4 with dual serotype infections (3-S. typhimurium/S. anatum and 1 S. anatum/S. newington) and 1 untyped Salmonella. The roles of physical, surgical and environmental stress factors were analyzed. The fecal shedder state persisted for over 3 1/2 months. Feces of a foal contained 10(5) salmonella per gram. Salmonella were isolated from the feces of horses during and following antimicrobial therapy regimes. Supportive and symptomatic treatment as well as good nursing care are imperative in handling cases of equine salmonellosis.
Feasibility study for siting of a deep repository within the Storuman municipality
International Nuclear Information System (INIS)
1995-01-01
It is SKB's task to gather a broad body of information for the siting of a deep repository for Sweden's spent nuclear fuel and other long-lived radioactive waste. The criteria presented by SKB serve as guidelines for the siting studies. Overviews of siting factors are compiled in general siting studies of all or parts of Sweden. Feasibility studies examine the siting prospects in potentially suitable and interested municipalities. SKB plans to carry out feasibility studies in five to ten municipalities in different parts of the country. General studies and feasibility studies are primarily based on existing material. The feasibility study in Storuman is the first to be conducted. It began during the second half of 1993 with the conclusion of an agreement between the municipality and SKB. SKB has been in charge of the execution of the feasibility study. SKB has been responsible for the summary provided in a status report published in June 1994, as well as for the conclusions and evaluations in this final report. Altogether about 30 reports have been published within the framework of the feasibility study. The purpose of the various studies have been to describe, in as much detail as possible, the prospects for siting a deep repository in the municipality of Storuman, and to shed light on the possible positive and negative consequences of such a siting. The feasibility study has led to a discussion within the municipality and the region concerning the siting of a deep repository. In SKB's opinion, this gives all those concerned ample opportunity to become acquainted with the issues and to assert their interests and present their viewpoints at an early stage. 55 refs
A qualitative exploratory study: Using medical students' experiences ...
African Journals Online (AJOL)
2012-08-23
Aug 23, 2012 ... There is recognition of the importance of qualitative research on incentives ... an attribute, such as personality type; and secondly does ... Method. Study site. The study site was a rural district-level hospital in KwaZulu-. Natal.
Directory of Open Access Journals (Sweden)
A. Michelini
2003-06-01
Full Text Available A site response experiment was performed in the basin of Città di Castello (a small town in Central Italy in May 2001. This study is part of a project on the evaluation of seismic hazard in seismogenic areas funded by the Gruppo Nazionale Difesa dai Terremoti (GNDT. The experiment consisted of a dense fixed transect configuration with most of the stations recording in continuous mode, and several ambient noise measurements both in single station and in array configuration spread over the investigated area. The dense transect was composed of 26 seismic stations in a crosswise configuration with a maximum inter-station distance of 250 m. The stations were deployed in the southern part of the basin, from the eastern bedrock outcrop to the western edge, across the town. About 70 earthquakes were recorded during 10 days of deployment, generally low magnitude or regional events. We located 23 earthquakes and 17 of them were located using the waveform similarity approach at 4 stations outside the target area. These 4 stations were part of a dense temporary seismic network involved in a previous experiment of the same project, aimed at performing a high-resolution picture of the local seismicity. Delay analysis on the recorded waveforms allowed us to infer the basin geometry at depth and estimate the S-wave velocity of sediments. Moreover, we evaluated relative site response along the E-W transect by performing a standard spectral ratio. Amplification factors up to 9 are found inside the basin; at frequencies above 5 Hz stations closer to the edges show higher amplification, whereas stations located in the middle of the basin, where the alluvial sediments are thicker (CD11-CD14, show higher amplification below 5 Hz. We considered the average amplification in two frequency bands (1-5 Hz and 5-10 Hz, representative of the resonance frequency for 2-3 storey buildings and 1 storey houses,respectively. Our results suggest that the potential hazard for 2-3
International Nuclear Information System (INIS)
Tobiason, D. S.
2002-01-01
This annual Neutron Soil Moisture Monitoring report provides an analysis and summary for site inspections, meteorological information, and neutron soil moisture monitoring data obtained at the Area 23 Hazardous Waste Trenches Resource Conservation and Recovery Act (RCRA) unit, located in Area 23 of the Nevada Test Site, Nye County, Nevada, during the October 2000--July 2001 monitoring period. Inspections of the Area 23 Hazardous Waste Trenches RCRA unit are conducted to determine and document the physical condition of the covers, facilities, and any unusual conditions that could impact the proper operation of the waste unit closure. Physical inspections of the closure were completed quarterly and indicated that the site is in good condition with no significant findings noted. An annual subsidence survey of the elevation markers was conducted in July 2001. There has been no subsidence at any of the markers since monitoring began eight years ago. Precipitation for the period October 2000 through July 2001 was 9.42 centimeters (cm) (3.71 inches [in]) (U.S. National Weather Service, 2001). The prior year annual rainfall (January 2000 through December 2000) was 10.44 cm (4.1 1 in.). The recorded average annual rainfall for this site from 1972 to January 2000 is 14.91 cm (5.87 in.). The objective of the neutron logging program is to monitor the soil moisture conditions along 30 neutron access tubes and detect changes that may be indicative of moisture movement at a point located directly beneath each trench. All monitored access tubes are within the compliance criteria of less than 5 percent residual volumetric moisture content at the compliance point directly beneath each respective trench. Soil conditions remain dry and stable underneath the trenches
Kim, Jong Seung; Oh, Jong Seok; Kwon, Sam Hyun
2016-06-01
Sinonasal organized hematoma is a rare, benign disease that can be locally aggressive and may be mistaken for malignancy. Because of its rarity, the clinical characteristics are not well known. The aim of this study is to investigate the distinguishing features of organized hematoma with an emphasis on incidence change. In this retrospective study, we reviewed the records of 23 patients with organized hematoma confirmed histopathologically among 5,378 patients who underwent endoscopic sinus surgery performed by a single surgeon from January 1995 to December 2014 at a tertiary care center. Clinical symptoms, endoscopic photography, computed tomography, and operative findings were reviewed. We also reviewed the relevant literature. Age, sex, site, origin subsite and histopathology were investigated. A statistical review was performed using R 3.1.2 to examine incidence change. The most common complaint was frequent epistaxis and nasal obstruction (52.1%). Of the 23 patients, eight were women and 15 were men with an age range of 18 to 75 years. (mean 38.9 years). Nine of these hematomas occurred on the right side and 14 on the left side. The predominant occurrence site was the antrum (65%), followed by the septum (17.3%), inferior turbinate (8%), and ethmoid sinus (8%). The incidence steadily increased over 20 years. Investigation of the clinical characteristics and incidence change of organized hematoma can provide useful information. Through analysis of the 23 cases in our study, the age distribution was found to be bimodal and the incidence of organizing hematoma was observed to steadily increase. Clinicians should be aware of these characteristics to avoid misdiagnoses of malignant tumors.
International Nuclear Information System (INIS)
Valdezco, E.M.; Palattao, M.V.B.; Marcelo, E.A.; Caseria, E.S.; Venida, L.L.; Cruz, J.M. dela
2002-01-01
The Philippines, through the Philippine Nuclear Research Institute (PNRI), decided to conduct a study on siting a low level radioactive waste disposal facility. The infrastructure set up for this purpose, the radioactive waste disposal concept, the overall siting process, the methodology applied and preliminary results obtained are described in this paper. (author)
Feasibility study for siting of a deep repository within the Storuman municipality
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-01-01
It is SKB`s task to gather a broad body of information for the siting of a deep repository for Sweden`s spent nuclear fuel and other long-lived radioactive waste. The criteria presented by SKB serve as guidelines for the siting studies. Overviews of siting factors are compiled in general siting studies of all or parts of Sweden. Feasibility studies examine the siting prospects in potentially suitable and interested municipalities. SKB plans to carry out feasibility studies in five to ten municipalities in different parts of the country. General studies and feasibility studies are primarily based on existing material. The feasibility study in Storuman is the first to be conducted. It began during the second half of 1993 with the conclusion of an agreement between the municipality and SKB. SKB has been in charge of the execution of the feasibility study. SKB has been responsible for the summary provided in a status report published in June 1994, as well as for the conclusions and evaluations in this final report. Altogether about 30 reports have been published within the framework of the feasibility study. The purpose of the various studies have been to describe, in as much detail as possible, the prospects for siting a deep repository in the municipality of Storuman, and to shed light on the possible positive and negative consequences of such a siting. The feasibility study has led to a discussion within the municipality and the region concerning the siting of a deep repository. In SKB`s opinion, this gives all those concerned ample opportunity to become acquainted with the issues and to assert their interests and present their viewpoints at an early stage. 55 refs.
National Oceanic and Atmospheric Administration, Department of Commerce — Data are from underwater visual surveys of fish stocks at 23 sites in West Hawaii. Survey sites are 8 to 14 m deep and are all located on reef shelves with moderate...
A study of moult-site fidelity in Egyptian geese, Alopochen ...
African Journals Online (AJOL)
Little is known about moult and moult-site fidelity of African waterfowl. Satellite telemetry and uniquely engraved colour-rings were used to study moult-site fidelity of Egyptian geese marked at two sites in South Africa – Barberspan in the summer-rainfall region and Strandfontein in the winter-rainfall region. Twelve Egyptian ...
International Nuclear Information System (INIS)
1987-01-01
Cultural resources at the Deaf Smith County site will be identified, evaluated and managed through the implementation of studies detailed in the Site Study Plan for Cultural Resources. This technical procedure outlines the conduct of pedestrian survey and the documentation of identified cultural resources. The purpose of the field surveys is to identify and document cultural resources in the areas that will be affected by site characterization activities and to record the environmental setting of identified cultural resources. Three pedestrian surveys will cover 100 percent of the on-site and off-site project areas. Survey 1 will provide coverage of the Repository Surface Facility (RSF) area, which includes the Exploratory Shaft Facility (ESF) and two linear engineering design borehole (EDBH) seismic survey corridors. Survey 2 will provide coverage of a 39 km 2 (15 mi 2 ) area that includes the 23 km 2 (9 mi 2 ) Deaf Smith County site plus a 0.4 to 0.8 kM (1/4 to 1/2 mi) border area but excludes the area covered by Survey 1. Survey 3 will cover offsite geotechnical test areas, such as the locations of playa boreholes, deep playa wells, hydrologic tests, site foundation borings, and their access routes. The purpose of site documentation or recording is to address the project information needs for land use permits and approvals, engineering design support, and cultural resource evaluation for National Register of Historic Places eligibility. Site documentation will consist of gathering sufficient data on identified resources to complete Texas Natural Resource Information System (TNRIS). 7 refs., 3 figs
Jia, Huiying; Tao, Feng; Liu, Changqin; Guo, Ting; Zhu, Wei; Wang, Shu; Cui, Bin; Ning, Guang
2015-03-01
Two independent Chinese cohorts were used to study the genetic association between the interleukin-23A (IL-23A) gene polymorphism (rs11171806) and susceptibility to Graves' disease (GD). The initial Shanghai cohort consisted of 712 unrelated patients with GD and 705 healthy control subjects, and the replication cohort from Xiamen Island included 433 patients with GD and 410 healthy control subjects. The serum concentration of IL-23 in GD patients was measured significantly higher than in health controls. Moreover in the subgroup analysis, higher concentrations of IL-23 were identified in patients of older age (⩾40 years) and female gender. We also performed an association study with the IL-23 gene polymorphism rs11171806 in both cohorts, in Shanghai cohorts, the frequencies of rs11171806 alleles were strongly different between Graves' disease patients (G 95.7% and A 4.3%) and healthy controls (G 97.7% and A 2.3%) (P=2.6×10(-3), OR=1.93 (95% CI: 1.25-2.97)), and in Xiamen cohorts, the proportion of individuals carrying the A allele of rs11171806 was the same significantly higher in Graves' disease patients than in controls [Graves' disease vs. control, 4.8% vs. 4.3%, OR=2.15 (95% CI: 1.23-3.79), P(allele)=6.3×10(-3)]. The distribution of rs11171806 genotype was also investigated in subgroups according to the age and gender. All of these findings suggested that IL-23 may play an important role in the development of GD, and the IL-23A gene is a genetic risk marker for GD in Han Chinese population. Copyright © 2015 Elsevier Inc. All rights reserved.
Temml, Veronika; Kuehnl, Susanne; Schuster, Daniela; Schwaiger, Stefan; Stuppner, Hermann; Fuchs, Dietmar
2013-01-01
Mediterranean Carthamus tinctorius (Safflower) is used for treatment of inflammatory conditions and neuropsychiatric disorders. Recently C. tinctorius lignans arctigenin and trachelogenin but not matairesinol were described to interfere with the activity of tryptophan-degrading enzyme indoleamine 2,3-dioxygenase (IDO) in peripheral blood mononuclear cells in vitro. We examined a potential direct influence of compounds on IDO enzyme activity applying computational calculations based on 3D geometry of the compounds. The interaction pattern analysis and force field-based minimization was performed within LigandScout 3.03, the docking simulation with MOE 2011.10 using the X-ray crystal structure of IDO. Results confirm the possibility of an intense interaction of arctigenin and trachelogenin with the binding site of the enzyme, while matairesinol had no such effect. PMID:24251110
Site study plan for Transportation, Deaf Smith County Site, Texas: Preliminary draft
International Nuclear Information System (INIS)
1987-06-01
This site study plan describes transportation field studies to be conducted during the characterization of the Deaf Smith County, Texas, site for the US Department of Energy's Salt Repository Project. The studies are needed to identify and assess potential project impacts to transportation infrastructure and systems in the project vicinity and along potential transportation routes to the site across the State of Texas. The studies are also needed to locate and design project transportation facilities, and to evaluate and design impact mitigation. After identifying the transportation information requirements needed to comply with Federal, State, and local regulations and repository program requirements, the site study plan describes the study design and rationale, the field data collection procedures and equipment, the data analysis methods and application of results, the data management strategy, the schedule of field activities, the management of the study, and the study's quality assurance program. The field data collection activities are organized into programs for the characterization of site vicinity rail corridors and highway corridors, characterization of alternative statewide transportation routes, monitoring of site characterization effects on transportation, characterization of aircraft overflight patterns and hazardous material transportation patterns, and assessment of emergency response preparedness along alternative statewide transportation routes. 34 refs., 10 figs., 2 tabs
Sardana, Richa; White, Joshua P; Johnson, Arlen W
2013-06-01
Bud23 is responsible for the conserved methylation of G1575 of 18S rRNA, in the P-site of the small subunit of the ribosome. bud23Δ mutants have severely reduced small subunit levels and show a general failure in cleavage at site A2 during rRNA processing. Site A2 is the primary cleavage site for separating the precursors of 18S and 25S rRNAs. Here, we have taken a genetic approach to identify the functional environment of BUD23. We found mutations in UTP2 and UTP14, encoding components of the SSU processome, as spontaneous suppressors of a bud23Δ mutant. The suppressors improved growth and subunit balance and restored cleavage at site A2. In a directed screen of 50 ribosomal trans-acting factors, we identified strong positive and negative genetic interactions with components of the SSU processome and strong negative interactions with components of RNase MRP. RNase MRP is responsible for cleavage at site A3 in pre-rRNA, an alternative cleavage site for separating the precursor rRNAs. The strong negative genetic interaction between RNase MRP mutants and bud23Δ is likely due to the combined defects in cleavage at A2 and A3. Our results suggest that Bud23 plays a role at the time of A2 cleavage, earlier than previously thought. The genetic interaction with the SSU processome suggests that Bud23 could be involved in triggering disassembly of the SSU processome, or of particular subcomplexes of the processome.
An X-ray absorption spectroscopic study of the metal site preference in Al1-xGaxFeO3
Walker, James D. S.; Grosvenor, Andrew P.
2013-01-01
Magnetoelectric materials have potential for being introduced into next generation technologies, especially memory devices. The AFeO3 (Pna21; A=Al, Ga) system has received attention to better understand the origins of magnetoelectric coupling. The magnetoelectric properties this system exhibits depend on the amount of anti-site disorder present, which is affected by the composition and the method of synthesis. In this study, Al1-xGaxFeO3 was synthesized by the ceramic method and studied by X-ray absorption spectroscopy. Al L2,3-, Ga K-, and Fe K-edge spectra were collected to examine how the average metal coordination number changes with composition. Examination of XANES spectra from Al1-xGaxFeO3 indicate that with increasing Ga content, Al increasingly occupies octahedral sites while Ga displays a preference for occupying the tetrahedral site. The Fe K-edge spectra indicate that more Fe is present in the tetrahedral site in AlFeO3 than in GaFeO3, implying more anti-site disorder is present in AlFeO3.
An X-ray absorption spectroscopic study of the metal site preference in Al1−xGaxFeO3
International Nuclear Information System (INIS)
Walker, James D.S.; Grosvenor, Andrew P.
2013-01-01
Magnetoelectric materials have potential for being introduced into next generation technologies, especially memory devices. The AFeO 3 (Pna2 1 ; A=Al, Ga) system has received attention to better understand the origins of magnetoelectric coupling. The magnetoelectric properties this system exhibits depend on the amount of anti-site disorder present, which is affected by the composition and the method of synthesis. In this study, Al 1−x Ga x FeO 3 was synthesized by the ceramic method and studied by X-ray absorption spectroscopy. Al L 2,3 -, Ga K-, and Fe K-edge spectra were collected to examine how the average metal coordination number changes with composition. Examination of XANES spectra from Al 1−x Ga x FeO 3 indicate that with increasing Ga content, Al increasingly occupies octahedral sites while Ga displays a preference for occupying the tetrahedral site. The Fe K-edge spectra indicate that more Fe is present in the tetrahedral site in AlFeO 3 than in GaFeO 3 , implying more anti-site disorder is present in AlFeO 3 . - Graphical abstract: Al 1−x Ga x FeO 3 has been investigated by XANES. Through examination of Al L 2,3 -, Ga K-, and Fe K-edge XANES spectra, it was found that more anti-site disorder of the Fe atoms is present in AlFeO 3 compared to in GaFeO 3 . Highlights: ► Al 1−x Ga x FeO 3 was investigated by X-ray absorption spectroscopy. ► Ga prefers to occupy the tetrahedral site in Al 1−x Ga x FeO 3 . ► Fe prefers to occupy the octahedral sites in Al 1−x Ga x FeO 3 as x increases. ► More anti-site disorder is present in AlFeO 3 compared to in GaFeO 3.
International Nuclear Information System (INIS)
Yaffee, S.L.; Miller, C.A.
1974-11-01
The ''AEC-Maryland Regional Siting Factors Study'' examines the process of siting in a regional context. It is developing an analysis method to delineate candidate areas for siting of several power plant technology packages, including both fossil-fueled and nuclear options. Tools that are being used include simulation modeling, economic and demographic forecasting, spatial analysis, and computer graphics and numerical manipulation. The approach will describe the trade-offs incurred if a power plant is located in one candidate area rather than in another. In FY 1974, a suitability analysis method was developed which uses engineering and environmental parameters to define a level of environmental cost incurred if a segment of land is used to site a specific technology package. (U.S.)
Chen, Wei; Melamed, Michal L; Hostetter, Thomas H; Bauer, Carolyn; Raff, Amanda C; Almudevar, Anthony L; Lalonde, Amy; Messing, Susan; Abramowitz, Matthew K
2016-08-05
The regulation of fibroblast growth factor-23 (FGF23) secretion in patients with chronic kidney disease (CKD) is incompletely understood. An in vitro study showed that metabolic acidosis increased FGF23 in mouse bone. The objective of this study is to evaluate the effect of oral sodium bicarbonate on circulating FGF23 levels in patients with CKD. This was a single-blind pilot study. Twenty adults with estimated glomerular filtration rate between 15-45 mL/min/1.73 m(2) and serum bicarbonate between 20-24 mEq/L were treated with placebo for 2 weeks, followed by increasing doses of oral sodium bicarbonate (0.3, 0.6 and 1.0 mEq/kg/day) in 2 week intervals for a total of 6 weeks. C-terminal FGF23 levels were measured at the initial visit, after 2 weeks of placebo and after 6 weeks of bicarbonate therapy. Wilcoxon matched-pairs signed-rank test was used to compare FGF23 before and after sodium bicarbonate. After 6 weeks of oral sodium bicarbonate, the median FGF23 increased significantly from 150.9 RU/mL (IQR 107.7-267.43) to 191.4 RU/mL (IQR 132.6-316.9) (p = 0.048) and this persisted after excluding participants who received activated vitamin D. FGF23 increased after short-term oral sodium bicarbonate therapy in patients with CKD and mild metabolic acidosis. It is unclear whether this was due to the alkalinizing effect of sodium bicarbonate or other factors. The study was registered at ClinicalTrials.gov ( NCT00888290 ) on April 23, 2009.
Discovering How Students Search a Library Web Site: A Usability Case Study.
Augustine, Susan; Greene, Courtney
2002-01-01
Discusses results of a usability study at the University of Illinois Chicago that investigated whether Internet search engines have influenced the way students search library Web sites. Results show students use the Web site's internal search engine rather than navigating through the pages; have difficulty interpreting library terminology; and…
Reactive sites influence in PMMA oligomers reactivity: a DFT study
Paz, C. V.; Vásquez, S. R.; Flores, N.; García, L.; Rico, J. L.
2018-01-01
In this work, we present a theoretical study of methyl methacrylate (MMA) living anionic polymerization. The study was addressed to understanding two important experimental observations made for Michael Szwarc in 1956. The unexpected effect of reactive sites concentration in the propagation rate, and the self-killer behavior of MMA (deactivating of living anionic polymerization). The theoretical calculations were performed by density functional theory (DFT) to obtain the frontier molecular orbitals values. These values were used to calculate and analyze the chemical interaction descriptors in DFT-Koopmans’ theorem. As a result, it was observed that the longest chain-length species (related with low concentration of reactive sites) exhibit the highest reactivity (behavior associated with the increase of the propagation rate). The improvement in this reactivity was attributed to the crosslinking produced in the polymethyl methacrylate chains. Meanwhile, the self-killer behavior was associated with the intermolecular forces present in the reactive sites. This behavior was associated to an obstruction in solvation, since the active sites remained active through all propagation species. The theoretical results were in good agreement with the Szwarc experiments.
Gaiser, Edward C; Gallezot, Jean-Dominique; Worhunsky, Patrick D; Jastreboff, Ania M; Pittman, Brian; Kantrovitz, Lauren; Angarita, Gustavo A; Cosgrove, Kelly P; Potenza, Marc N; Malison, Robert T; Carson, Richard E; Matuskey, David
2016-12-01
Most prior work with positron emission tomography (PET) dopamine subtype 2/3 receptor (D 2/3 R) non-selective antagonist tracers suggests that obese (OB) individuals exhibit lower D 2/3 Rs when compared with normal weight (NW) individuals. A D 3 -preferring D 2/3 R agonist tracer, [ 11 C](+)PHNO, has demonstrated that body mass index (BMI) was positively associated with D 2/3 R availability within striatal reward regions. To date, OB individuals have not been studied with [ 11 C](+)PHNO. We assessed D 2/3 R availability in striatal and extrastriatal reward regions in 14 OB and 14 age- and gender-matched NW individuals with [ 11 C](+)PHNO PET utilizing a high-resolution research tomograph. Additionally, in regions where group D 2/3 R differences were observed, secondary analyses of 42 individuals that constituted an overweight cohort was done to study the linear association between BMI and D 2/3 R availability in those respective regions. A group-by-brain region interaction effect (F 7, 182 =2.08, p=0.047) was observed. Post hoc analyses revealed that OB individuals exhibited higher tracer binding in D 3 -rich regions: the substantia nigra/ventral tegmental area (SN/VTA) (+20%; p=0.02), ventral striatum (VST) (+14%; p<0.01), and pallidum (+11%; p=0.02). BMI was also positively associated with D 2/3 R availability in the SN/VTA (r=0.34, p=0.03), VST (r=0.36, p=0.02), and pallidum (r=0.30, p=0.05) across all subjects. These data suggest that individuals who are obese have higher D 2/3 R availability in brain reward regions densely populated with D 3 Rs, potentially identifying a novel pharmacologic target for the treatment of obesity.
Report of JLC site study group
Hasegawa, T; Yamashita, S
2003-01-01
This study group selected some good sites for construction of JLC (Electron-Positron Linear Collider) on the basis of investigation of data and field survey. The aims, activity, use of underground of private land, conditions of site, selection of site at present and future, summary and proposal are reported. 9 sites (Hidaka, Kitakami, Murayama, Abukuma, Kitaibaraki, Aichi and Gifu, Takamatsu, Hiroshima and Seburi range) are selected for the construction on the basis of firm ground and 4 sites (Okinawa, Harima, Tsukuba and Mutsuogawara) for development and researches. 9 sites area consists of plutonic rock or old strata of Paleozoic era. Many problems in each site are reported. There are three following proposals; 1) the self-governing communities of the sites have to understand JLC and start to construct it by information, 2) a site evaluation committee consists of specialist of civil engineering, building, social and natural environment and disaster prevention and 3) the vibration test should be carried out ...
Closure report for CAU No. 450: Historical UST release sites, Nevada Test Site. Volume 2
International Nuclear Information System (INIS)
1997-09-01
This report addresses the closure of 11 historical underground storage tank release sites within various areas of the Nevada Test Site. This report contains remedial verification of the soil sample analytical results for the following: Area 11 Tweezer facility; Area 12 boiler house; Area 12 service station; Area 23 bypass yard; Area 23 service station; Area 25 power house; Area 25 tech. services building; Area 25 tech. operations building; Area 26 power house; and Area 27 boiler house
Behavior-based safety on construction sites: a case study.
Choudhry, Rafiq M
2014-09-01
This work presents the results of a case study and describes an important area within the field of construction safety management, namely behavior-based safety (BBS). This paper adopts and develops a management approach for safety improvements in construction site environments. A rigorous behavioral safety system and its intervention program was implemented and deployed on target construction sites. After taking a few weeks of safety behavior measurements, the project management team implemented the designed intervention and measurements were taken. Goal-setting sessions were arranged on-site with workers' participation to set realistic and attainable targets of performance. Safety performance measurements continued and the levels of performance and the targets were presented on feedback charts. Supervisors were asked to give workers recognition and praise when they acted safely or improved critical behaviors. Observers were requested to have discussions with workers, visit the site, distribute training materials to workers, and provide feedback to crews and display charts. They were required to talk to operatives in the presence of line managers. It was necessary to develop awareness and understanding of what was being measured. In the process, operatives learned how to act safely when conducting site tasks using the designed checklists. Current weekly scores were discussed in the weekly safety meetings and other operational site meetings with emphasis on how to achieve set targets. The reliability of the safety performance measures taken by the company's observers was monitored. A clear increase in safety performance level was achieved across all categories: personal protective equipment; housekeeping; access to heights; plant and equipment, and scaffolding. The research reveals that scores of safety performance at one project improved from 86% (at the end of 3rd week) to 92.9% during the 9th week. The results of intervention demonstrated large decreases in
Sliem, Hamdy; Tawfik, Gamal; Moustafa, Fadia; Zaki, Heba
2011-01-01
Introduction: Secondary hyperparathyroidism (SHPT) is an insidious disease that develops early in the course of chronic kidney disease (CKD) and increases in severity as the glomerular filtration rate deteriorates. Recent studies have identified fibroblast growth factor-23 (FGF23) as a new protein with phosphaturic activity. It is mainly secreted by osteoblasts and is now considered the most important factor for regulation of phosphorus homeostasis. It is not yet proven if there is any direct relation between parathyroid hormone (PTH) and FGF23. The present study aims to evaluate the relation between serum FGF23, phosphorus, and PTH in end-stage renal disease in patients with SHPT on regular hemodialysis. Materials and Methods: Forty-six consecutive CKD adult patients (case group) and 20 healthy adults (control group) were included in the study. All patients had SHPT and were on regular hemodialysis. Both groups were subjected to full medical history, clinical examination and biochemical studies. Serum phosphorus, calcium, ferritin, hemoglobin level, blood urea, creatinine, PTH, and FGF23 were analyzed. Results: Levels of FGF23 were significantly higher in the case group in comparison with those in the control group, viz., 4-fold, and positively correlated with PTH. Phosphorus levels in the case group were significantly high in spite of the increasing levels of FGF23. Both PTH and FGF23 were positively correlated with phosphorus and negatively with hemoglobin levels. Conclusion: SHPT and FGF23 may have a partial role in the development of anemia in patients with CKD. FGF23 could be a central factor in the pathogenesis of SHPT. Its role in controlling hyperphosphatemia in CKD is vague. PMID:21731867
Directory of Open Access Journals (Sweden)
Hamdy Sliem
2011-01-01
Full Text Available Introduction: Secondary hyperparathyroidism (SHPT is an insidious disease that develops early in the course of chronic kidney disease (CKD and increases in severity as the glomerular filtration rate deteriorates. Recent studies have identified fibroblast growth factor-23 (FGF23 as a new protein with phosphaturic activity. It is mainly secreted by osteoblasts and is now considered the most important factor for regulation of phosphorus homeostasis. It is not yet proven if there is any direct relation between parathyroid hormone (PTH and FGF23. The present study aims to evaluate the relation between serum FGF23, phosphorus, and PTH in end-stage renal disease in patients with SHPT on regular hemodialysis. Materials and Methods: Forty-six consecutive CKD adult patients (case group and 20 healthy adults (control group were included in the study. All patients had SHPT and were on regular hemodialysis. Both groups were subjected to full medical history, clinical examination and biochemical studies. Serum phosphorus, calcium, ferritin, hemoglobin level, blood urea, creatinine, PTH, and FGF23 were analyzed. Results: Levels of FGF23 were significantly higher in the case group in comparison with those in the control group, viz., 4-fold, and positively correlated with PTH. Phosphorus levels in the case group were significantly high in spite of the increasing levels of FGF23. Both PTH and FGF23 were positively correlated with phosphorus and negatively with hemoglobin levels. Conclusion: SHPT and FGF23 may have a partial role in the development of anemia in patients with CKD. FGF23 could be a central factor in the pathogenesis of SHPT. Its role in controlling hyperphosphatemia in CKD is vague.
Directory of Open Access Journals (Sweden)
Jun Ni
Full Text Available The Auxin/Indole-3-Acetic Acid (Aux/IAA and Auxin Response Factor (ARF are two important families that play key roles in auxin signal transduction. Both of the families contain a similar carboxyl-terminal domain (Domain III/IV that facilitates interactions between these two families. In spite of the importance of protein-protein interactions among these transcription factors, the mechanisms involved in these interactions are largely unknown. In this study, we isolated six intragenic suppressors of an auxin insensitive mutant, Osiaa23. Among these suppressors, Osiaa23-R5 successfully rescued all the defects of the mutant. Sequence analysis revealed that an amino acid substitution occurred in the Tryptophan (W residue in Domain IV of Osiaa23. Yeast two-hybrid experiments showed that the mutation in Domain IV prevents the protein-protein interactions between Osiaa23 and OsARFs. Phylogenetic analysis revealed that the W residue is conserved in both OsIAAs and OsARFs. Next, we performed site-specific amino acid substitutions within Domain IV of OsARFs, and the conserved W in Domain IV was exchanged by Serine (S. The mutated OsARF(WSs can be released from the inhibition of Osiaa23 and maintain the transcriptional activities. Expression of OsARF(WSs in Osiaa23 mutant rescued different defects of the mutant. Our results suggest a previously unknown importance of Domain IV in both families and provide an indirect way to investigate functions of OsARFs.
Energy Technology Data Exchange (ETDEWEB)
Sloop, Christy
2013-04-01
This Corrective Action Decision Document/Closure Report presents information supporting the closure of Corrective Action Unit (CAU) 569: Area 3 Yucca Flat Atmospheric Test Sites, Nevada National Security Site, Nevada. CAU 569 comprises the following nine corrective action sites (CASs): • 03-23-09, T-3 Contamination Area • 03-23-10, T-3A Contamination Area • 03-23-11, T-3B Contamination Area • 03-23-12, T-3S Contamination Area • 03-23-13, T-3T Contamination Area • 03-23-14, T-3V Contamination Area • 03-23-15, S-3G Contamination Area • 03-23-16, S-3H Contamination Area • 03-23-21, Pike Contamination Area The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation that no further corrective action is needed for CAU 569 based on the implementation of the corrective actions listed in Table ES-2.
Site Response Analysis Using DeepSoil: Case Study of Bangka Site, Indonesia
Energy Technology Data Exchange (ETDEWEB)
Iswanto, Eko Rudi; Yee, Eric [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)
2015-10-15
Indonesia government declared through Act No. 17 year 2007 on the National Long-Term Development Plant Year 2005-2025 and Presidential Decree No. 5 year 2006 on the National Energy Policy (Indonesia 2007; Indonesia 2006), that nuclear energy is stated as a part of the national energy system. In order to undertake the above national policy, National Nuclear Energy Agency of Indonesia, as the promotor for the utilization of nuclear energy will conduct site study, which is a part of infrastructure preparation for NPP construction. Thorough preparation and steps are needed to operate an NPP and it takes between 10 to 15 years from the preliminary study (site selection, financial study, etc.) up to project implementation (manufacturing, construction, commissioning). During project implementation, it is necessary to prepare various documents relevant for permit application such as Safety Evaluation Report for site permit, Preliminary Safety Analysis Report and Environment Impact Assessment Report for construction permit. Considering the continuously increasing electricity energy demand, it is necessary to prepare for alternative NPP sites. The safety requirements of NPP's are stringent; amongst the various requirements is the ability to safely shut down in the wake of a possible earthquake. Ground response analysis of a potential site therefore needs to be carried out, parameter that affect the resistance of an NPP to earthquakes such as peak strain profiles is analysed. The objective of this paper is to analyse the ground response of the selected site for a NPP, using The Mw 7.9 in Sikuai Island, West Sumatra on September 12, 2007 as present input motion. This analysis will be carried out using a ground response analysis program, DeepSoil. In addition to this, an attempt was made to define the site specific input motion characteristics of the selected site for use in DeepSoil (DeepSoil 5.0). A site investigation at the WB site was performed primarily on the PS
A Study of Social Networking Sites for Learners of Japanese
Directory of Open Access Journals (Sweden)
Fusako Ota
2011-01-01
Full Text Available Social Networking Sites (SNSs such as “Facebook” and “MySpace” have been used by many people from different countries around the world, and they have recently been applied to second language (L2 learning, both inside and outside classrooms. A number of researchers have investigated the utility of SNSs, and some language researchers have studied the use of SNSs for L2 learning in language classrooms. However, the study of the usage of SNSs for L2 learning outside the classroom has not yet been studied thoroughly, despite the fact that many communities and groups exist for users who are interested in learning L2 on such sites. This article examines the nature and extent of SNS communities available specifically for L2 learners of Japanese, and describes the usage which is being made of these communities in particular on the SNSs, “mixi” and “Facebook”. Furthermore, the beneficial aspects of using such sites for L2 learning will be discussed.
Directory of Open Access Journals (Sweden)
Fagbohun B.J.
2016-09-01
Full Text Available A major challenge in most growing urban areas of developing countries, without a pre-existing land use plan is the sustainable and efficient management of solid wastes. Siting a landfill is a complicated task because of several environmental regulations. This challenge gives birth to the need to develop efficient strategies for the selection of proper waste disposal sites in accordance with all existing environmental regulations. This paper presents a knowledge-based multi-criteria decision analysis using GIS for the selection of suitable landfill site in Ado-Ekiti, Nigeria. In order to identify suitable sites for landfill, seven factors - land use/cover, geology, river, soil, slope, lineament and roads - were taken into consideration. Each factor was classified and ranked based on prior knowledge about the area and existing guidelines. Weights for each factor were determined through pair-wise comparison using Saaty’s 9 point scale and AHP. The integration of factors according to their weights using weighted index overlay analysis revealed that 39.23 km2 within the area was suitable to site a landfill. The resulting suitable area was classified as high suitability covering 6.47 km2 (16.49%, moderate suitability 25.48 km2 (64.95% and low suitability 7.28 km2 (18.56% based on their overall weights.
Test-retest and between-site reliability in a multicenter fMRI study.
Friedman, Lee; Stern, Hal; Brown, Gregory G; Mathalon, Daniel H; Turner, Jessica; Glover, Gary H; Gollub, Randy L; Lauriello, John; Lim, Kelvin O; Cannon, Tyrone; Greve, Douglas N; Bockholt, Henry Jeremy; Belger, Aysenil; Mueller, Bryon; Doty, Michael J; He, Jianchun; Wells, William; Smyth, Padhraic; Pieper, Steve; Kim, Seyoung; Kubicki, Marek; Vangel, Mark; Potkin, Steven G
2008-08-01
In the present report, estimates of test-retest and between-site reliability of fMRI assessments were produced in the context of a multicenter fMRI reliability study (FBIRN Phase 1, www.nbirn.net). Five subjects were scanned on 10 MRI scanners on two occasions. The fMRI task was a simple block design sensorimotor task. The impulse response functions to the stimulation block were derived using an FIR-deconvolution analysis with FMRISTAT. Six functionally-derived ROIs covering the visual, auditory and motor cortices, created from a prior analysis, were used. Two dependent variables were compared: percent signal change and contrast-to-noise-ratio. Reliability was assessed with intraclass correlation coefficients derived from a variance components analysis. Test-retest reliability was high, but initially, between-site reliability was low, indicating a strong contribution from site and site-by-subject variance. However, a number of factors that can markedly improve between-site reliability were uncovered, including increasing the size of the ROIs, adjusting for smoothness differences, and inclusion of additional runs. By employing multiple steps, between-site reliability for 3T scanners was increased by 123%. Dropping one site at a time and assessing reliability can be a useful method of assessing the sensitivity of the results to particular sites. These findings should provide guidance toothers on the best practices for future multicenter studies.
Directory of Open Access Journals (Sweden)
S. K. M. Abujayyab
2015-10-01
Full Text Available This paper briefly introduced the theory and framework of geospatial site selection (GSS and discussed the application and framework of artificial neural networks (ANNs. The related literature on the use of ANNs as decision rules in GSS is scarce from 2000 till 2015. As this study found, ANNs are not only adaptable to dynamic changes but also capable of improving the objectivity of acquisition in GSS, reducing time consumption, and providing high validation. ANNs make for a powerful tool for solving geospatial decision-making problems by enabling geospatial decision makers to implement their constraints and imprecise concepts. This tool offers a way to represent and handle uncertainty. Specifically, ANNs are decision rules implemented to enhance conventional GSS frameworks. The main assumption in implementing ANNs in GSS is that the current characteristics of existing sites are indicative of the degree of suitability of new locations with similar characteristics. GSS requires several input criteria that embody specific requirements and the desired site characteristics, which could contribute to geospatial sites. In this study, the proposed framework consists of four stages for implementing ANNs in GSS. A multilayer feed-forward network with a backpropagation algorithm was used to train the networks from prior sites to assess, generalize, and evaluate the outputs on the basis of the inputs for the new sites. Two metrics, namely, confusion matrix and receiver operating characteristic tests, were utilized to achieve high accuracy and validation. Results proved that ANNs provide reasonable and efficient results as an accurate and inexpensive quantitative technique for GSS.
Directory of Open Access Journals (Sweden)
van Rooyen Elise
2008-07-01
Full Text Available Abstract Background Scaling up the implementation of new health care interventions can be challenging and demand intensive training or retraining of health workers. This paper reports on the results of testing the effectiveness of two different kinds of face-to-face facilitation used in conjunction with a well-designed educational package in the scaling up of kangaroo mother care. Methods Thirty-six hospitals in the Provinces of Gauteng and Mpumalanga in South Africa were targeted to implement kangaroo mother care and participated in the trial. The hospitals were paired with respect to their geographical location and annual number of births. One hospital in each pair was randomly allocated to receive either 'on-site' facilitation (Group A or 'off-site' facilitation (Group B. Hospitals in Group A received two on-site visits, whereas delegates from hospitals in Group B attended one off-site, 'hands-on' workshop at a training hospital. All hospitals were evaluated during a site visit six to eight months after attending an introductory workshop and were scored by means of an existing progress-monitoring tool with a scoring scale of 0–30. Successful implementation was regarded as demonstrating evidence of practice (score >10 during the site visit. Results There was no significant difference between the scores of Groups A and B (p = 0.633. Fifteen hospitals in Group A and 16 in Group B demonstrated evidence of practice. The median score for Group A was 16.52 (range 00.00–23.79 and that for Group B 14.76 (range 07.50–23.29. Conclusion A previous trial illustrated that the implementation of a new health care intervention could be scaled up by using a carefully designed educational package, combined with face-to-face facilitation by respected resource persons. This study demonstrated that the site of facilitation, either on site or at a centre of excellence, did not influence the ability of a hospital to implement KMC. The choice of outreach
International Nuclear Information System (INIS)
Durham, L.A.; Peterson, J.M.; Frothingham, D.G.; Frederick, W.T.; Lenart, W.
2008-01-01
The US Army Corps of Engineers (USACE) is addressing radiological contamination following Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) requirements at the Shallow Land Disposal Area (SLDA) site, which is a radiologically contaminated property that is part of the Formerly utilized Sites Remedial Action Program (FUSRAP). The SLDA is an 18-hectare (44-acre) site in Parks township, Armstrong County, Pennsylvania, about 37 kilometers (23 miles) east-northeast of Pittsburgh. According to historical record, radioactive wastes were disposed of at the SLDA in a series of trenches by the Nuclear Materials and Equipment Company (NUMEC) in the 1960s. The wastes originated from the nearby Apollo nuclear fuel fabrication facility, which began operations under NUMEC in the late 1950s and fabricated enriched uranium into naval reactor fuel elements. It is believed that the waste materials were buried in a series of pits constructed adjacent to one another in accordance with an Atomic Energy Commission (AEC) regulation that has since been rescinded. A CERCLA remedial investigation/feasibility study (RI/FS) process was completed for the SLDA site, and the results of the human health risk assessment indicated that the radiologically contaminated wastes could pose a risk to human health in the future. There are no historical records that provide the exact location of these pits. However, based on geophysical survey results conducted in the 1980s, these pits were defined by geophysical anomalies and were depicted on historical site drawings as trenches. At the SLDA site, a combination of investigative methods and tools was used in the RI/FS and site characterization activities. The SLDA site provides an excellent example of how historical documents and data, historical aerial photo analysis, physical sampling, and nonintrusive geophysical and gamma walkover surveys were used in combination to reduce the uncertainty in the location of the trenches. The
A systematic review of laparoscopic port site hernias in gastrointestinal surgery.
LENUS (Irish Health Repository)
Owens, M
2012-02-01
INTRODUCTION: Port site hernia is an important yet under-recognised complication of laparoscopic surgery, which carries a high risk of strangulation due to the small size of the defect involved. The purpose of this study was to examine the incidence, classification, and pathogenesis of this complication, and to evaluate strategies to prevent and treat it. METHODS: Medline was searched using the words "port site hernia", "laparoscopic port hernia" "laparoscopic complications" and "trocar site hernias". The search was limited to articles on cholecystectomy, colorectal, bariatric or anti-reflux surgery published in English. A total of 42 articles were analysed and of these 35 were deemed eligible for review. Inclusion criteria were laparoscopic gastrointestinal surgery in English only with reported incidence of port site herniation. Studies were excluded if insufficient data was provided. Eligible studies were also cross-referenced. RESULTS: Analysis of 11,699 patients undergoing laparoscopic gastrointestinal procedures demonstrated an incidence of port site hernias of 0.74% with a mean follow-up of 23.9 months. The lowest incidence of port site herniation was for bariatric surgery with 0.57% in 2644 patients with a mean follow-up of 67.4 months while the highest incidence was for laparoscopic colorectal surgery with an incidence of 1.47% in 477 patients with a mean follow-up of 71.5 months. CONCLUSION: All fascial defects larger than or equal to 10mm should be closed with peritoneum, while smaller defects may require closure in certain circumstances to prevent herniation. Laparoscopic port site herniation is a completely preventable cause of morbidity that requires a second surgical procedure to repair.
International Nuclear Information System (INIS)
Nacht, S.
1999-01-01
The Mercury Fire Training Pit is a former fire training area located in Area 23 of the Nevada Test Site (NTS). The Mercury Fire Training Pit was used from approximately 1965 to the early 1990s to train fire-fighting personnel at the NTS, and encompasses an area approximately 107 meters (m) (350 feet [ft]) by 137 m (450 ft). The Mercury Fire Training Pit formerly included a bermed burn pit with four small burn tanks, four large above ground storage tanks an overturned bus, a telephone pole storage area, and areas for burning sheds, pallets, and cables. Closure activities will include excavation of the impacted soil in the aboveground storage tank and burn pit areas to a depth of 1.5 m (5 ft), and excavation of the impacted surface soil downgradient of the former ASTs and burnpit areas to a depth of 0.3 m (1 ft). Excavated soil will be disposed in the Area 6 Hydrocarbon Landfill at the NTS
International Nuclear Information System (INIS)
Hsieh, Hui-Chuan; Hsieh, Yi-Hsuan; Huang, Yu-Hsin; Shen, Fan-Ching; Tsai, Han-Ni; Tsai, Jui-He; Lai, Yu-Ting; Wang, Yu-Ting; Chuang, Woei-Jer; Huang, Wenya
2005-01-01
HHR23A and hHR23B are the human homologs of Saccharomyces cerevisiae Rad23. hHR23B is associated with the nucleotide excision repair (NER) factor xeroderma pigmentosum C (XPC) protein and is required for global genome repair. The function of hHR23A is not yet clear. In this study, the potential function of the hHR23A protein was investigated using RNA interference techniques. The hHR23A knock-down (KD) construct diminished the RNA level of hHR23A protein by approximately 60%, and it did not interfere with expression of the hHR23B gene. Based on Southwestern immunoblot and host-cell reactivation assays, hHR23A KD cells were found to be deficient in DNA repair activity against the DNA damage caused by UVC irradiation. In these hHR23A KD cells, the XPC gene was not normally induced by UVC irradiation, indicating that the hHR23A protein is involved in NER through regulation of the DNA damage recognition protein XPC. Co-immunoprecipitation experiments revealed that hHR23A was associated with a small portion of hHR23B and the majority of p53 protein, indicating that hHR23A regulates the function of XPC by its association with the NER activator p53
Site characterization studies in the NWTS program
International Nuclear Information System (INIS)
Shipler, D.; Evans, G.
1980-01-01
The US Department of Energy (DOE) has the responsibility to identify sites and construct and operate facilities for the storage or isolation of spent fuel and/or reprocessing radioactive wastes from commercial nuclear power plants. The National Waste Terminal Storage (NWTS) Program has been initiated by the DOE to develop the technology and demonstrate the feasibility of burial and isolation of high level radioactive waste in deep geologic formations. The NTWS Program plan which sets forth the criteria, procedures, and other considerations required to characterize and select a site in a comprehensive stepwise manner is discussed. The plan is not specific to any given geologic medium but serves as a guide for site selection in any geohydrologic system deemed appropriate for consideration for a deep geologic repository. The plan will be used by all NWTS Project Offices in the conduct of their site characterization program. The plan will be updated, as warranted, to reflect technology development, National policies, rulemakings by regulatory agencies, and other changing political, social, and institutional considerations. Site characterization begins with the identification of regions believed to have suitable geologic, hydrologic, and environmental characteristics for repository siting. This is followed by an iterative process of data collection and analysis to identify areas and locations which appear most suitable for further investigations. In addition, screening studies of the DOE's nuclear complexes has led to the selection of the Nevada Test Site and the Hanford Site for further characterization studies. The site characterization process results in a number of candidate sites from which a site will be selected and proposed to the NRC for licensing
Ecological and radioecological studies of nuclear installation sites
International Nuclear Information System (INIS)
Caries, J. C.; Hugon, J.; Grauby, A.
1988-01-01
The site study method consists of a dynamic and estimated analysis and of following up the release impact on all natural or non natural media compartments that take a part in the protection of man and his environment. The stages of knowing a nuclear site include the site preliminary radioecological evaluation, diffusion parameters evaluation, the quantification of factors of radioelements transfer to man, the ecological baseline carrying out, the radioactive baseline establishment, the radioecological synthesis of the results, the site radioactive and ecological control. This method applys to selection and detailed study of site. 1 tab., 7 refs. (F.M.)
Corrosion Studies of Wrought and Cast NASA-23 Alloy
Danford, M. D.
1997-01-01
Corrosion studies were carried out for wrought and cast NASA-23 alloy using electrochemical methods. The scanning reference electrode technique (SRET), the polarization resistance technique (PR), and the electrochemical impedance spectroscopy (EIS) were employed. These studies corroborate the findings of stress corrosion studies performed earlier, in that the material is highly resistant to corrosion.
Sternoe study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Nordqvist, R.; Tiren, S.; Ljunggren, C.; Voss, C.
1992-01-01
During the period from 1977-1986 SKB (Swedish Nuclear Fuel and Waste Management Co) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the previously investigated study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favourable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concerns the Sternoe study site. This site was one of the first sites to be investigated by SKB . The studies at Sternoe were made under severe time-constraints and with prototype borehole instrumentations. These limitations should be kept in mind when reading the report. (41 refs., 16 figs., 12 tabs.) (au)
Gideaa study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Nordqvist, R.; Ljunggren, C.; Tiren, S.; Voss, C.
1991-10-01
During the period from 1977-1986 SKB (Swedish Nuclear Fuel and Waste Management Co) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other site with geological and/or socio-economical characteristics judged more favourable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concerns the Gideaa study site. (au)
Kamlunge study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Andersson, P.; Ittner, T.; Tiren, S.; Ljunggren, C.
1992-05-01
During the period from 1977-1986 SKB (Swedish nuclear Fuel and Waste Management Co.) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favourable may very well be selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concerns the Kamlunge study site. (79 refs.) (au)
International Nuclear Information System (INIS)
Grant Evenson
2006-01-01
Corrective Action Unit (CAU) 139 is located in Areas 3, 4, 6, and 9 of the Nevada Test Site, which is 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 139 is comprised of the seven corrective action sites (CASs) listed below: (1) 03-35-01, Burn Pit; (2) 04-08-02, Waste Disposal Site; (3) 04-99-01, Contaminated Surface Debris; (4) 06-19-02, Waste Disposal Site/Burn Pit; (5) 06-19-03, Waste Disposal Trenches; (6) 09-23-01, Area 9 Gravel Gertie; and (7) 09-34-01, Underground Detection Station. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives with the exception of CASs 09-23-01 and 09-34-01. Regarding these two CASs, CAS 09-23-01 is a gravel gertie where a zero-yield test was conducted with all contamination confined to below ground within the area of the structure, and CAS 09-34-01 is an underground detection station where no contaminants are present. Additional information will be obtained by conducting a corrective action investigation (CAI) before evaluating corrective action alternatives and selecting the appropriate corrective action for the other five CASs where information is insufficient. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on January 4, 2006, by representatives of the Nevada Division of Environmental Protection; U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office; Stoller-Navarro Joint Venture; and Bechtel Nevada. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 139
Energy Technology Data Exchange (ETDEWEB)
Patrick Matthews
2012-08-01
CAU 570 comprises the following six corrective action sites (CASs): • 02-23-07, Atmospheric Test Site - Tesla • 09-23-10, Atmospheric Test Site T-9 • 09-23-11, Atmospheric Test Site S-9G • 09-23-14, Atmospheric Test Site - Rushmore • 09-23-15, Eagle Contamination Area • 09-99-01, Atmospheric Test Site B-9A These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on April 30, 2012, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 570. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The presence and nature of contamination at CAU 570 will be evaluated based on information collected from a field investigation. Radiological contamination will be evaluated based on a comparison of the total effective dose at sample locations to the dose-based final action level. The total effective dose will be calculated as the total of separate estimates of internal and external dose. Results from the analysis of soil samples will be used to calculate internal radiological
Fjaellveden study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Nordqvist, R.; Ljunggren, C.; Tiren, S.; Voss, C.
1991-10-01
During the period from 1977-1986 SKB (Swedish Nuclear Fuel and Waste Management CO) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favourable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need for complementary investigations. This report concerns the Fjaellveden study site. (au)
Energy Technology Data Exchange (ETDEWEB)
Patrick Matthews
2012-09-01
CAU 366 comprises six corrective action sites (CASs): • 11-08-01, Contaminated Waste Dump #1 • 11-08-02, Contaminated Waste Dump #2 • 11-23-01, Radioactively Contaminated Area A • 11-23-02, Radioactively Contaminated Area B • 11-23-03, Radioactively Contaminated Area C • 11-23-04, Radioactively Contaminated Area D The purpose of this CADD is to identify and provide the rationale for the recommendation of corrective action alternatives (CAA) for the six CASs within CAU 366. Corrective action investigation (CAI) activities were performed from October 12, 2011, to May 14, 2012, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 366: Area 11 Plutonium Valley Dispersion Sites.
DEFF Research Database (Denmark)
Rosendahl, G; Douthwaite, S
1994-01-01
The antibiotics thiostrepton and micrococcin bind to the GTPase region in domain II of 23S rRNA, and inhibit ribosomal A-site associated reactions. When bound to the ribosome, these antibiotics alter the accessibility of nucleotides 1067A and 1095A towards chemical reagents. Plasmid......-coded Escherichia coli 23S rRNAs with single mutations at positions 1067 or 1095 were expressed in vivo. Mutant ribosomes are functional in protein synthesis, although those with transversion mutations function less effectively. Antibiotics were bound under conditions where wild-type and mutant ribosomes compete...
Klipperaas study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Andersson, Peter; Ittner, T.; Tiren, S.; Ljunggren, C.
1992-09-01
During the period from 1977 - 1986 SKB (Swedish Nuclear Fuel and Waste Management Co.) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection rpogramme will be to perform detailed characterisation, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if any of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favorable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concern the Klipperaas study site. The main topics are the scope of activities, geologic model, geohydrological model, groundwater chemistry, assessment of solute transport, and rock mechanics
Scopesi, Fabio; Canini, Silvana; Arioni, Cesare; Mazzella, Massimo; Gazzolo, Diego; Lantieri, Pasquale B; Bonacci, Wanda; Serra, Giovanni
2006-06-01
Recently we demonstrated an increased 2,3-diphosphoglycerate (2,3-DPG) erythrocyte concentration in rat pups subjected to nucleotide-enriched artificial feeding. The present study was carried out to test the hypothesis that a possible increase in 2,3-DPG concentration can also be obtained in human neonates who are fed nucleotide-enriched formula. Preterm neonates born or referred to the neonatal intensive care unit of the G. Gaslini Hospital, Genoa University, with a gestational age >30 weeks and <37 weeks were enrolled in our randomized trial. Recruitment took place within 48-72 hours from birth. Only newborns of mothers deciding not to breast-feed were eligible to be randomized for the supplemented group (FN) or non-supplemented group (RF). Breast-fed newborns were considered the control group (C). The study window (for supplementation and blood samples) was restricted to the first two weeks following birth (from the 2nd (t1) to the 16th (t2) day of life). At the end of our study, only 21 neonates were eligible for statistical analysis. The stimulating action of dietary nucleotides on 2,3-DPG concentration failed to be demonstrated; increases in 2,3-DPG concentration that were observed in newborns fed with nucleotide supplemented formula (FN) were comparable to those observed in newborns fed with regular formula (RF) and breast-fed newborns. The EC recommendation for the amount of nucleotides allowed in formula milk does not seem to be high enough to have positive effects on 2,3-DPG synthesis. Whether this possible 'pharmacological' effect can be achieved by a higher intake of ingested nucleotides and/or a change in the proportions of single nucleotides contained in milk formulas remain interesting end points to be elucidated.
Finnsjoen study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Andersson, Peter; Ittner, T.; Tiren, S.; Ljunggren, C.
1992-12-01
The Finnsjoen study site was selected in 1977 to provide input to the KBS-1 and KBS-2 performance assessments. The site was later used as a test site for testing new instruments and new site characterization methods, as well as a research site for studying mainly groundwater flow and groundwater transport. All together, the Finnsjoen studies have involved 11 cored boreholes, down to max 700 m depth, and extensive borehole geophysical, geochemical and geohydraulic measurements, as well as rock stress measurements and tracer tests. This report presents the scope of the Finnsjoen studies together with main results. Conceptual uncertainties in assumptions and models are discussed with emphasis on the models used for the performance assessment SKB91. Of special interest for the Finnsjoen study site is the strong influence caused by a subhorizontal fracture zone on groundwater flow, transport and chemistry
International Journal of Humanistic Studies: Site Map
African Journals Online (AJOL)
International Journal of Humanistic Studies: Site Map. Journal Home > About the Journal > International Journal of Humanistic Studies: Site Map. Log in or Register to get access to full text downloads.
Energy Technology Data Exchange (ETDEWEB)
Thoden, James B.; Holden, Hazel M. (UW)
2010-09-08
The pathogenic bacteria Pseudomonas aeruginosa and Bordetella pertussis contain in their outer membranes the rare sugar 2,3-diacetamido-2,3-dideoxy-D-mannuronic acid. Five enzymes are required for the biosynthesis of this sugar starting from UDP-N-acetylglucosamine. One of these, referred to as WlbB, is an N-acetyltransferase that converts UDP-2-acetamido-3-amino-2,3-dideoxy-D-glucuronic acid (UDP-GlcNAc3NA) to UDP-2,3-diacetamido-2,3-dideoxy-D-glucuronic acid (UDP-GlcNAc3NAcA). Here we report the three-dimensional structure of WlbB from Bordetella petrii. For this analysis, two ternary structures were determined to 1.43 {angstrom} resolution: one in which the protein was complexed with acetyl-CoA and UDP and the second in which the protein contained bound CoA and UDP-GlcNAc3NA. WlbB adopts a trimeric quaternary structure and belongs to the L{beta}H superfamily of N-acyltransferases. Each subunit contains 27 {beta}-strands, 23 of which form the canonical left-handed {beta}-helix. There are only two hydrogen bonds that occur between the protein and the GlcNAc3NA moiety, one between O{sup {delta}1} of Asn 84 and the sugar C-3{prime} amino group and the second between the backbone amide group of Arg 94 and the sugar C-5{prime} carboxylate. The sugar C-3{prime} amino group is ideally positioned in the active site to attack the si face of acetyl-CoA. Given that there are no protein side chains that can function as general bases within the GlcNAc3NA binding pocket, a reaction mechanism is proposed for WlbB whereby the sulfur of CoA ultimately functions as the proton acceptor required for catalysis.
Laparoendoscopic Single-Site Pyelolithotomy With Use of a Carter-Thomason Needle Grasper
Seo, Ill Young; Rim, Joung Sik
2013-01-01
Purpose To study the feasibility and safety of the procedure, we present our early experience with laparoendoscopic single-site (LESS) pyelolithotomy performed by use of a Carter-Thomason needle grasper. Materials and Methods Four patients underwent LESS pyelolithotomy for the removal of renal pelvic stones. The patients' mean age was 57.8 years, and their mean body mass index was 23.01. We used a homemade single-port device made with a surgical glove that was inserted into a 2.5-cm periumbil...
Nuclear Energy Center study. Phase II. Site suitability analysis. Final report
International Nuclear Information System (INIS)
Fellows, W.S.; Sharp, J.M.; Benator, B.I.
1978-06-01
A site screening study was conducted to identify a site or sites for detailed, site-specific study as a nuclear energy center. Using technical criteria of water requirements, geotechnical constraints, and projected load center and transmission considerations as well as environmental and institutional considerations, five potential study sites in the State of South Carolina were identified, evaluated against established criteria, and ranked according to their acceptability as potential nuclear energy center study sites. Consideration of what is ''representative'' of a site as well as the ranking score was factored into site recommendations, since the site deemed easiest to license and permit may not be the most desirable site for future study of the technical and institutional feasibility and practicality of a specific site. The sites near Lake Hartwell and the Savannah River Plant (SRP) of the Department of Energy were selected as potential study sites after consideration of the above criteria. Because the Lake Hartwell site offers the opportunity to consider institutional issues which may be more representative of other possible NEC sites, it is recommended that the Lake Hartwell site be studied to establish the feasibility and practicality of the nuclear energy concept on a site-specific basis
Directory of Open Access Journals (Sweden)
Jun Chen
2013-01-01
Full Text Available Interleukin- (IL- 22 is the signature cytokine of T-helper (Th 22 cells, and IL-23 is required for IL-22 production. The objective of this study was to examine the immunoexpression of IL-22 and IL-23 in archival paraffin-embedded biopsy specimens from oral LP (n=42 and cutaneous LP (n=38 against normal control tissues. The results showed that the percentage of cells expressing IL-22 and IL-23 in LP were significantly higher in LP compared to controls, respectively (both P<0.001. The correlation between IL-22 and IL-23 expression was significant (P<0.05. Moreover, the percentage of cells expressing IL-22 and IL-23 in oral LP were significantly higher than cutaneous LP (P<0.05. Collectively, our findings demonstrated that the increased expression of IL-22 and IL-23 in LP lesions could play roles in the pathogenesis of LP. Moreover, oral LP expressing IL-22 and IL-23 was higher than cutaneous LP, probably due to Th22 cells as an important component of oral mucosal host defense against oral microbiota and tissue antigens. This may be associated with the difference in clinical behaviour of the two variants of the disease.
23. ATSR congress - Proceedings
International Nuclear Information System (INIS)
2006-11-01
This document brings together the available presentations given at the 23. congress of the French association for radiation protection techniques and sciences (ATSR): 1 - J-F. Lecomte (CIPR): International commission of radiological protection (ICRP)'s recommendations; 2 - T. Lahaye (DGT): presentation of the 'worker's decree'; 3 - C. Marchal (DGSNR): Nuclear safety authority (ASN) viewpoint: first controllers' experience feedback; 4 - F. Rollinger (IRSN): missions of the IRSN's public expert for workers radiation protection; 5 - J-C. Varin (Areva NC): technical, organisational and managerial aspects of the implementation of new regulatory dispositions about radiation protection technical controls at La Hague facility; 6 - J-J. Radecki (Areva NC): enforcement of the radiological zoning by-law at Areva facilities; 7 - D. Miniere (EDF): implementation of the ALARA approach at EDF's nuclear power plants; 8 - D. Lefer (EAMEA): situation in the army and issues generated by the new decree; 9 - L. Ridel (DGA SPN): waste management aspect in the framework of submarines dismantling; 10 - D. Giordan (CMIR 78): the workers' decree: from practice to intervention; 11 - N. Barrey (CHU Bordeaux): enforcement of the May 2004 by-law and experience feedback; 12 - J-C. Mozziconacci (CH Bourges): zoning, reclassification and implementation of the medical imaging operational dosimetry in a medium size hospital; 13 - J. Bino (AMEST Lille): recommendations and technical instructions for labour doctors; 14 - K. Zarraa (CERAP): decree impact on approved organisations; 15 - D. Morio (COFREND): difficulties encountered with the implementation of radiographical devices; 16 - B. Carrez (Ponts et Chaussees): workplace studies and operational dosimetries: essential tools at public work sites; 17 - G. Imbard (CEA): evolution of workers regulation, adaptation of practices at Marcoule site; 18 - M. Ammerich (CEA): ambiguities and enforcement difficulties of the workers' decree; 19 - H. Mansoux
A study plan for determining recharge rates at the Hanford Site using environmental tracers
International Nuclear Information System (INIS)
Murphy, E.M.; Szercsody, J.E.; Phillips, S.J.
1991-02-01
This report presents a study plan for estimating recharge at the Hanford Site using environmental tracers. Past operations at the Hanford Site have led to both soil and groundwater contamination, and recharge is one of the primary mechanisms for transporting contaminants through the vadose zone and into the groundwater. An alternative to using fixed lysimeters for determining recharge rates in the vadose zone is to use environmental tracers. Tracers that have been used to study water movement in the vadose zone include total chloride, 36 Cl, 3 H, and 2 H/ 18 O. Atmospheric levels of 36 Cl and 3 H increased during nuclear bomb testing in the Pacific, and the resulting ''bomb pulse'' or peak concentration can be measured in the soil profile. Locally, past operations at the Hanford Site have resulted in the atmospheric release of numerous chemical and isotopic tracers, including nitrate, 129 I, and 99 Tc. Seven study sites on the Hanford Site have been selected, in two primary soil types that are believed to represent the extremes in recharge, the Quincy sand and the Warden silt loam. An additional background study site upwind of the Hanford facilities has been chosen at the Yakima Firing Center. Six tracer techniques (total chloride, 36 Cl, 3 H, nitrate, 129 I, and 99 Tc) will be tested on at least one site in the Quincy sand, one site in the Warden silt loam, and the background site, to determine which combination of tracers works best for a given soil type. In subsequent years, additional sites will be investigated. The use of environmental tracers is perhaps the only cost-effective method for estimating the spatial variability of recharge at a site as large as Hanford. The tracer techniques used at Hanford have wide applicability at other arid sites. 166 refs., 41 figs., 16 tabs
Closure Report for Corrective Action Unit 340: NTS Pesticide Release Sites Nevada Test Site, Nevada
Energy Technology Data Exchange (ETDEWEB)
C. M. Obi
2000-05-01
The purpose of this report is to provide documentation of the completed corrective action and to provide data confirming the corrective action. The corrective action was performed in accordance with the approved Corrective Action Plan (CAP) (U.S. Department of Energy [DOE], 1999) and consisted of clean closure by excavation and disposal. The Area 15 Quonset Hut 15-11 was formerly used for storage of farm supplies including pesticides, herbicides, and fertilizers. The Area 23 Quonset Hut 800 was formerly used to clean pesticide and herbicide equipment. Steam-cleaning rinsate and sink drainage occasionally overflowed a sump into adjoining drainage ditches. One ditch flows south and is referred to as the quonset hut ditch. The other ditch flows southeast and is referred to as the inner drainage ditch. The Area 23 Skid Huts were formerly used for storing and mixing pesticide and herbicide solutions. Excess solutions were released directly to the ground near the skid huts. The skid huts were moved to a nearby location prior to the site characterization performed in 1998 and reported in the Corrective Action Decision Document (CADD) (DOE, 1998). The vicinity and site plans of the Area 23 sites are shown in Figures 2 and 3, respectively.
The Violence Prevention Community Meeting: A Multi-Site Study.
Lanza, Marilyn; Ridenour, Marilyn; Hendricks, Scott; Rierdan, Jill; Zeiss, Robert; Schmidt, Satu; Lovelace, Jeff; Amandus, Harlan
2016-06-01
The Violence Prevention Community Meeting (VPCM) is a specialized form of community meeting in which avoiding violence and promoting non-violent problem solving and interpersonal civility are focal points. A nationwide study to assess the VPCM as an effective intervention to reduce workplace violence was undertaken. Seven acute locked psychiatric units of the Veterans Health Administration (VHA) throughout the United States participated in the study. All patients and all staff on the seven in-patient locked psychiatry units participated in the intervention (VPCM) or as a control (treatment as usual). The study was 21weeks at each site. The three time periods were pre-treatment weeks 1-3, treatment weeks 4-18, and post-treatment weeks 19-21. The VPCM was conducted during the treatment weeks. Overall rates of aggression declined by 0.6% (95% CI: -5.6%, 6.5%; nonsignificant) per week in the intervention hospitals and by 5.1% (95% CI: 0.4%, 9.6%; significant) per week for the control hospitals. Aggression decreased for both the intervention and control hospitals which could be due to enrollment in a research study and thus being more aware of their ability to address workplace violence at their site. Published by Elsevier Inc.
Nuclear Energy Center study. Phase II. Site suitability analysis. Final report
Energy Technology Data Exchange (ETDEWEB)
Fellows, W.S.; Sharp, J.M.; Benator, B.I.
1978-06-01
A site screening study was conducted to identify a site or sites for detailed, site-specific study as a nuclear energy center. Using technical criteria of water requirements, geotechnical constraints, and projected load center and transmission considerations as well as environmental and institutional considerations, five potential study sites in the State of South Carolina were identified, evaluated against established criteria, and ranked according to their acceptability as potential nuclear energy center study sites. Consideration of what is ''representative'' of a site as well as the ranking score was factored into site recommendations, since the site deemed easiest to license and permit may not be the most desirable site for future study of the technical and institutional feasibility and practicality of a specific site. The sites near Lake Hartwell and the Savannah River Plant (SRP) of the Department of Energy were selected as potential study sites after consideration of the above criteria. Because the Lake Hartwell site offers the opportunity to consider institutional issues which may be more representative of other possible NEC sites, it is recommended that the Lake Hartwell site be studied to establish the feasibility and practicality of the nuclear energy concept on a site-specific basis.
A Goal Programming Model for the Siting of Multilevel EMS Systems.
1980-03-01
Management," unpublished Ph.D. thesis, University of Texas, Austin, Texas, 1971. -23- (11) Daskin , M. and E. Stern, " A Multiobjective Set Covering...GOAL PROGRAM4MING MODEL FOR THE SITING OF MULTILEVEL EMS SYSTE-ETC(U) UNM1AR 80 A CHARNES, J E STORBECK N000iA-75-C-569 WICLASSIFIED CCS-366 N...366 A GOAL PROGRAMMING MODEL FOR THE SITING OF MULTILEVEL EMS SYSTEMS by A . Charnes J. Storbeck March 1980 This project was partially supported by
Conformational plasticity at the IgE-binding site of the B-cell receptor CD23.
Dhaliwal, Balvinder; Pang, Marie O Y; Yuan, Daopeng; Yahya, Norhakim; Fabiane, Stella M; McDonnell, James M; Gould, Hannah J; Beavil, Andrew J; Sutton, Brian J
2013-12-01
IgE antibodies play a central role in allergic disease. They recognize allergens via their Fab regions, whilst their effector functions are controlled through interactions of the Fc region with two principal cell surface receptors, FcɛRI and CD23. Crosslinking of FcɛRI-bound IgE on mast cells and basophils by allergen initiates an immediate inflammatory response, while the interaction of IgE with CD23 on B-cells regulates IgE production. We have determined the structures of the C-type lectin "head" domain of CD23 from seven crystal forms. The thirty-five independent structures reveal extensive conformational plasticity in two loops that are critical for IgE binding. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.
Siting of nuclear desalination plants in Saudi Arabia: A seismic study
International Nuclear Information System (INIS)
Aljohani, M.S.; Abdul-Fattah, A.F.; Almarshad, A.I.
2005-01-01
This paper presents the selection criteria generally and seismic criteria specifically to select a suitable site in Saudi Arabia for a nuclear desalination plant. These criteria include geological, meteorological, cooling water supply discharge, transport infrastructure, population, electric grid, water network capacity, environmental impact and airport movement. The seismicity of the Arabian peninsula for the locations of seismic activity along the Red Sea and the Arabian Gulf coastlines from 1973 to 2000 was studied carefully. This study included towns and locations along the east and west coastlines and their distances from the seismic event site. The results showed that Rabigh City along the west coast of Saudi Arabia is a good site to build a nuclear desalination plant. This is because of the following reasons: good seismic stability; good weather statistics; no flooding; mild wave conditions; good supply and discharge; good transportation infrastructure; low population area; very close to the huge electric grid. (author)
National radioactive waste repository site selection study. Phase 2. A report on public comment
International Nuclear Information System (INIS)
1995-11-01
Agreement was reached in principle between State/Territory and the Commonwealth of Australia Governments that a suitable site for a radioactive wastes repository must be found. The discussion papers resulting from the Phase 1 and Phase 2 of the site selection study were released for public comment. The national repository will be for disposal of low level and short-lived intermediate level radioactive wastes streaming from the medical, research and industrial use of radioisotopes in Australia. The purpose of this report is to summarise and respond in general terms to comment received on the discussion paper -Phase 2 of the study. Forty five submissions were received. Of these: 18 supported the Phase 2 study approach and the concept of a national repository; 13 did not state a clear position but either requested more information or provided constructive comment on the siting process; 7 supported the site selection approach and the repository concept but suggested that the repository should not be sited in a particular area; 3 opposed the siting of the repository in their vicinity but not necessarily the repository concept and site selection approach; 4 opposed the concept of a national repository. This compares with 124 submissions on Phase 1 of the study, of which 57 opposed the national repository concept (52 of these were from letters elicited by Greenpeace) and 48 supported the establishment of a national repository and the site selection approach proposed. 3 figs
Directory of Open Access Journals (Sweden)
Grace Ding
2016-03-01
Full Text Available In order to make environmentally aware decisions, there is growing interest in the comparative energy and greenhouse gas (GHG performance of competing construction methods. Little research has been done concerning competing ground floor construction methods, especially given different site variables, such as slope and soil type. A life cycle assessment approach was adopted to analyse environmental impacts, including cumulative energy demand and GHG emissions for detached housing construction in Australia. Data was drawn from 24 case study housing projects, including 12 reinforced concrete and 12 suspended timber floor projects. The data presented in the paper compares cumulative energy demand, GHG and the constituent parts of competing construction methods. The findings indicate that the timber floors use/create significantly less cumulative energy demand and GHG emissions than concrete floors—approximately 2.1 to 2.7 times less energy and 2.3 to 2.9 times less GHG. These findings are limited to the site slope and foundation soil types identified in the paper. The main application of the work is in guidance concerning the lowest environmental impact options for detached housing construction.
CLOSURE REPORT FOR CORRECTIVE ACTION UNIT 204: STORAGE BUNKERS, NEVADA TEST SITE, NEVADA
International Nuclear Information System (INIS)
2006-01-01
Corrective Action Unit (CAU) 330 consists of four Corrective Action Sites (CASs) located in Areas 6, 22, and 23 of the Nevada Test Site (NTS). The unit is listed in the Federal Facility Agreement and Consent Order (FFACO, 1996) as CAU 330: Areas 6, 22, and 23 Tanks and Spill Sites. CAU 330 consists of the following CASs: CAS 06-02-04, Underground Storage Tank (UST) and Piping CAS 22-99-06, Fuel Spill CAS 23-01-02, Large Aboveground Storage Tank (AST) Farm CAS 23-25-05, Asphalt Oil Spill/Tar Release
Closure Report for Corrective Action Unit 537: Waste Sites, Nevada Test Site, Nevada
International Nuclear Information System (INIS)
NSTec Environmental Restoration
2007-01-01
Corrective Action Unit (CAU) 537 is identified in the ''Federal Facility Agreement and Consent Order'' (FFACO) of 1996 as Waste Sites. CAU 537 is located in Areas 3 and 19 of the Nevada Test Site, approximately 65 miles northwest of Las Vegas, Nevada, and consists of the following two Corrective Action Sites (CASs): CAS 03-23-06, Bucket; Yellow Tagged Bags; and CAS 19-19-01, Trash Pit. CAU 537 closure activities were conducted in April 2007 according to the FFACO and Revision 3 of the Sectored Clean-up Work Plan for Housekeeping Category Waste Sites (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2003). At CAS 03-23-06, closure activities included removal and disposal of a 15-foot (ft) by 15-ft by 8-ft tall wooden shed containing wood and metal debris and a 5-gallon plastic bucket containing deteriorated plastic bags with yellow radioactive contamination tape. The debris was transported to the Area 9 U10c Landfill for disposal after being screened for radiological contamination according to the ''NV/YMP Radiological Control Manual'' (NNSA/NSO, 2004). At CAS 19-19-01, closure activities included segregation, removal, and disposal of non-friable, non-regulated asbestos-containing material (ACM) and construction debris. The ACM was determined to be non-friable by waste characterization samples collected prior to closure activities. The ACM was removed and double-bagged by licensed, trained asbestos workers and transported to the Area 9 U10c Landfill for disposal. Construction debris was transported in end-dump trucks to the Area 9 U10c Landfill for disposal. Closure activities generated sanitary waste/construction debris and ACM. Waste generated during closure activities was appropriately managed and disposed. Waste characterization sample results are included as Appendix A of this report, and waste disposition documentation is included as Appendix B of this report. Copies of the Sectored Housekeeping Site Closure
Fibroblast Growth Factor-23—A Potential Uremic Toxin
Directory of Open Access Journals (Sweden)
Piotr Kuczera
2016-12-01
Full Text Available Fibroblast growth factor-23 (FGF23 is a circulating member of the FGF family produced mainly by the osteocytes and osteoblasts that can act as a hormone. The main action of FGF23 is to lower phosphatemia via the reduction of urinary phosphate reabsorption and the decrease of 1,25(OH2-D generation in the kidney. In the course of chronic kidney disease (CKD, plasma FGF23 concentration rises early, most probably to compensate the inability of the deteriorating kidneys to excrete an adequate amount of phosphate. However, this comes at the cost of FGF23-related target organ toxicity. Results of clinical studies suggest that elevated plasma FGF23 concentration is independently associated with the increased risk of CKD progression, occurrence of cardio-vascular complications, and mortality in different stages of CKD. FGF23 also contributes to cardiomyocyte hypertrophy, vascular calcification, and endothelial dysfunction. The impact of FGF23 on heart muscle is not dependent on Klotho, but rather on the PLCγ–calcineurin–NFAT (nuclear factor of activated T-cells pathway. Among the factors increasing plasma FGF23 concentration, active vitamin D analogues play a significant role. Additionally, inflammation and iron deficiency can contribute to the increase of plasma FGF23. Among the factors decreasing plasma FGF23, dietary phosphate restriction, some intestinal phosphate binders, cinacalcet (and other calcimimetics, and nicotinamide can be enumerated. Anti-FGF23 antibodies have also recently been developed to inhibit the action of FGF23 in target organs. Still, the best way to normalize plasma FGF23 in maintenance hemodialysis patients is restoring kidney function by successful kidney transplantation.
Krishnan, Anand; Nongkynrih, Baridalyne; Kapoor, Suresh Kumar; Pandav, Chandrakant
2009-09-28
The International Network of field sites with continuous Demographic Evaluation of Populations and Their Health (INDEPTH) has 34 Health and Demographic Surveillance System (HDSS) in 17 different low and middle-income countries. Of these, 23 sites are in Africa, 10 sites are in Asia, and one in Oceania. The INDEPTH HDSS sites in Asia identified chronic non-communicable diseases (NCDs) as a neglected area of attention. As a first step, they conducted NCD risk factor surveys within nine sites in five countries. These sites are now looking to broaden the agenda of research on NCDs using the baseline data to inform policy and practice. A conceptual framework for translating research into action for NCDs at INDEPTH sites was developed. This had five steps - assess the problem, understand the nature of the problem, evaluate different interventions in research mode, implement evidence-based interventions in programme mode, and finally, share knowledge and provide leadership to communities and countries. Ballabgarh HDSS site in India has successfully adopted these steps and is used as a case study to demonstrate how this progress was achieved and what factors were responsible for a successful outcome. Most of the HDSS sites are in the second step of the process of translating research to action (understand the problem). The conduct of NCD risk factor surveys has enabled an assessment of the burden of NCD risk together with determinants in order to understand the burden at the population level. The experience from Ballabgarh HDSS exemplifies that the following steps - pilot testing the interventions, implementing activities in programme mode, and finally, share knowledge and provide leadership - are also possible in rural settings in low-income countries. The critical success factors identified were involvement of a premier medical institution, pre-existing links to policy makers and programme managers, strong commitment of the HDSS team and adequate human resource capacity
Operational Challenges and Solutions with Implementation of an Adaptive Seamless Phase 2/3 Study
Spencer, Kimberly; Colvin, Kelly; Braunecker, Brad; Brackman, Marcia; Ripley, Joyce; Hines, Paul; Skrivanek, Zachary; Gaydos, Brenda; Geiger, Mary Jane
2012-01-01
A wide variety of operational issues were encountered with the planning and implementation of an adaptive, dose-finding, seamless phase 2/3 trial for a diabetes therapeutic. Compared with a conventional design, significant upfront planning was required, as well as earlier, more integrated cross-functional coordination. The existing infrastructure necessitated greater flexibility to meet the needs of the adaptive design. Rapid data acquisition, analysis, and reporting were essential to support the successful implementation of the adaptive algorithm. Drug supply for nine treatment arms had to be carefully managed across many sites worldwide. Details regarding these key operational challenges and others will be discussed along with resolutions taken to enable successful implementation of this adaptive, seamless trial. PMID:23294774
Energy Technology Data Exchange (ETDEWEB)
Drifford, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1967-06-15
A crystallographic study on magnesium aluminates led to the determination of crystal site average distortion. A spectroscopic study of transition elements doped spinels gave the position of the doping element in tetrahedral (A) or octahedral (B) sites, and the local distortion of the latter. The comparison of average and local parameters points to differences in the behaviour of doping elements and shows the size of (A) sites are independent of the host crystal composition while the average size of (B) sites varies with the composition. (author) [French] Une etude cristallographique des aluminates de magnesium a permis de determiner la deformation moyenne des sites cristallins. Une etude spectroscopique des aluminates de magnesium dopes avec des elements de transition a permis de localiser les dopants entre les sites tetraedriques (A) et octaedriques (B) et d'etudier la deformation locale de ces sites. La comparaison entre les parametres moyens et locaux a caracterise le comportement du dopant et montre que les dimensions des sites (A) sont independantes de la composition de la matrice, alors que les caracteristiques geometriques moyennes des sites (B) varient continument avec la composition. (auteur)
Siting studies for new nuclear power plants in Argentina
International Nuclear Information System (INIS)
Barbaran, Gustavo A.
2008-01-01
This paper is a summary of the thesis prepared by the Group of Prospective and Energy Planning of the National Atomic Energy Commission for the 'Specialization on Applications of Nuclear Technology Course' of the Instituto Balseiro in 2007. It describes the evolution of siting studies through time and the main focus worldwide in this type of studies. Then, it makes a brief review of previous siting studies of nuclear power plants conducted in Argentina. It carries out a description of the methodology to conduct a site evaluation for nuclear power plants according to actual international criteria. Finally, it describes the licensing process that follows every site study. (author) [es
Whitehill, Jennifer M; Pumper, Megan A; Moreno, Megan A
2015-05-20
Emerging adults have high rates of heavy episodic drinking (binge drinking) and related risks including alcohol-impaired driving. To understand whether social networking sites (SNSs) used on mobile devices represent a viable platform for real-time interventions, this study measured emerging adults' use of two popular SNSs (Facebook and Twitter) during the Mifflin Street Block Party. This annual festival is held in Madison, Wisconsin and is known for high alcohol consumption. Event attendees ages 18-23 years were recruited by young adult research assistants (>21 years). Participants completed a brief in-person interview assessing drinking intensity, use of SNSs, and use of SNSs to plan transportation. Analyses included t-tests, chi-squared tests, and Fisher's exact tests. At the event, nearly all of the 200 participants (97 %) consumed alcohol and 18 % met criteria for heavy episodic drinking. Approximately one-third of participants had used Facebook or Twitter on the day of the event. Facebook use (23 %) was more prevalent than Twitter use (18 %), especially among heavy episodic drinkers. Use of either SNS was 41 % among females and 24 % among males (χ (2)=6.01; df=1; p=0.01). Plans to use a SNS to arrange transportation were relatively uncommon (4 %), but this was more frequent among heavy episodic drinkers (11 %) compared to non-heavy episodic drinkers (2 %) (Fisher's exact p=0.02). These results indicate that SNSs are used during alcohol consumption and warrant exploration as a way to facilitate connections to resources like safe ride services.
International Nuclear Information System (INIS)
Matthews, Patrick
2011-01-01
Corrective Action Unit 366 comprises the six corrective action sites (CASs) listed below: (1) 11-08-01, Contaminated Waste Dump No.1; (2) 11-08-02, Contaminated Waste Dump No.2; (3) 11-23-01, Radioactively Contaminated Area A; (4) 11-23-02, Radioactively Contaminated Area B; (5) 11-23-03, Radioactively Contaminated Area C; and (6) 11-23-04, Radioactively Contaminated Area D. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed July 6, 2011, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 366. The presence and nature of contamination at CAU 366 will be evaluated based on information collected from a field investigation. Radiological contamination will be evaluated based on a comparison of the total effective dose (TED) at sample locations to the dose-based final action level (FAL). The TED will be calculated by summing the estimates of internal and external dose. Results from the analysis of soil samples collected from sample plots will be used to calculate internal radiological dose. Thermoluminescent dosimeters placed at each sample location will be used to measure external radiological dose. Based on historical documentation of the releases
Energy Technology Data Exchange (ETDEWEB)
Matthews, Patrick K.
2013-07-01
Corrective Action Unit (CAU) 567 is located in Areas 1, 3, 5, 20, and 25 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 567 is a grouping of sites where there has been a suspected release of contamination associated with nuclear testing. This document describes the planned investigation of CAU 567, which comprises the following corrective action sites (CASs): • 01-23-03, Atmospheric Test Site T-1 • 03-23-25, Seaweed E Contamination Area • 05-23-07, A5b RMA • 20-23-08, Colby Mud Spill • 25-23-23, J-11 Soil RMA These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the investigation report. The sites will be investigated based on the data quality objectives (DQOs) developed on May 6, 2013, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Field Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 567. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The potential contamination sources associated with CAU 567 releases are nuclear test operations and other NNSS operations. The DQO process resulted in an assumption that total effective dose (TED) within a default contamination boundary
The Cottonwood Lake study area, a long-term wetland ecosystem monitoring site
Mushet, David M.; Euliss, Ned H.
2012-01-01
The Cottonwood Lake study area is one of only three long-term wetland ecosystem monitoring sites in the prairie pothole region of North America; the other two are Orchid Meadows in South Dakota and St. Denis in Saskatchewan. Of the three, Cottonwood Lake has, by far, the longest continuous data-collection record. Research was initiated at the study area in 1966, and intensive investigations of the hydrology, chemistry, and biology of prairie pothole wetlands continue at the site today. This fact sheet describes the study area, provides an overview of wetland ecology research that has been conducted at the site in the past, and provides an introduction to current work being conducted at the study area by USGS scientists.
Knubovets, Tatyana; Shinar, Hadassah; Eliav, Uzi; Navon, Gil
1996-01-01
Recently, it has been shown that23Na double-quantum-filtered NMR spectroscopy can be used to detect anisotropic motion of bound sodium ions in biological systems. The technique is based on the formation of the second-rank tensor when the quadrupolar interaction is not averaged to zero. Using this method, anisotropic motion of bound sodium in human and dog red blood cells was detected, and the effect was shown to depend on the integrity of the membrane cytoskeleton. In the present study, multiple-quantum-filtered techniques were applied in combination with a quadrupolar echo to measure the transverse-relaxation times,T2fandT2s. Line fitting was performed to obtain the values of the residual quadrupolar interaction, which was measured for sodium in a variety of mammalian erythrocytes of different size, shape, rheological properties, and sodium concentrations. Human unsealed white ghosts were used to study sodium bound at the anisotropic sites on the inner side of the RBC membrane. Modulations of the conformation of the cytoskeleton by the variation of either the ionic strength or pH of the suspending medium caused drastic changes in both the residual quadrupolar interaction andT2fdue to changes in the fraction of bound sodium ions as well as changes in the structure of the binding sites. By combining the two spectroscopic parameters, structural change can be followed. The changes in the structure of the sodium anisotropic binding sites deduced by this method were found to correlate with known conformational changes of the membrane cytoskeleton. Variations of the medium pH affected both the fraction of bound sodium ions and the structure of the anisotropic binding sites. Sodium and potassium were shown to bind to the anisotropic binding sites with the same affinity.
International Nuclear Information System (INIS)
1987-06-01
The Cultural Resources Site Study Plan describes a field program to identify and evaluate the archaeological, historical, and Native American Indian resources of the site on local and regional perspectives; monitor and manage discovered cultural resources; and establish a worker education program. The archaeological field program consists of three pedestrian surveys: Survey 1 includes two EDBH seismic survey lines and the area within the exploratory shaft facility (ESF); Survey 2 includes the remainder of the site plus a 1/4 to 3/4-mi border area; and Survey 3 includes an assortment of offsite areas. The historical studies will identify and evaluate known and discovered historical sites and structures and the Native American Indian will identify and evaluate cultural and religious concerns expressed by Indian tribal groups. Prehistoric and historic sites will be evaluated to determine if they meet eligibility criteria for listing on the National Register of Historic Places. This site study plan describes the need for each study; its design and design rationale; analysis, management, and use of data; schedule of field activities; organization of field personnel and sample management; and quality assurance requirements. The cultural resource studies will provide data for satisfying the Programmatic Agreement, engineering design needs, and SRP requirements for permits and approvals, and for minimizing effects to any cultural properties discovered during site characterization. 75 refs., 10 figs., 2 tabs
Energy Technology Data Exchange (ETDEWEB)
Thoden, James B.; Holden, Hazel M. (UW)
2011-12-22
The unusual sugar 2,3-diacetamido-2,3-dideoxy-d-mannuronic acid, or ManNAc3NAcA, has been observed in the lipopolysaccharides of both pathogenic and nonpathogenic Gram-negative bacteria. It is added to the lipopolysaccharides of these organisms by glycosyltransferases that use as substrates UDP-ManNAc3NAcA. Five enzymes are ultimately required for the biosynthesis of UDP-ManNAc3NAcA starting from UDP-N-acetylglucosamine. The second enzyme in the pathway, encoded by the wlba gene and referred to as WlbA, catalyzes the NAD-dependent oxidation of the C-3' hydroxyl group of the UDP-linked sugar. Here we describe a combined structural and functional investigation of the WlbA enzymes from Bordetella pertussis and Chromobacterium violaceum. For this investigation, ternary structures were determined in the presence of NAD(H) and substrate to 2.13 and 1.5 {angstrom} resolution, respectively. Both of the enzymes display octameric quaternary structures with their active sites positioned far apart. The octamers can be envisioned as tetramers of dimers. Kinetic studies demonstrate that the reaction mechanisms for these enzymes are sequential and that they do not require {alpha}-ketoglutarate for activity. These results are in sharp contrast to those recently reported for the WlbA enzymes from Pseudomonas aeruginosa and Thermus thermophilus, which function via ping-pong mechanisms that involve {alpha}-ketoglutarate. Taken together, the results reported here demonstrate that there are two distinct families of WlbA enzymes, which differ with respect to amino acid sequences, quaternary structures, active site architectures, and kinetic mechanisms.
Intrinsic Remediation Treatability Study for Site ST-29 Patrick Air Force Base, Florida
1995-08-01
of the northeast/southwest (NE/SW) runway. The BX Service Station has been in operation since 1954. The site consists of a small food market (Building... UCg /1 0 86-4-MWD .09 12.4 1.47 0 86-5-MWS .17 23.6 6.86 86-7 .12 30.2 2.52 86-8 .10 44.7 8.51 86-9-MWD .11 34.7 15.3 86-9-MWD Dup .11 86-9-MWS .10
Coaching at the Building Site – A Feasibility Study
DEFF Research Database (Denmark)
Koch, Christian; Alsdorf, Morten; Sander, Dag
2006-01-01
successfully at a building site, in certain specific situations. The feeling of security is important for the focus persons at the building site and is best obtained in the open air. The way the leader acts towards the employee/focus person is decisive. Consciousness and responsibility is developed......Coaching has become widely used in business, and is well described. However it is rarely used in construction. This makes a contrast to the poor performance of site interaction, leading to a vast amount of reported cooperation and coordination problems. This paper investigates the feasibility...... observations in a building site operating with lean construction, where the managers did not use coaching consciously in their interaction with employees. 29 participant observations of five of the managers at the building site were carried out, at individual- and group meetings. Coaching can be used...
International Nuclear Information System (INIS)
Nguyen, T.
2004-01-01
To reduce redundancy, cost, and time, while at the same time ultimately increasing the effectiveness of the radioactive risk management process, a logical framework incorporating risk assessments (human cancer and environmental risks) into the environmental site assessment process was designed for radioactive open site contamination. Risk-based corrective action is becoming an increasingly more acceptable approach for the remediation of contaminated sites. In the past, cleanup goals were usually established without any regard to the risk involved, by mandating remediation goals based solely on maximum contamination levels. Now, a multi-stage environmental site assessment template has been developed on a radioecological approach. The template gives a framework for making environmentally sound decisions based on relevant regulations and guidelines. The first stage involves the comparison of the background screening activity level to the regulated activity level, the second stage involves the use of site-specific information to determine the risk involved with the contamination, and the third stage provides a remediation decision matrix based on results from the first two stages. This environmental site assessment template is unique because it incorporates the modified Canadian National Classification System for radioactive contaminated sites and two different types of risk assessments (human cancer risks and the newly designed ecological risk) into the decision making process. The template was used to assess a radiologically contaminated site at the Canadian Forces Base at Suffield (Alberta) as a case study, and it reaffirms the Department of National Defence's action as appropriate. This particular site is a Class 3, has an overall insignificant human cancer risk ( -6 ) and a low environmental risk, and conforms to all regulated guidelines. Currently, it is restricted and should be left as is, provided that the subsurface is not disturbed. (author)
Adsorption of the diazo dye Direct Red 23 onto a zinc oxide surface: A spectroscopic study
Lucilha, Adriana Campano; Bonancêa, Carlos Eduardo; Barreto, Wagner José; Takashima, Keiko
2010-01-01
The adsorption of the diazo dye Direct Red 23 onto a zinc oxide surface at 30 °C in the dark was investigated. The color reduction was monitored by spectrophotometry at 503 nm. The FTIR and Raman spectra of the Direct Red 23 adsorption as a function of ZnO concentration were registered. From the PM3 semi-empirical calculations of the atomic charge density and dipole moment of the Direct Red 23 molecule, it was demonstrated that the azo dye molecule may be adsorbed onto the ZnO surface through molecule geometry modifications, enhancing the interfacial area causing a variation in the bonding frequencies.
Site study plan for routine laboratory rock mechanics, Deaf Smith County Site, Texas: Revision 1
International Nuclear Information System (INIS)
1987-12-01
This Site Study Plan for Routine Laboratory Rock Mechanics describes routine laboratory testing to be conducted on rock samples collected as part of the characterization of the Deaf Smith County site, Texas. This study plan describes the early laboratory testing. Additional testing may be required and the type and scope of testing will be dependent upon the results of the early testing. This study provides for measurements of index, hydrological, mechanical, and chemical properties with tests which are standardized and used widely in geotechnical investigations. Another Site Study Plan for Nonroutine Laboratory Rock Mechanics describes laboratory testing of samples from the site to determine mechanical, thermomechanical, and thermal properties by less widely used methods, many of which have been developed specifically for characterization of the site. Data from laboratory tests will be used for characterization of rock strata, design of shafts and underground facilities, and modeling of repository behavior in support of resolution of both preclosure and postclosure issues. A tentative testing schedule and milestone log are given. A quality assurance program will be utilized to assure that activities affecting quality are performed correctly and that appropriate documentation is maintained. 18 refs., 8 figs., 3 tabs
Energy Technology Data Exchange (ETDEWEB)
Matthews, Patrick [Nevada Field Ofice, Las Vegas, NV (United States). National Nuclear Security Administration
2015-08-01
The purpose of this Corrective Action Decision Document is to identify and provide the rationale for the recommendation of corrective action alternatives (CAAs) for the 14 CASs within CAU 568. Corrective action investigation (CAI) activities were performed from April 2014 through May 2015, as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 568: Area 3 Plutonium Dispersion Sites, Nevada National Security Site, Nevada; and in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices. The purpose of the CAI was to fulfill data needs as defined during the DQO process. The CAU 568 dataset of investigation results was evaluated based on a data quality assessment. This assessment demonstrated that the dataset is complete and acceptable for use in fulfilling the DQO data needs. Based on the evaluation of analytical data from the CAI, review of future and current operations at the 14 CASs, and the detailed and comparative analysis of the potential CAAs, the following corrective actions are recommended for CAU 568: • No further action is the preferred corrective action for CASs 03-23-17, 03-23-22, 03-23-26. • Closure in place is the preferred corrective action for CAS 03-23-19; 03-45-01; the SE DCBs at CASs 03-23-20, 03-23-23, 03-23-31, 03-23-32, 03-23-33, and 03-23-34; and the Pascal-BHCA at CAS 03-23-31. • Clean closure is the preferred corrective action for CASs 03-08-04, 03-23-30, and 03-26-04; and the four well head covers at CASs 03-23-20, 03-23-23, 03-23-31, and 03-23-33.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Recruitment. 15a.23 Section 15a.23 Agriculture Office... FEDERAL FINANCIAL ASSISTANCE Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 15a.23 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which this subpart applies shall...
History of Tank 23, 1962 through 1974
International Nuclear Information System (INIS)
McNatt, F.G.
1979-04-01
Tank 23 was placed in service in April 1964 receiving contaminated water from Buildings 244-H, the Receiving Basin for Off-Site Fuel (RBOF), and 245-H, the Resin Regeneration Facility (RRF). Tank 23 also provided emergency storage space for 500,000 gallons in the event of a severe contamination incident in Building 244-H. The tank has remained in this service since that time. The Tank 23 waste was processed initially by the 242-H evaporator, but since mid-1966 the waste has been processed through a zeolite bed to remove 137 C and other radioisotopes by ion exchange, and discarded to seepage basins. Inspections of the tank interior were made by using a 40-ft optical periscope and the thickness of the steel bottom of the tank was measured ultrasonically. Samples of the waste in the tank and liquid collected in the side wall and bottom sumps were analyzed. Several equipment modifications and repairs were made
Energy Technology Data Exchange (ETDEWEB)
Grant Evenson
2006-04-01
Corrective Action Unit (CAU) 139 is located in Areas 3, 4, 6, and 9 of the Nevada Test Site, which is 65 miles northwest of Las Vegas, Nevada. Corrective Action Unit 139 is comprised of the seven corrective action sites (CASs) listed below: (1) 03-35-01, Burn Pit; (2) 04-08-02, Waste Disposal Site; (3) 04-99-01, Contaminated Surface Debris; (4) 06-19-02, Waste Disposal Site/Burn Pit; (5) 06-19-03, Waste Disposal Trenches; (6) 09-23-01, Area 9 Gravel Gertie; and (7) 09-34-01, Underground Detection Station. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives with the exception of CASs 09-23-01 and 09-34-01. Regarding these two CASs, CAS 09-23-01 is a gravel gertie where a zero-yield test was conducted with all contamination confined to below ground within the area of the structure, and CAS 09-34-01 is an underground detection station where no contaminants are present. Additional information will be obtained by conducting a corrective action investigation (CAI) before evaluating corrective action alternatives and selecting the appropriate corrective action for the other five CASs where information is insufficient. The results of the field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on January 4, 2006, by representatives of the Nevada Division of Environmental Protection; U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office; Stoller-Navarro Joint Venture; and Bechtel Nevada. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 139.
International Nuclear Information System (INIS)
BECHTEL NEVADA
2004-01-01
Corrective Action Unit (CAU) 112, Area 23 Hazardous Waste Trenches, Nevada Test Site (NTS), Nevada, is a Resource Conservation and Recovery Act (RCRA) unit located in Area 23 of the NTS. This annual Post-Closure Inspection and Monitoring Report provides the results of inspections and monitoring for CAU 112. This report includes a summary and analysis of the site inspections, repair and maintenance, meteorological information, and neutron soil moisture monitoring data obtained at CAU 112 for the current monitoring period, October 2003 through September 2004. Inspections of the CAU 112 RCRA unit were performed quarterly to identify any significant physical changes to the site that could impact the proper operation of the waste unit. The overall condition of the covers and facility was good, and no significant findings were observed. The annual subsidence survey of the elevation markers was conducted on August 23, 2004, and the results indicated that no cover subsidence4 has occurred at any of the markers. The elevations of the markers have been consistent for the past 11 years. The total precipitation for the current reporting period, october 2003 to September 2004, was 14.0 centimeters (cm) (5.5 inches [in]) (National Oceanographic and Atmospheric Administration, Air Resources Laboratory, Special Operations and Research Division, 2004). This is slightly below the average rainfall of 14.7 cm (5.79 in) over the same period from 1972 to 2004. Post-closure monitoring verifies that the CAU 112 trench covers are performing properly and that no water is infiltrating into or out of the waste trenches. Sail moisture measurements are obtained in the soil directly beneath the trenches and compared to baseline conditions for the first year of post-closure monitoring, which began in october 1993. neutron logging was performed twice during this monitoring period along 30 neutron access tubes to obtain soil moisture data and detect any changes that may indicate moisture movement
23. ATSR congress - Proceedings; 23eme congres de l'ATSR - Recueil des conferences
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-11-15
This document brings together the available presentations given at the 23. congress of the French association for radiation protection techniques and sciences (ATSR): 1 - J-F. Lecomte (CIPR): International commission of radiological protection (ICRP)'s recommendations; 2 - T. Lahaye (DGT): presentation of the 'worker's decree'; 3 - C. Marchal (DGSNR): Nuclear safety authority (ASN) viewpoint: first controllers' experience feedback; 4 - F. Rollinger (IRSN): missions of the IRSN's public expert for workers radiation protection; 5 - J-C. Varin (Areva NC): technical, organisational and managerial aspects of the implementation of new regulatory dispositions about radiation protection technical controls at La Hague facility; 6 - J-J. Radecki (Areva NC): enforcement of the radiological zoning by-law at Areva facilities; 7 - D. Miniere (EDF): implementation of the ALARA approach at EDF's nuclear power plants; 8 - D. Lefer (EAMEA): situation in the army and issues generated by the new decree; 9 - L. Ridel (DGA SPN): waste management aspect in the framework of submarines dismantling; 10 - D. Giordan (CMIR 78): the workers' decree: from practice to intervention; 11 - N. Barrey (CHU Bordeaux): enforcement of the May 2004 by-law and experience feedback; 12 - J-C. Mozziconacci (CH Bourges): zoning, reclassification and implementation of the medical imaging operational dosimetry in a medium size hospital; 13 - J. Bino (AMEST Lille): recommendations and technical instructions for labour doctors; 14 - K. Zarraa (CERAP): decree impact on approved organisations; 15 - D. Morio (COFREND): difficulties encountered with the implementation of radiographical devices; 16 - B. Carrez (Ponts et Chaussees): workplace studies and operational dosimetries: essential tools at public work sites; 17 - G. Imbard (CEA): evolution of workers regulation, adaptation of practices at Marcoule site; 18 - M. Ammerich (CEA): ambiguities and enforcement difficulties of
A Study Plan for Determining Recharge Rates at the Hanford Site Using Environmental Tracers
Energy Technology Data Exchange (ETDEWEB)
Murphy, E. M.; Szecsody, J. E.; Phillips, S. J.
1991-02-01
This report presents a study plan tor estimating recharge at the Hanford Site using environmental tracers. Past operations at the Hanford Site have led to both soil and groundwater contamination, and recharge is one of the primary mechanisms for transporting contaminants through the vadose zone and into the groundwater. The prediction of contaminant movement or transport is one aspect of performance assessment and an important step in the remedial investigation/feasibility study (RI/FS) process. In the past, recharge has been characterized by collecting lysimeter data. Although lysimeters can generate important and reliable data, their limitations include 1) fixed location, 2) fixed sediment contents, 3) edge effects, 4) low rates, and 5) relatively short duration of measurement. These limitations impact the ability to characterize the spatial distribution of recharge at the Hanford Site, and thus the ability to predict contaminant movement in the vadose zone. An alternative to using fixed lysimeters for determining recharge rates in the vadose zone is to use environmental tracers. Tracers that have been used to study water movement in the vadose zone include total chloride, {sup 36}CI, {sup 3}H, and {sup 2}H/{sup 18}O. Atmospheric levels of {sup 36}CI and {sup 3}H increased during nuclear bomb testing in the Pacific, and the resulting "bomb pulse" or peak concentration can be measured in the soil profile. Locally, past operations at the Hanford Site have resu~ed in the atmospheric release of numerous chemical and isotopic tracers, including nitrate, {sup 129}I, and {sup 99}Tc. The radionuclides, in particular, reached a well-defined atmospheric peak in 1945. Atmospheric releases of {sup 129}I and {sup 99}Tc were greatly reduced by mid-1946, but nitrogen oxides continued to be released from the uranium separations facilities. As a result, the nitrate concentrations probably peaked in the mid-1950s, when the greatest number of separations facilities were operating
Case study of siting technology for underground nuclear power plant
International Nuclear Information System (INIS)
Hibino, Satoshi; Komada, Hiroya; Honsho, Shizumitsu; Fujiwara, Yoshikazu; Motojima, Mutsumi; Nakagawa, Kameichiro; Nosaki, Takashi
1991-01-01
Underground siting method is one of new feasible siting methods for nuclear power plants. This report presents the results on case studies on underground siting. Two sites of a steeply inclined and plateau like configurations were selected. 'Tunnel type cavern; all underground siting' method was applied for the steeply inclined configuration, and 'shaft type semi-cavern; partial underground siting' method was applied for the plateau like configuration. The following designs were carried out for these two sites as case studies; (1) conceptual designs, (2) geological surveys and rock mechanics tests, (3) stability analysis during cavern excavations, (4) seismic stability analysis of caverns during earthquake, (5) reinforcement designs for caverns, (6) drainage designs. The case studies showed that these two cases were fully feasible, and comparison between two cases revealed that the 'shaft type semi-cavern; partial underground siting' method was more suitable for Japanese islands. As a first step of underground siting, therefore, the authors recommend to construct a nuclear power plant by this method. (author)
Kristensen, Pål; Heir, Trond; Herlofsen, Pål H; Langsrud, Øyvind; Weisæth, Lars
2012-01-01
We prospectively studied parental mental health after suddenly losing a son in a military training accident. Parents (N = 32) were interviewed at 1, 2 and 23 years after the death of their son. The General Health Questionnaire and Expanded Texas Inventory of Grief were self-reported at 1, 2, 5, and 23 years; the Inventory of Complicated Grief was self-reported at 23 years. We observed a high prevalence of psychiatric disorders at 1- and 2-year follow-ups (57% and 45%, respectively), particularly major depression (43% and 31%, respectively). Only one mental disorder was diagnosed at the 23-year follow-up. Grief and psychological distress were highest at 1- and 2-year follow-ups. Spouses exhibited a high concordance of psychological distress. Mothers reported more intense grief reactions than did fathers. The loss of a son during military service may have a substantial impact on parental mental health particularly during the first 2 years after death. Spouses' grief can be interrelated and may contribute to their psychological distress.
Ichikawa, Shoji; Sorenson, Andrea H.; Austin, Anthony M.; Mackenzie, Donald S.; Fritz, Timothy A.; Moh, Akira; Hui, Siu L.; Econs, Michael J.
2009-01-01
Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia. The disease is caused by inactivating mutations in fibroblast growth factor 23 (FGF23), Klotho (KL), and uridine diphosphate-N-acetyl-α-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). In vitro studies indicate that GALNT3 O-glycosylates a phosphaturic hormone, FGF23, and prevents its proteolytic processing, thereby allowing secretion of intact FGF23. In this study we generat...
Iron site occupancies in magnetite-ulvospinel solid solution: A new approach using XMCD
Energy Technology Data Exchange (ETDEWEB)
Pearce, C. I.; Henderson, C. M. B.; Telling, N. D.; Pattrick, R. A.D.; Vaughan, D. J.; Charnock, J. M.; Arenholz, E.; Tuna, F.; Coker, V.S.; Laan, G. van der
2009-06-22
Ordering of Fe{sup 3+} and Fe{sup 2+} between octahedral (Oh) and tetrahedral (Td) sites in synthetic members of the magnetite (Fe{sub 3}O{sub 4}) - ulvoespinel (Fe{sub 2}TiO{sub 4}) solid-solution series was determined using Fe L{sub 2,3}-edge X-ray magnetic circular dichroism (XMCD) coupled with electron microprobe and chemical analysis, Ti L-edge spectroscopy, Fe K-edge EXAFS and XANES, Fe{sub 57} Moessbauer spectroscopy, and unit cell parameters. Microprobe analysis, cell edges and chemical FeO determinations showed that the bulk compositions of the samples were stoichiometric magnetite-ulvoespinel solid-solutions. Surface sensitive XMCD showed that the surfaces of these oxide minerals were more sensitive to redox conditions and some samples required re-equilibration with suitable solid-solid buffers. Detailed site-occupancy analysis of these samples gave XMCD-Fe{sup 2+}/Fe{sup 3+} ratios very close to stoichiometric values. L{sub 2,3}-edge spectroscopy showed that Ti{sup 4+} was restricted to Oh sites. XMCD results showed that significant Fe{sup 2+} only entered Td when the Ti content was > 0.40 apfu while Fe{sup 2+} in Oh increased from 1 a.p.f.u in magnetite to a maximum of {approx}1.4 apfu in USP45. As the Ti content increased from this point, the steady increase in Fe{sup 2+} in Td sites was clearly observable in the XMCD spectra, concurrent with a slow decrease in Fe{sup 2+} in Oh sites. Calculated magnetic moments showed a steady decrease from magnetite (4.06 {mu}{sub B}) to USP45 (1.5 {mu}{sub B}) and then a slower decrease towards the value for ulvoespinel (0 {mu}{sub B}). Two of the synthesized samples were also partially maghemitized by re-equilibrating with an oxidizing Ni-NiO buffer and XMCD showed that Fe{sup 2+} oxidation only occurred at Oh sites, with concomitant vacancy formation restricted to this site. This study shows the advantage of using XMCD as a direct measurement of Fe oxidation state in these complex magnetic spinels. These results
Mortality in employees at a New Zealand agrochemical manufacturing site
Burns, Carol J.; Herbison, G. Peter; Humphry, Noel F.; Bodner, Kenneth; Collins, James J.
2009-01-01
Background Previous studies at the Dow AgroSciences (Formerly Ivon Watkins-Dow) plant in New Plymouth, New Zealand, had raised concerns about the cancer risk in a subset of workers at the site with potential exposure to 2,3,7,8-tetrachlorodibenzo-p-dioxin. As the plant had been involved in the synthesis and formulation of a wide range of agrochemicals and their feedstocks, we examined the mortality risk for all workers at the site. Aims To quantify the mortality hazards arising from employment at the Dow AgroSciences agrochemical production site in New Plymouth, New Zealand. Methods Workers employed between 1 January 1969 and 1 October 2003 were followed up to the end of 2004. Standardized mortality ratios (SMRs) were calculated using national mortality rates by employment duration, sex, period of hire and latency. Results A total of 1754 employees were followed during the study period and 247 deaths were observed. The all causes and all cancers SMRs were 0.97 (95% CI 0.85–1.10) and 1.01 (95% CI 0.80–1.27), respectively. Mortality due to all causes was higher for short-term workers (SMR 1.23, 95% CI 0.91–1.62) than long-term workers (SMR 0.92, 95% CI 0.80–1.06) and women had lower death rates than men. Analyses by latency and period of hire did not show any patterns consistent with an adverse impact of occupational exposures. Conclusions The mortality experience of workers at the site was similar to the rest of New Zealand. PMID:19297337
Social implications of knowing Yahweh: A study of Jeremiah 9:22�23
Directory of Open Access Journals (Sweden)
Wilhelm J. Wessels
2009-09-01
Full Text Available In the brief passage of Jeremiah 9:22�23, wisdom, might and riches are explicitly rejected as reasons for boasting. The only true reason for boasting is if a person �knows Yahweh�. In verse 23, this is linked with three other concepts: steadfast love, justice and righteousness. Jeremiah described the society of his day as corrupt in every sense of the word. People were stubborn, refused to acknowledge Yahweh and showed no signs of truly knowing him. They had, in fact, deserted the Torah of Yahweh. To know Yahweh has social implications. The rhetorical appeal of Jeremiah 9:22�23 to readers and hearers of this oracle is quite clear. To know Yahweh is not to claim to be wise or be the strongest or have the most possessions but to respond to Yahweh�s way of acting. This implies an understanding of his loving�kindness and acting in a morally correct way.
Troedhan, Angelo; Schlichting, Izabela; Kurrek, Andreas; Wainwright, Marcel
2014-07-30
Implant-Insertion-Torque-Value (ITV) proved to be a significant clinical parameter to predict long term implant success-rates and to decide upon immediate loading. The study evaluated ITVs, when four different and commonly used biomaterials were used in sinuslift-procedures compared to natural subantral bone in two-stage-implant-procedures. The tHUCSL-INTRALIFT-method was chosen for sinuslifting in 155 sinuslift-sites for its minimal invasive transcrestal approach and scalable augmentation volume. Four different biomaterials were inserted randomly (easy-graft CRYSTAL n = 38, easy-graft CLASSIC n = 41, NanoBone n = 42, BioOss n = 34), 2 ccm in each case. After a mean healing period of 8,92 months uniform tapered screw Q2-implants were inserted and Drill-Torque-Values (DTV) and ITV were recorded and compared to a group of 36 subantral sites without need of sinuslifting. DTV/ITV were processed for statistics by ANOVA-tests. Mean DTV/ITV obtained in Ncm were: Control Group 10,2/22,2, Bio-Oss 12,7/26,2, NanoBone 17,5/33,3, easy-graft CLASSIC 20,3/45,9, easy-graft CRYSTAL 23,8/56,6 Ncm, significance-level of differences throughout p < 0,05. Within the limits of this study the results suggest self-hardening solid-block-like bone-graft-materials to achieve significantly better DTV/ITV than loose granulate biomaterials for its suspected improvement of vascularization and mineralization of the subantral scaffold by full immobilization of the augmentation site towards pressure changes in the human sinus at normal breathing.
Site study plan for borehole search and characterization, Deaf Smith County Site, Texas: Revision 1
International Nuclear Information System (INIS)
1987-01-01
This site study plan describes the Borehole Search and Characterization field activities to be conducted during the early stages of Site Characterization at the Deaf Smith County site, Texas. The field program has been designed to provide data useful in addressing information/data needs resulting from Federal/State/Local regulatory requirements and repository program requirements. Air and ground surveys, an extensive literature search, and landowner interviews will be conducted to locate wells within and adjacent to the proposed nuclear waste repository site in Deaf Smith County. Initially, the study will center around the planned Exploratory Shaft Facilities location and will expand outward from that location. Findings from this study may lead to preparation of a new site study plan to search suspected borehole locations, and excavate or reenter known boreholes for additional characterization or remedial action. The Salt Repository Project (SRP) Networks specify the schedule under which the program will operate. The Technical Field Services Contractor (TFSC) is responsible for conducting the field program. Data will be handled and reported in accordance with established SRP procedures. A quality assurance program will be utilized to assure that activities affecting quality are performed correctly and that appropriate documentation is maintained. 13 refs., 6 figs., 3 tabs
Yegenoglu, Selen; Aslan, Dilek; Sozen, Bilge
2012-04-01
In this follow-up study, we aimed to assess national and international pharmaceutical companies' Web sites using guidelines of The Association of Research-Based Pharmaceutical Companies (AIFD) and Pharmaceutical Manufacturers Association of Turkey (IEIS) to define whether there has been progress since 2004. We used two national guidelines in order to evaluate the Web sites of pharmaceutical companies in our study. The first guideline was from IEIS, and the second was from AIFD, which was issued recently. We collected our data between February 1 and April 30, 2011. Data analyses were performed using SPSS version 15.0. Chi squared test was done for comparing the two assessments in different years (2004 and 2011). In general, the progress that we were expecting was not satisfactory for both the international and national companies. The percentage of unmet criteria increased for "links" (from 48.0% to 52.0%) and for "mentioning the responsible person/firm for the Web site design" (from 40.6% to 59.4%) among national companies. We observed statistically significant progress only for the "information for the public" criterion (from 52.9% to 100%) among international companies. On the other hand, there was progress and a statistically significant difference in terms of not displaying any "drug ads" on the Web sites of national firms (from 55.9% to 87.5%), availability of "mail address" (from 88.2% to 100%), "telephone number" (from 88.2% to 100%), "indication of the target group" (from 23.5% to 52.1%), and "disclaimer stating the given information cannot replace a physician or pharmacist" (from 29.4% to 53.1%). Our major recommendation to pharmaceutical companies is to update their Web sites with evidence-based scientific information about themselves and their products using international and national standards. From the companies' perspective, this should be a priority responsibility based on the ethical aspect of individual and community health.
Poly[propane-1,3-diammonium [cuprate(II-bis(μ2-pyridine-2,3-dicarboxylato] trihydrate
Directory of Open Access Journals (Sweden)
Shabnam Hooshmand
2008-02-01
Full Text Available The title polymeric compound {(C3H12N2[Cu(C7H3NO42]·3H2O}n or {(pnH2[Cu(py-2,3-dc2]·3H2O}n (pn is propane-1,3-diamine and py-2,3-dcH2 is pyridine-2,3-dicarboxylic acid, was synthesized by reaction of copper(II chloride dihydrate with a proton-transfer compound, propane-1,3-diammonium pyridine-2,3-dicarboxylate or (pnH2(py-2,3-dc, in aqueous solution. The anion is a six-coordinate complex (site symmetry overline{1}, with a distorted octahedral geometry around CuII, consisting of two bidentate pyridine-2,3-dicarboxylate groups and two O atoms of bridging ligands from (py-2,3-dc2− fragments, which are located in trans positions. The (pnH22+ cation is disordered over two sites by the center of inversion. Intermolecular hydrogen bonds, π–π [centroid–centroid distances of 3.539 (3 Å] and C—O...π stacking interactions [O...Cg = 3.240 (5 Å; Cg is the center of the pyridine ring], connect the various components into a supramolecular structure.
Session II-A. Site characterization
International Nuclear Information System (INIS)
McIntosh, W.
1981-01-01
Section II-A on Site Characterization consists of the following papers which describe the progress made during the past fiscal year toward identifying sites for high-level radioactive waste repositories in deep geologic formations: (1) progress in expanded studies for repository sites; (2) evaluation of geologic and hydrologic characteristics in the Basin and Range Province relative to high-level nuclear waste disposal; (3) siting progress: Permian region; (4) Paradox Basin site exploration: a progress report; (5) progress toward recommending a salt site for an exploratory shaft; (6) status of geologic investigations for nuclear waste disposal at the Nevada Test Site; (7) geohydrologic investigation of the Hanford Site, Washington: basalt waste isolation project. Highlights include: expanding studies in crystalline rocks, both in the Appalachian and Lake Superior regions; laying the ground work with the states in the Basin and Range Province to kick off a joint USGS-state province study; narrowing areas of the Permian and Paradox bedded salt regions to a few promising locations; issuing a Gulf Coast Salt Dome Evaluation report (ONWI-109) for public review and comment; narrowing the Nevada Test Site area and Hanford Site area to locations for detailed site investigations and exploratory shafts; progress in developing the subseabed and space disposals alternatives
Energy Technology Data Exchange (ETDEWEB)
Patrick Matthews
2011-09-01
Corrective Action Unit 366 comprises the six corrective action sites (CASs) listed below: (1) 11-08-01, Contaminated Waste Dump No.1; (2) 11-08-02, Contaminated Waste Dump No.2; (3) 11-23-01, Radioactively Contaminated Area A; (4) 11-23-02, Radioactively Contaminated Area B; (5) 11-23-03, Radioactively Contaminated Area C; and (6) 11-23-04, Radioactively Contaminated Area D. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed July 6, 2011, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 366. The presence and nature of contamination at CAU 366 will be evaluated based on information collected from a field investigation. Radiological contamination will be evaluated based on a comparison of the total effective dose (TED) at sample locations to the dose-based final action level (FAL). The TED will be calculated by summing the estimates of internal and external dose. Results from the analysis of soil samples collected from sample plots will be used to calculate internal radiological dose. Thermoluminescent dosimeters placed at each sample location will be used to measure external radiological dose. Based on historical documentation of the releases
Cutting edge: A critical functional role for IL-23 in psoriasis.
Tonel, Giulia; Conrad, Curdin; Laggner, Ute; Di Meglio, Paola; Grys, Katarzyna; McClanahan, Terrill K; Blumenschein, Wendy M; Qin, Jian-Zhong; Xin, Hong; Oldham, Elizabeth; Kastelein, Robert; Nickoloff, Brian J; Nestle, Frank O
2010-11-15
Interleukin-23 is a key cytokine involved in the generation of Th17 effector cells. Clinical efficacy of an anti-p40 mAb blocking both IL-12 and IL-23 and disease association with single nucleotide polymorphisms in the IL23R gene raise the question of a functional role of IL-23 in psoriasis. In this study, we provide a comprehensive analysis of IL-23 and its receptor in psoriasis and demonstrate its functional importance in a disease-relevant model system. The expression of IL-23 and its receptor was increased in the tissues of patients with psoriasis. Injection of a mAb specifically neutralizing human IL-23 showed IL-23-dependent inhibition of psoriasis development comparable to the use of anti-TNF blockers in a clinically relevant xenotransplant mouse model of psoriasis. Together, our results identify a critical functional role for IL-23 in psoriasis and provide the rationale for new treatment strategies in chronic epithelial inflammatory disorders.
A study on development of monitoring and assessment module for sites
International Nuclear Information System (INIS)
Park, Se Moon; Yoon, Bong Yo; Kim, Dae Jung; Park, Joo Wan; Kim, Chang Lak
2006-01-01
As the development of total management systems for sites along with site environmental information is becoming standard, the system known as the Site Information and Total Environmental database management System (SITES) has been developed over the last two years. The first result was a database management system for storing data obtained from facilities, and a site characterization in addition to an environmental assessment of a site. The SITES database is designed to be effective and practical for use with facility management and safety assessment in relation to Geographic Information Systems. SITES is a total management program, which includes its database, its data analysis system required for site characterization, a safety assessment modeling system and an environment monitoring system. I can contribute to the institutional management of the facility and to its safety reassessment. SITES is composed of two main modules: the SITES Database Module (SDM) and the Monitoring and Assessment (M and A) module. The M and A module is subdivided into two sub-modules: the Safety Assessment System (SAS) and the Site Environmental Monitoring System (SEMS). SAS controls the data (input and output) from the SITES DB for the site safety assessment, whereas SEMS controls the data obtained from the records of the measuring sensors and facilities. The on-line site and environmental monitoring data is managed in SEMS. The present paper introduces the procedure and function of the M and A modules
[sup 99m]Tc-RBC subtraction scintigraphy; Assessmet of bleeding site and rate
Energy Technology Data Exchange (ETDEWEB)
Inagaki, Syoichi; Tonami, Syuichi; Yasui, Masakazu; Kuranishi, Makoto; Sugishita, Kouki; Nakamura, Mamoru (Toyama Medical and Pharmaceutical Univ. (Japan). Hospital)
1994-03-01
Sequential abdominal scintigrams with [sup 99m]Tc-labelled red blood cells (RBC) were subtracted for observing a site of gastrointestinal bleeding and calculating the bleeding rate. This method is technically very easy and can detect the site of bleeding with the minimum rate, as low as 0.2 ml/min., in a phantom experiment. In 23 cases with final diagnosis of gastrointestinal bleeding, conventional non-subtraction scintigraphy detected only 30% (7/23), but subtraction scintigraphy detected 61% (14/23). It was concluded that subtraction scintigraphy had higher sensitivity than conventional scintigraphy for early diagnosing bleeding. A combination of non-subtraction and subtraction scintigraphy is recommended to detect a site of gastrointestinal bleeding in a clinical setting. (author).
Subakti, A. G.; Pratomo, Aditya; Triana, Ika; Khrisnanto, Iwan
2018-03-01
Heritage Tourism is used for experiencing the heritage of city, region, state or country. This travel enables the tourist to learn about local customs, traditions, history and culture. One of the tourist attractions in Cianjur, where an ancient historical megalithic site named Situs Gunung Padang could be found. Situs Gunung Padang which consists of five terraces and five levels, completely built stones. This site is the largest megalithic site in Southeast Asia. There is an enormous tourism potential owned by this site because it expresses and preserving ancient Sundanese cultural in the megalithic era. But the potential of this site seems haven’t made as a tourist attraction compared with Borobudur or Prambanan Temple. The purpose of this research is to analyze the existence of Gunung Padang site as a heritage tourism with SWOT approach to discover what factors need to be repaired. The result of this research is showing that Gunung Padang site has a huge potential if the regional governments and the locals can contribute to preserve and making this site as a tourist attraction.
International Nuclear Information System (INIS)
1987-06-01
The Land Use Site Study Plan describes a field program consisting of characterization of the site; seismic survey rights-of-way and transportation and utility corridors, the vicinity, the region, future land use, and monitoring land-use change. Aerial photography will be used to characterize the site, seismic rows and transportation and utility corridors, and the vicinity. The resulting land-use maps and overlays will then be verified in the field. Interviews with farm managers and local experts will provide additional information. A Geographic Information System (GIS) and satellite imagery will be used to characterize the region, monitor land-use change, and provide information to assist with the future land use study. The site study plan describes the study design and rationale, the filed data collection procedures and equipment, the data analysis methods and application of results, the data management strategy, the schedule of field activities, the personnel requirements and management of the study, and the study's quality assurance program. The directives and requirements that drive these studies are derived from the Salt Repository Project Requirements Document. 51 refs; 6 figs; 3 tabs
Thamsborg, Lise Holst; Andersen, Berit; Larsen, Lise Grupe; Christensen, Jette; Johansen, Tonje; Hariri, Jalil; Christiansen, Sanne; Rygaard, Carsten; Lynge, Elsebeth
2018-05-26
The first birth cohorts of women offered human papillomavirus (HPV) vaccination as girls are now entering cervical screening. However, there is no international consensus on how to screen HPV vaccinated women. These women are better protected against cervical cancer and could therefore be offered less intensive screening. Primary HPV testing is more sensitive than cytology, allowing for a longer screening interval. The aim of Trial23 is to investigate if primary HPV testing with cytology triage of HPV positive samples is a reasonable screening scheme for women offered HPV vaccination as girls. Trial23 is a method study embedded in the existing cervical screening programme in four out of five Danish regions. Without affecting the screening programme, women born in 1994 are randomised to present screening with liquid-based cytology every third year (present programme arm) or present screening plus an HPV test (HPV arm). The study started 1 February 2017 and will run over three screening rounds corresponding to 7-8 years. The primary endpoint is cervical intraepithelial neoplasia grade 3 or above. The trial is undertaken as a non-inferiority study including intention-to-treat and per-protocol analyses. The potential effect of primary HPV screening with a 6-year interval will be calculated from the observed data. The study protocol has been submitted to the ethical committee and deemed a method study. All women are screened according to routine guidelines. The study will contribute new evidence on the future screening of HPV vaccinated birth cohorts of women. All results will be published in open-access journal. NCT03049553; Pre-results. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Bhattarai, Mukunda; Adhikari, Lok Bijaya; Gautam, Umesh Prasad; Bollinger, Laurent; Hernandez, Bruno; Yokoi, Toshiaki; Hayashida, Takumi
2016-05-01
We propose a reference site for the site effect study in and around the Kathmandu valley, Nepal. The used data were the accelerograms recorded at two stations, DMG and KKA, and velocity seismograms co-recorded at the PKIN station during nine shallow local and regional earthquakes of local magnitude equal to or greater than 5.0. The DMG station is located on the thick sediments of the Kathmandu valley, whereas the others are rock sites. The KKA station is located on the granite and gneisses of the Shivapuri Lekh about 10 km northwest of the capital, and the PKIN station is in the tunnel of an old iron mine on the southern slope of the Phulchauki Hill about 15 km southeast. The spectral ratios of the ground motion records of the DMG station compared to those of the PKIN station, for all considered earthquakes, confirm that the DMG station has amplification ranging from 1 to 10 in the frequency range of 0.5-10 Hz, and spectral ratios of the KKA station referenced by the PKIN station show that the KKA station has significant amplification in the frequency range of 4-10 Hz and the peak value of the spectral ratio is at most over 25. Therefore, the site amplification in and around Kathmandu valley would be significantly underestimated in the frequency range from 4 to 10 Hz if the records of the KKA station were used as a proxy for input seismic motions to the sediment. Based on the above analysis, we propose that the PKIN station should be considered as a reliable reference site for the assessment of seismic hazards in and around the Kathmandu valley.
A study in usability: redesigning a health sciences library's mobile site.
Rosario, Jovy-Anne; Ascher, Marie T; Cunningham, Diana J
2012-01-01
A mobile site redesign was conducted at a medium-sized academic health sciences library with the goal of creating a site that meets the mobile information needs of its users. The redesign phases included (1) needs assessment, (2) usability testing, and (3) site design. The survey results showed that Apple devices were the most prevalent; the most desirable activities performed on a mobile site were searching for articles, accessing full-text articles and e-books, searching databases, and searching the catalog. These activities guided the development of the usability testing tasks and the redesign. All phases were completed within six months, and the total project cost was $50 for incentive purchases. Copyright © Taylor & Francis Group, LLC
Studies for site preparation for ITER construction
International Nuclear Information System (INIS)
Fardeau, A.; Blanc, F.; Cardettini, J.D.; Mandine, J.R.; Guerin, R.; Patisson, L.; Bergegere, P.; Santagiustina, A.; Garin, P.
2004-01-01
The implantation of a nuclear facility such as ITER (about 20 buildings on 40 ha) requires many preparatory studies, particularly with respect to: Underground characteristics; Topography, layout; Deforestation, excavations; Networks, fences and roads; Impact of seismic hazard on design. This paper presents the main results of these studies, carried out within the European ITER Site Studies framework. A dedicated paper in the conference deals with the transport studies. To choose the site for ITER implantation, detailed geological, hydrogeological and geophysical investigations have been carried out. Taking into account the meteorological data (particularly the main wind direction), topography, access, electrical supply, fluids needs and constraints (gravity systems), buildings and roads have been implemented. (authors)
Background complementary hydrogeochemical studies. SDM-Site Forsmark
Energy Technology Data Exchange (ETDEWEB)
Kalinowski, Birgitta E. (ed.)
2008-08-15
in geochemistry, hydrochemistry, hydrogeochemistry, microbiology, geomicrobiology, analytical chemistry etc. The resulting site descriptive model version, mainly based on 2.2 data and complementary 2.3 data, was carried out during September 2006 to December 2007. Several groups within ChemNet were involved and the evaluation was conducted independently using different approaches ranging from expert knowledge to geochemical and mathematical modelling including transport modelling. During regular ChemNet meetings the results have been presented and discussed. This report is a compilation of different projects that have been finished independently of each other. Section 1: M3 modelling and 2D visualisation of the hydrochemical parameters by Ioana Gurban. The focus of this part is on updating the hydrochemical model, to make uncertainty tests and to present the final models that can be integrated better with the hydrodynamic models. M3 modelling helps to summarise and understand the measured data, by using the major elements and the isotopes delta18O and delta2H as variables. The visualisation of the mixing proportions along the boreholes helps to understand the distribution of the data in the domain and to check and compare the results of different models; and therefore to choose the model which best describes the measured data. Section 2: Coupled hydrogeological and solute transport, visualisation and supportive detailed reaction modelling by Jorge Molinero, David Arcos, Lara Duro. Reactive mixing and reactive solute transport models are used as quantitative tools in order to evaluate how much disturbance can be allowed for a given groundwater sample at repository depth and still meet the SKB suitability criteria. Spatial analysis and 3D visualisation of available representative samples in Forsmark was performed. The computed M3 mixing fractions show a spatial distribution qualitatively correlated with key hydrochemical signatures, such as strontium (for Deep Saline
Site Specific Ground Response Analysis for Quantifying Site Amplification at A Regolith Site
Directory of Open Access Journals (Sweden)
Bambang Setiawan
2017-08-01
Full Text Available DOI: 10.17014/ijog.4.3.159-167A numerical model has demonstrated that it can simulate reasonably well earthquake motions at the ground level during a seismic event. The most widely used model is an equivalent linear approach. The equivalent linear model was used to compute the free-field response of Adelaide regolith during the 1997 Burra earthquake. The aim of this study is to quantify the amplification at the investigated site. The model computed the ground response of horizontally layered soil deposits subjected to transient and vertically propagating shear waves through a one-dimensional-soil column. Each soil layer was assumed to be homogeneous, visco-elastic, and infinite in the horizontal extent. The results of this study were compared to other studies and forward computation of the geotechnical dynamic parameters of the investigated site. The amplification triggered by the 1997 Burra seismic event was deduced. This study reveals the amplification factor up to 3.6 at the studied site.
Social implications of knowing Yahweh: A study of Jeremiah 9:22�23
Wilhelm J. Wessels
2009-01-01
In the brief passage of Jeremiah 9:22�23, wisdom, might and riches are explicitly rejected as reasons for boasting. The only true reason for boasting is if a person �knows Yahweh�. In verse 23, this is linked with three other concepts: steadfast love, justice and righteousness. Jeremiah described the society of his day as corrupt in every sense of the word. People were stubborn, refused to acknowledge Yahweh and showed no signs of truly knowing him. They had, in fact, deserted the Torah of Ya...
Chen, Yu Wai; Tajima, Toshitaka; Rees, Martin; Garcia-Maya, Mitla
2009-09-01
Human homologue A of Rad23 (hHR23A) plays dual roles in DNA repair as well as serving as a shuttle vehicle targeting polyubiquitinated proteins for degradation. Its N-terminal ubiquitin-like (UbL) domain interacts with the 19S proteasomal cap and provides the docking mechanism for protein delivery. Pyramidal crystals of the UbL domain of hHR23A were obtained by the hanging-drop vapour-diffusion method with ammonium sulfate as the crystallizing agent. The crystals diffracted to beyond 2 A resolution and belonged to the hexagonal space group P6(5)22, with unit-cell parameters a = b = 78.48, c = 63.57 A. The structure was solved by molecular replacement using the UbL domain of yeast Dsk2 as the search model.
Mapping Suitable Sites for Setting up Wind Farms: A Case Study of ...
African Journals Online (AJOL)
Mapping Suitable Sites for Setting up Wind Farms: A Case Study of Nyanga District. ... Ethiopian Journal of Environmental Studies and Management ... sources and continuous power shortages make wind energy a very attractive alternative to ...
The Wood and Bark of Hardwoods Growing on Southern Pine Sites - A Pictorial Atlas
Charles W. McMillin; Floyd G. Manwiller
1980-01-01
Provides a pictorial description of the structure and appearance of 23 pine-site hardwoods, an overview of hardwood anatomy, and data on the resource and certain important physical properties of stemwood and bark.
Energy Technology Data Exchange (ETDEWEB)
Patrick Matthews
2012-09-01
Corrective Action Unit (CAU) 105 is located in Area 2 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 105 is a geographical grouping of sites where there has been a suspected release of contamination associated with atmospheric nuclear testing. This document describes the planned investigation of CAU 105, which comprises the following corrective action sites (CASs): • 02-23-04, Atmospheric Test Site - Whitney • 02-23-05, Atmospheric Test Site T-2A • 02-23-06, Atmospheric Test Site T-2B • 02-23-08, Atmospheric Test Site T-2 • 02-23-09, Atmospheric Test Site - Turk These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed on April 30, 2012, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 105. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The potential contamination sources associated with all CAU 105 CASs are from atmospheric nuclear testing activities. The presence and nature of contamination at CAU
{sup 23}Na nuclear magnetic resonance study of the structure and dynamic of natrolite
Energy Technology Data Exchange (ETDEWEB)
Paczwa, Mateusz; Olszewski, Marcin; Sergeev, Nikolaj [Szczecin Univ. (Poland). Inst. of Physics; Sapiga, Aleksej A.; Sapiga, Aleksej V. [Taurida National V.I. Vernadsky Univ., Simferopol, Crimea (Ukraine)
2015-07-01
The temperature dependences of nuclear magnetic resonance (NMR) and magic angle spinning (MAS) NMR spectra of {sup 23}Na nuclei in natrolite (Na{sub 2}Al{sub 2}Si{sub 3}O{sub 10} . 2H{sub 2}O) have been studied. The temperature dependences of the spin-lattice relaxation times T{sub 1} in natrolite have also been studied. It has been shown that the spin-lattice relaxation of the {sup 23}Na is governed by the electric quadrupole interaction with the crystal electric field gradients modulated by translational motion of H{sub 2}O molecules in the natrolite pores. The dipolar interactions with paramagnetic impurities become significant as a relaxation mechanism of the {sup 23}Na nuclei only at low temperature (<270 K).
Astuto, L M; Bork, J M; Weston, M D; Askew, J W; Fields, R R; Orten, D J; Ohliger, S J; Riazuddin, S; Morell, R J; Khan, S; Riazuddin, S; Kremer, H; van Hauwe, P; Moller, C G; Cremers, C W R J; Ayuso, C; Heckenlively, J R; Rohrschneider, K; Spandau, U; Greenberg, J; Ramesar, R; Reardon, W; Bitoun, P; Millan, J; Legge, R; Friedman, T B; Kimberling, W J
2002-08-01
Usher syndrome type I is characterized by congenital hearing loss, retinitis pigmentosa (RP), and variable vestibular areflexia. Usher syndrome type ID, one of seven Usher syndrome type I genetic localizations, have been mapped to a chromosomal interval that overlaps with a nonsyndromic-deafness localization, DFNB12. Mutations in CDH23, a gene that encodes a putative cell-adhesion protein with multiple cadherin-like domains, are responsible for both Usher syndrome and DFNB12 nonsyndromic deafness. Specific CDH23 mutational defects have been identified that differentiate these two phenotypes. Only missense mutations of CDH23 have been observed in families with nonsyndromic deafness, whereas nonsense, frameshift, splice-site, and missense mutations have been identified in families with Usher syndrome. In the present study, a panel of 69 probands with Usher syndrome and 38 probands with recessive nonsyndromic deafness were screened for the presence of mutations in the entire coding region of CDH23, by heteroduplex, single-strand conformation polymorphism, and direct sequence analyses. A total of 36 different CDH23 mutations were detected in 45 families; 33 of these mutations were novel, including 18 missense, 3 nonsense, 5 splicing defects, 5 microdeletions, and 2 insertions. A total of seven mutations were common to more than one family. Numerous exonic and intronic polymorphisms also were detected. Results of ophthalmologic examinations of the patients with nonsyndromic deafness have found asymptomatic RP-like manifestations, indicating that missense mutations may have a subtle effect in the retina. Furthermore, patients with mutations in CDH23 display a wide range of hearing loss and RP phenotypes, differing in severity, age at onset, type, and the presence or absence of vestibular areflexia.
Astuto, L. M.; Bork, J. M.; Weston, M. D.; Askew, J. W.; Fields, R. R.; Orten, D. J.; Ohliger, S. J.; Riazuddin, S.; Morell, R. J.; Khan, S.; Riazuddin, S.; Kremer, H.; van Hauwe, P.; Moller, C. G.; Cremers, C. W. R. J.; Ayuso, C.; Heckenlively, J. R.; Rohrschneider, K.; Spandau, U.; Greenberg, J.; Ramesar, R.; Reardon, W.; Bitoun, P.; Millan, J.; Legge, R.; Friedman, T. B.; Kimberling, W. J.
2002-01-01
Usher syndrome type I is characterized by congenital hearing loss, retinitis pigmentosa (RP), and variable vestibular areflexia. Usher syndrome type ID, one of seven Usher syndrome type I genetic localizations, have been mapped to a chromosomal interval that overlaps with a nonsyndromic-deafness localization, DFNB12. Mutations in CDH23, a gene that encodes a putative cell-adhesion protein with multiple cadherin-like domains, are responsible for both Usher syndrome and DFNB12 nonsyndromic deafness. Specific CDH23 mutational defects have been identified that differentiate these two phenotypes. Only missense mutations of CDH23 have been observed in families with nonsyndromic deafness, whereas nonsense, frameshift, splice-site, and missense mutations have been identified in families with Usher syndrome. In the present study, a panel of 69 probands with Usher syndrome and 38 probands with recessive nonsyndromic deafness were screened for the presence of mutations in the entire coding region of CDH23, by heteroduplex, single-strand conformation polymorphism, and direct sequence analyses. A total of 36 different CDH23 mutations were detected in 45 families; 33 of these mutations were novel, including 18 missense, 3 nonsense, 5 splicing defects, 5 microdeletions, and 2 insertions. A total of seven mutations were common to more than one family. Numerous exonic and intronic polymorphisms also were detected. Results of ophthalmologic examinations of the patients with nonsyndromic deafness have found asymptomatic RP–like manifestations, indicating that missense mutations may have a subtle effect in the retina. Furthermore, patients with mutations in CDH23 display a wide range of hearing loss and RP phenotypes, differing in severity, age at onset, type, and the presence or absence of vestibular areflexia. PMID:12075507
Energy Technology Data Exchange (ETDEWEB)
NSTec Environmental Restoration
2010-03-15
This Corrective Action Decision Document (CADD)/Closure Report (CR) was prepared by the Defense Threat Reduction Agency (DTRA) for Corrective Action Unit (CAU) 504, 16a-Tunnel Muckpile. This CADD/CR is consistent with the requirements of the Federal Facility Agreement and Consent Order (FFACO) agreed to by the State of Nevada; U.S. Department of Energy (DOE), Environmental Management; U.S. Department of Defense; and DOE, Legacy Management. Corrective Action Unit 504 is comprised of four Corrective Action Sites (CASs): • 16-06-01, Muckpile • 16-23-01, Contaminated Burial Pit • 16-23-02, Contaminated Area • 16-99-01, Concrete Construction Waste Corrective Action Site 16-23-01 is not a burial pit; it is part of CAS 16-06-01. Therefore, there is not a separate data analysis and assessment for CAS 16-23-01; it is included as part of the assessment for CAS 16-06-01. In addition to these CASs, the channel between CAS 16-23-02 (Contaminated Area) and Mid Valley Road was investigated with walk-over radiological surveys and soil sampling using hand tools. The purpose of this CADD/CR is to provide justification and documentation supporting the recommendation for closure in place with use restrictions for CAU 504. A CADD was originally submitted for CAU 504 and approved by the Nevada Division of Environmental Protection (NDEP). However, following an agreement between NDEP, DTRA, and the DOE, National Nuclear Security Administration Nevada Site Office to change to a risk-based approach for assessing the corrective action investigation (CAI) data, NDEP agreed that the CAU could be re-evaluated using the risk-based approach and a CADD/CR prepared to close the site.
Web vulnerability study of online pharmacy sites.
Kuzma, Joanne
2011-01-01
Consumers are increasingly using online pharmacies, but these sites may not provide an adequate level of security with the consumers' personal data. There is a gap in this research addressing the problems of security vulnerabilities in this industry. The objective is to identify the level of web application security vulnerabilities in online pharmacies and the common types of flaws, thus expanding on prior studies. Technical, managerial and legal recommendations on how to mitigate security issues are presented. The proposed four-step method first consists of choosing an online testing tool. The next steps involve choosing a list of 60 online pharmacy sites to test, and then running the software analysis to compile a list of flaws. Finally, an in-depth analysis is performed on the types of web application vulnerabilities. The majority of sites had serious vulnerabilities, with the majority of flaws being cross-site scripting or old versions of software that have not been updated. A method is proposed for the securing of web pharmacy sites, using a multi-phased approach of technical and managerial techniques together with a thorough understanding of national legal requirements for securing systems.
WHAMM links actin assembly via the Arp2/3 complex to autophagy.
Kast, David J; Dominguez, Roberto
2015-01-01
Macroautophagy (hereafter autophagy) is the process by which cytosolic material destined for degradation is enclosed inside a double-membrane cisterna known as the autophagosome and processed for secretion and/or recycling. This process requires a large collection of proteins that converge on certain sites of the ER membrane to generate the autophagosome membrane. Recently, it was shown that actin accumulates around autophagosome precursors and could play a role in this process, but the mechanism and role of actin polymerization in autophagy were unknown. Here, we discuss our recent finding that the nucleation-promoting factor (NPF) WHAMM recruits and activates the Arp2/3 complex for actin assembly at sites of autophagosome formation on the ER. Using high-resolution, live-cell imaging, we showed that WHAMM forms dynamic puncta on the ER that comigrate with several autophagy markers, and propels the spiral movement of these puncta by an Arp2/3 complex-dependent actin comet tail mechanism. In starved cells, WHAMM accumulates at the interface between neighboring autophagosomes, whose number and size increases with WHAMM expression. Conversely, knocking down WHAMM, inhibiting the Arp2/3 complex or interfering with actin polymerization reduces the size and number of autophagosomes. These findings establish a link between Arp2/3 complex-mediated actin assembly and autophagy.
Salmon Site Remediation Investigation Report, Appendix A
International Nuclear Information System (INIS)
1999-01-01
installation of a water supply system that will provide potable water to the site and residence in the proximity to the site; (2) continued maintenance of surface institutional controls and subsurface restrictions; and (3) continue to implement the long-term hydrologic monitoring program. The Salmon Site will be relinquished the State of Mississippi as mandated by Public Law 104-201-September 23, 1996, to be used as a demonstration forest/wildlife refuge. Should the land use change in the future and/or monitoring information indicates a change in the site conditions, the DOE will reassess the risk impacts to human health and the environment
Role of grass-legume communities in revegetation of a subalpine mine site in British Columbia
Energy Technology Data Exchange (ETDEWEB)
Yamanaka, K
1982-01-01
This study describes an investigation of the potential for pioneer grass-legume communities to stabilize and ameliorate geologically-fresh soil leading to the establishment of a self-sustaining, progressive plant succession on a surface-mined subalpine site. The study area is located 2000 m above sea level in the Canadian Rocky Mountains. Field studies revealed chronological trends in grass-legume communities at four sites revegetated during 1974-1978 including: species composition, legumes (Trifolium repens L., T. hybridum L. and Medicago sativa L.) performing increasingly poorly on the older sites; biomass changes, a shoot to root ratio (S/R) decreasing from 2.3 to 0.2 as the communities aged; and litter accumulation which continued even on the oldest site. Fertilizer (13-16-10) operationally applied at 150-391 kg/ha enhanced the growth of Dactylis gomerata L. and litter degradation, and acidified the soil. Nitrogen fertilization was also associated with two clear inverse relationships identified between D. glomerata and Festuca rubra L. biomass, and between soil pH and phosphorus levels. In greenhouse tests grasses were revealed to be more efficient soil nitrogen consumers than were legumes and nitrogen fixation decreased significantly (P < 0.01) and linearly with increasing grass seeding rates.
Site study plan for regional hydrologic sampling and monitoring: Preliminary draft
International Nuclear Information System (INIS)
Dutton, A.R.
1987-01-01
The purpose of the Regional Hydrologic Studies Plan is to describe those field activities required for completion of the objectives of hydrologic activities. Many of these activities are regional in scope and are designed to provide a framework for understanding the hydrologic setting of the site and the hydrologic processes that influence site characteristics. Site Study Plans (SSPs) define activates at and in the immediate vicinity of the site. The activities specified in the Regional Hydrologic Studies Plan are performed beyond the confines of the site because the hydrologic systems extend beyond the site boundaries, because pertinent data that bear on site suitability are available outside of the site, and because natural analogues exist outside of the site that allow analysis of processes that are expected to operate within the site. 15 refs., 5 figs., 1 tab
Single crystal magnetic, dielectric and thermal studies of the relaxor ferroelectric Pb(Fe2/3W1/3)O3
International Nuclear Information System (INIS)
Ye, Z.G.; Sato, M.; Kita, E.; Bursill, L.A.; Schmid, H.
1998-01-01
The magnetic, dielectric and thermal properties of the complex perovskite Pb(Fe 2/3 W 1/3 )O 3 [PFW] have been studied on single crystals by means of a SQUID magnetometer, dielectric measurements and thermal analysis. Anomalies in the temperature dependence of the magnetization have revealed magnetic phase transitions at T N1 =350 K and T N2 =20 K. These two steps of antiferromagnetic ordering are attributed to the microstructural feature of the complex perovskite, characterized by ordered and disordered arrangements on the B-site, giving rise to a strong superexchange interaction of - Fe 3 + - O - Fe 3+ - type with a higher ordering temperature, and to a weak superexchange interaction of the B-site ordered elpasolite type - Fe 3+ + - O - W - O - Fe 3+ - with a lower Neel temperature. The low temperature antiferromagnetic phase exhibits a weak ferromagnetism. The dielectric properties of PFW show a relaxor ferroelectric behaviour with a dispersive maximum of permittivity at Tm (170 -190 K). The magnetic phase transition at T N2 =20 K results in anomalies both of the real part of permittivity and the dissipation factor, suggesting a magneto-electric coupling via magneto-structural interactions
Closure Report for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada
Energy Technology Data Exchange (ETDEWEB)
NSTec Environmental Restoration
2009-07-31
Corrective Action Unit (CAU) 139 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Waste Disposal Sites' and consists of the following seven Corrective Action Sites (CASs), located in Areas 3, 4, 6, and 9 of the Nevada Test Site: CAS 03-35-01, Burn Pit; CAS 04-08-02, Waste Disposal Site; CAS 04-99-01, Contaminated Surface Debris; CAS 06-19-02, Waste Disposal Site/Burn Pit; CAS 06-19-03, Waste Disposal Trenches; CAS 09-23-01, Area 9 Gravel Gertie; and CAS 09-34-01, Underground Detection Station. Closure activities were conducted from December 2008 to April 2009 according to the FFACO (1996, as amended February 2008) and the Corrective Action Plan for CAU 139 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2007b). The corrective action alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. Closure activities are summarized. CAU 139, 'Waste Disposal Sites,' consists of seven CASs in Areas 3, 4, 6, and 9 of the NTS. The closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. This CR provides a summary of completed closure activities, documentation of waste disposal, and confirmation that remediation goals were met. The following site closure activities were performed at CAU 139 as documented in this CR: (1) At CAS 03-35-01, Burn Pit, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (2) At CAS 04-08-02, Waste Disposal Site, an administrative UR was implemented. No postings or post-closure monitoring are required. (3) At CAS 04-99-01, Contaminated Surface Debris, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (4) At CAS 06-19-02, Waste Disposal Site/Burn Pit, no work was performed. (5) At CAS 06-19-03, Waste Disposal Trenches, a native soil cover was installed
Closure Report for Corrective Action Unit 139: Waste Disposal Sites, Nevada Test Site, Nevada
International Nuclear Information System (INIS)
2009-01-01
Corrective Action Unit (CAU) 139 is identified in the Federal Facility Agreement and Consent Order (FFACO) as 'Waste Disposal Sites' and consists of the following seven Corrective Action Sites (CASs), located in Areas 3, 4, 6, and 9 of the Nevada Test Site: CAS 03-35-01, Burn Pit; CAS 04-08-02, Waste Disposal Site; CAS 04-99-01, Contaminated Surface Debris; CAS 06-19-02, Waste Disposal Site/Burn Pit; CAS 06-19-03, Waste Disposal Trenches; CAS 09-23-01, Area 9 Gravel Gertie; and CAS 09-34-01, Underground Detection Station. Closure activities were conducted from December 2008 to April 2009 according to the FFACO (1996, as amended February 2008) and the Corrective Action Plan for CAU 139 (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2007b). The corrective action alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. Closure activities are summarized. CAU 139, 'Waste Disposal Sites,' consists of seven CASs in Areas 3, 4, 6, and 9 of the NTS. The closure alternatives included No Further Action, Clean Closure, and Closure in Place with Administrative Controls. This CR provides a summary of completed closure activities, documentation of waste disposal, and confirmation that remediation goals were met. The following site closure activities were performed at CAU 139 as documented in this CR: (1) At CAS 03-35-01, Burn Pit, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (2) At CAS 04-08-02, Waste Disposal Site, an administrative UR was implemented. No postings or post-closure monitoring are required. (3) At CAS 04-99-01, Contaminated Surface Debris, soil and debris were removed and disposed as LLW, and debris was removed and disposed as sanitary waste. (4) At CAS 06-19-02, Waste Disposal Site/Burn Pit, no work was performed. (5) At CAS 06-19-03, Waste Disposal Trenches, a native soil cover was installed, and a UR was
Renewable energy potential on brownfield sites: A case study of Michigan
International Nuclear Information System (INIS)
Adelaja, Soji; Shaw, Judy; Beyea, Wayne; Charles McKeown, J.D.
2010-01-01
Federal priorities are increasingly favoring the replacement of conventional sources of energy with renewable energy. With the potential for a federal Renewable Electricity Standard (RES) legislation, many states are seeking to intensify their renewable energy generation. The demand for wind, solar, geothermal and bio-fuels-based energy is likely to be rapidly expressed on the landscape. However, local zoning and NIMBYism constraints slow down the placement of renewable energy projects. One area where land constraints may be lower is brownfields; whose development is currently constrained by diminished housing, commercial, and industrial property demand. Brownfield sites have the potential for rapid renewable energy deployment if state and national interests in this area materialize. This study investigates the application of renewable energy production on brownfield sites using Michigan as a case study. Wind and solar resource maps of Michigan were overlaid with the brownfield locations based on estimates of brownfield land capacity. The total estimated energy potential available on Michigan's brownfield sites is 4320 megawatts (MW) of plate capacity for wind and 1535for solar, equating to 43% of Michigan's residential electricity consumption (using 30% capacity factor). Estimated economic impacts include over $15 billion in investments and 17,500 in construction and long-term jobs.
23 CFR 450.318 - Transportation planning studies and project development.
2010-04-01
... on the human and natural environment, or mitigation of these impacts; and (2) The systems-level... study into the draft Environmental Impact Statement (EIS) or Environmental Assessment, or other means... Environmental Policy Act (NEPA) of 1969 (42 U.S.C. 4321 et seq.) and associated implementing regulations (23 CFR...
CD/MCD/VTVH-MCD Studies of Escherichia coli Bacterioferritin Support a Binuclear Iron Cofactor Site.
Kwak, Yeonju; Schwartz, Jennifer K; Huang, Victor W; Boice, Emily; Kurtz, Donald M; Solomon, Edward I
2015-12-01
Ferritins and bacterioferritins (Bfrs) utilize a binuclear non-heme iron binding site to catalyze oxidation of Fe(II), leading to formation of an iron mineral core within a protein shell. Unlike ferritins, in which the diiron site binds Fe(II) as a substrate, which then autoxidizes and migrates to the mineral core, the diiron site in Bfr has a 2-His/4-carboxylate ligand set that is commonly found in diiron cofactor enzymes. Bfrs could, therefore, utilize the diiron site as a cofactor rather than for substrate iron binding. In this study, we applied circular dichroism (CD), magnetic CD (MCD), and variable-temperature, variable-field MCD (VTVH-MCD) spectroscopies to define the geometric and electronic structures of the biferrous active site in Escherichia coli Bfr. For these studies, we used an engineered M52L variant, which is known to eliminate binding of a heme cofactor but to have very minor effects on either iron oxidation or mineral core formation. We also examined an H46A/D50A/M52L Bfr variant, which additionally disrupts a previously observed mononuclear non-heme iron binding site inside the protein shell. The spectral analyses define a binuclear and an additional mononuclear ferrous site. The biferrous site shows two different five-coordinate centers. After O2 oxidation and re-reduction, only the mononuclear ferrous signal is eliminated. The retention of the biferrous but not the mononuclear ferrous site upon O2 cycling supports a mechanism in which the binuclear site acts as a cofactor for the O2 reaction, while the mononuclear site binds the substrate Fe(II) that, after its oxidation to Fe(III), migrates to the mineral core.
Ichikawa, Shoji; Sorenson, Andrea H; Austin, Anthony M; Mackenzie, Donald S; Fritz, Timothy A; Moh, Akira; Hui, Siu L; Econs, Michael J
2009-06-01
Familial tumoral calcinosis is characterized by ectopic calcifications and hyperphosphatemia. The disease is caused by inactivating mutations in fibroblast growth factor 23 (FGF23), Klotho (KL), and uridine diphosphate-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3). In vitro studies indicate that GALNT3 O-glycosylates a phosphaturic hormone, FGF23, and prevents its proteolytic processing, thereby allowing secretion of intact FGF23. In this study we generated mice lacking the Galnt3 gene, which developed hyperphosphatemia without apparent calcifications. In response to hyperphosphatemia, Galnt3-deficient mice had markedly increased Fgf23 expression in bone. However, compared with wild-type and heterozygous littermates, homozygous mice had only about half of circulating intact Fgf23 levels and higher levels of C-terminal Fgf23 fragments in bone. Galnt3-deficient mice also exhibited an inappropriately normal 1,25-dihydroxyvitamin D level and decreased alkaline phosphatase activity. Furthermore, renal expression of sodium-phosphate cotransporters and Kl were elevated in Galnt3-deficient mice. Interestingly, there were sex-specific phenotypes; only Galnt3-deficient males showed growth retardation, infertility, and significantly increased bone mineral density. In summary, ablation of Galnt3 impaired secretion of intact Fgf23, leading to decreased circulating Fgf23 and hyperphosphatemia, despite increased Fgf23 expression. Our findings indicate that Galnt3-deficient mice have a biochemical phenotype of tumoral calcinosis and provide in vivo evidence that Galnt3 plays an essential role in proper secretion of Fgf23 in mice.
Energy Technology Data Exchange (ETDEWEB)
Matthews, Patrick
2014-05-01
Corrective Action Unit (CAU) 573 is located in Area 5 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 573 is a grouping of sites where there has been a suspected release of contamination associated with non-nuclear experiments and nuclear testing. This document describes the planned investigation of CAU 573, which comprises the following corrective action sites (CASs): • 05-23-02, GMX Alpha Contaminated Area • 05-45-01, Atmospheric Test Site - Hamilton These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives.
Topoisomerase I tyrosine phosphorylation site and the DNA-interactive site
International Nuclear Information System (INIS)
Roll, D.; Durban, E.
1986-01-01
Phosphorylation of topoisomerase I (topo I) at serine by NII kinase is accompanied by stimulation of enzymatic activity. In contrast, phosphorylation at tyrosine by tyrosine kinase seems to inhibit enzymatic activity. This inhibition may be caused by interference of the phosphorylated tyrosine residue with the interaction of topo I with DNA. To test this, topo I was labeled with crude membrane fraction enriched for EGF-receptor kinase in presence of γ-P32-ATP and electrophoresed on SDS-polyacrylamide gels. Stained topo I bands were excised, dried, digested with trypsin and analyzed on a C18 reverse-phase HPLC column. One major peak of radioactivity eluted at fraction 23 with 20% acetonitrile. To obtain the DNA-interactive site, topo I was incubated with pBR322 DNA labeled by nick-translation followed by DNase I treatment, and electrophoresis on SDS-polyacrylamide gels. Tryptic peptides were generated and analyzed by reverse-phase HPLC. A major peak of radioactivity eluted at fraction 16-18 with 15.5-17% acetonitrile. Studies are in progress to resolve whether (a) the two peptides are different, i.e. the tyrosine-P site and DNA-tyrosine interactive site are localized at different regions of the topo I or (b) the peptide sequences are identical but the covalent attachment of deoxynucleotides altered the peptide's elution from the HPLC column
Di Fiore, Adolfo; Sivolella, Stefano; Stocco, Elena; Favero, Vittorio; Stellini, Edoardo
2018-02-01
Implant site preparation through drilling procedures may cause bone thermonecrosis. The aim of this in vitro study was to evaluate, using a thermal probe, overheating at implant sites during osteotomies through 2 different drilling methods (continuous drilling technique versus intermittent drilling technique) using irrigation at different temperatures. Five implant sites 13 mm in length were performed on 16 blocks (fresh bovine ribs), for a total of 80 implant sites. The PT-100 thermal probe was positioned 5 mm from each site. Two physiological refrigerant solutions were used: one at 23.7°C and one at 6.0°C. Four experimental groups were considered: group A (continuous drilling with physiological solution at 23.7°C), group B (intermittent drilling with physiological solution at 23.7°C), group C (continuous drilling with physiological solution at 6.0°C), and group D (intermittent drilling with physiological solution at 6.0°C). The Wilcoxon rank-sum test (2-tailed) was used to compare groups. While there was no difference between group A and group B (W = 86; P = .45), statistically significant differences were observed between experimental groups A and C (W = 0; P =.0001), B and D (W = 45; P =.0005), and C and D (W = 41; P = .003). Implant site preparation did not affect the overheating of the bone. Statistically significant differences were found with the refrigerant solutions. Using both irrigating solutions, bone temperature did not exceed 47°C.
Valentijn, Linda J.; Koster, Jan; Versteeg, Rogier
2006-01-01
NM23-H1 and NM23-H2 are neighboring genes on chromosome 17q. They encode nucleoside diphosphate kinases that have additional roles in signal transduction, transcription, and apoptosis. NM23-H1 expression is a strong marker for prognosis and metastatic behavior in many tumor types. A new
A Comparative Study of Blood Culture Sampling from Umbilical Catheter Line versus Peripheral Site
Directory of Open Access Journals (Sweden)
Abdolkarim Hamedi
2010-08-01
Full Text Available Neonatal sepsis is an important cause of death and morbidity in newborns and is diagnosed by isolation of organism in blood culture. In several reports,reliablity of blood cultures were done from umbi lical catheters,have been demonstrated. The objective of the present study was to determine,wether an inde welling umbilical catheter, could be an alternative site for blood culture. In a prospective study over 6 months during 2006,141 paired blood cultures from 134 infant,were done simultaneously from peripheral site and umbilical catheter (mostly U. V. C,during the first four days of life. Majority of these infants were preterm and admitted to NICU for special care. these infants had indwelling umbilical line and had indication of sepsis workup. A total of 141 pairs of blood cultures were obtained from 134 infants. In 16 infants blood culture pairs were positive for one organism in both peripheral vein and umbilical site. 71. 6% of total cultures (n=11pairs were negative in boths site. A total of 22 pairs were positive in one site only,with 5 positive from peripheral vein only and the other 17 from umblical site. Two pairs were positve in boths site with two different organism. In over all 16 infant (11%of blood were considered to be contaminated. Contamination rate were 2. 4% and 9. 2% for peripheral and umbilical catheter site. Contamination rate increased after 48 hours of age in umbilical catheter. The result showed that after 2 days contamination rate for blood culture taken from catheter line increased and specifity decreased. We recommended that blood culture via umblical catheter in first 2 days in sick neonates with indwelling catheter can be a alternate site of blood culture sampelling.
International Nuclear Information System (INIS)
Chen, Z.; Huang, G.H.; Chakma, A.
1999-01-01
An integrated approach for estimating the distribution of light nonaqueous phase liquids (LNAPLs) such as oil spill and leakage in a porous media is proposed, based on a study at a site located in western Canada. The site has one original release source that is a flare pit, with on-site soil and groundwater seriously contaminated by petroleum products spilled over the past two decades. Results of the study show that soil properties and site characteristics have significant impact on the spreading of contaminants which affect the estimation of contaminant volume. Although the LNAPLs in the subsurface do not appear as a distinct layer, and the volume and distribution differ from site to site, the proposed method offers insight into the contamination details and is, therefore, considered to be an effective and convenient tool for obtaining a reasonable estimate of residual oil volume in the subsurface. Results could also be used in designing an enhanced recovery scheme for the site under study, as well as in designing multi-component models of the subsurface contamination for the purpose of risk assessment. 13 refs., 2 tabs., 2 figs
International Nuclear Information System (INIS)
Bakkum, E.L.
1987-01-01
A study of 23 Na via the 22 Ne(p,γ) 23 Na and 23 Na(γ,γ) 23 Na reactions is presented. Only a limited number of resonances has been studied, selected on the basis of strong excitation of the lowest levels of which the spin was unknown. As a result the spins are now known of all levels of 23 Na with excitation energies up to 7 MeV, except for a few high-spin states which are too weakly excited in the decay of the known 22 Ne(p,γ) resonances. The mean lifetimes of the 23 Na levels at 4.43 and 7.89 MeV were found to be 350±70 and 220±17 attoseconds (1 attosecond = 10 -18 seconds) respectively. 97 refs.; 22 figs.; 12 tabs
Williams, Sarah C.
2010-01-01
The purpose of this study was to investigate how federated search engines are incorporated into the Web sites of libraries in the Association of Research Libraries. In 2009, information was gathered for each library in the Association of Research Libraries with a federated search engine. This included the name of the federated search service and…
Xiang, Xue-Lian; Yang, Xia; Liang, Hai-Wei; Qiu, Xiao-Hui; Yang, Li-Hua; Peng, Zhi-Gang; Chen, Gang
2018-01-01
Mounting evidence has shown that miR-23b-3p, which is associated with cell proliferation, invasion, and apoptosis, acts as a biomarker for diagnosis and outcomes in numerous cancers. However, the clinicopathological implication of miR-23b-3p in hepatocellular carcinoma (HCC) remains unclear. Our study evaluated the role of miR-23b-3p in HCC and investigated its potential application as a marker for preliminary diagnosis and therapy in HCC. High-throughput data from the NCBI Gene Expression Omnibus (GEO) and The Cancer Genome Atlas (TCGA) were collected and analyzed. One hundred and one tissue sections of HCC were paired with adjacent non-cancerous HCC as further supplements. miR-23b-3p expression was detected using quantitative real-time PCR. Additionally, the relationship between miR-23b-3p expression and HCC progression and Time-to-recurrence (months) was explored. Ten algorithms were applied to predict the prospective target genes of miR-23b-3p. Next, we conducted bioinformatics analysis for further study. miR-23b-3p expression was pronouncedly decreased in HCC tissues in contrast with their paired adjacent non-cancerous HCC (PAKT1, EGFR, CTNNB1, BCL2, SMAD3, PTEN and KDM6A, were located in the key nodes with high degree (>35). In conclusion, this study provides impressive illumination of the potential role of miR-23b-3p in HCC tumorigenesis and progression. Furthermore, miR-23b-3p may act as a predictor of HCC and could be a new treatment target. PMID:29484429
Energy Technology Data Exchange (ETDEWEB)
Alfred Wickline
2008-04-01
This Corrective Action Decision Document (CADD)/Closure Report (CR) has been prepared for Corrective Action Unit (CAU) 545, Dumps, Waste Disposal Sites, and Buried Radioactive Materials, in Areas 2, 3, 9, and 20 of the Nevada Test Site, Nevada, in accordance with the Federal Facility Agreement and Consent Order that was agreed to by the State of Nevada; U.S. Department of Energy (DOE), Environmental Management; U.S. Department of Defense; and DOE, Legacy Management (1996, as amended February 2008). Corrective Action Unit 545 is comprised of the following eight Corrective Action Sites (CASs): • 02-09-01, Mud Disposal Area • 03-08-03, Mud Disposal Site • 03-17-01, Waste Consolidation Site 3B • 03-23-02, Waste Disposal Site • 03-23-05, Europium Disposal Site • 03-99-14, Radioactive Material Disposal Area • 09-23-02, U-9y Drilling Mud Disposal Crater • 20-19-01, Waste Disposal Site While all eight CASs are addressed in this CADD/CR, sufficient information was available for the following three CASs; therefore, a field investigation was not conducted at these sites: • For CAS 03-08-03, though the potential for subsidence of the craters was judged to be extremely unlikely, the data quality objective (DQO) meeting participants agreed that sufficient information existed about disposal and releases at the site and that a corrective action of close in place with a use restriction is recommended. Sampling in the craters was not considered necessary. • For CAS 03-23-02, there were no potential releases of hazardous or radioactive contaminants identified. Therefore, the Corrective Action Investigation Plan for CAU 545 concluded that: “Sufficient information exists to conclude that this CAS does not exist as originally identified. Therefore, there is no environmental concern associated with CAS 03-23-02.” This CAS is closed with no further action. • For CAS 03-23-05, existing information about the two buried sources and lead pig was considered to be
Veteran Teacher Engagement in Site-Based Professional Development: A Mixed Methods Study
Houston, Biaze L.
2016-01-01
This research study examined how teachers self-report their levels of engagement, which factors they believe contribute most to their engagement, and which assumptions of andragogy most heavily influence teacher engagement in site-based professional development. This study employed a convergent parallel mixed methods design to study veteran…
A Study On The Applicability Of SERVQUAL Dimensions Of Web Sites
A. van der Wiele (Ton); J.D. van Iwaarden (Jos)
2002-01-01
textabstractA survey has been undertaken amongst students of two universities (Erasmus University Rotterdam, The Netherlands, and Northeastern University Boston, USA) to study what quality factors are perceived as important in relation to their use of web sites. The results of the questionnaire
Evaluation and modelling of a potential repository site - Olkiluoto case study
International Nuclear Information System (INIS)
Saksa, P.; Ahokas, H.; Loefman, J.; Pitkaenen, P.; Paulamaeki, S.; Snellman, M.
1998-01-01
The observations, interpretations and estimates resulting from site investigations were developed into conceptual bedrock model of the Olkiluoto area. Model development has been an interdisciplinary process and three major iterations have occurred. Geochemical sampling and a programme of electromagnetic and electrical soundings were carried out and interpreted to model occurrences of groundwater types. The parametrisation and modifications needed between geological models and ground-water flow simulation model is discussed. The latest groundwater flow modelling effort comprises the transient flow analysis taking into account the effects of density variations, the repository, post-glacial land uplift and global sea level rise. The main flow modeling result quantities (the amount, direction, velocity and routes as well as concentration of water) are used for evaluation of the investigation sites and of the preconditions for safe final disposal of spent nuclear fuel. Integration of hydrological and hydrogeochemical methods and studies has provided the primary method for investigating the evolution. Testing of flow models with hydro-geochemical information is considered to improve the hydrogeological understanding of a site and increases confidence in conceptual hydrogeological models. Bedrock model allows also comparisons to be made between its time-varying versions. The evolution of fracture frequency, fracture zone structures and hydraulic conductivity has been studied. A prediction-outcome comparison was made in selected boreholes and showed that the rock type was the easiest parameter to predict
Cancer incidence in Italian contaminated sites
Directory of Open Access Journals (Sweden)
Pietro Comba
2014-06-01
Full Text Available INTRODUCTION. The incidence of cancer among residents in sites contaminated by pollutants with a possible health impact is not adequately studied. In Italy, SENTIERI Project (Epidemiological study of residents in National Priority Contaminated Sites, NPCSs was implemented to study major health outcomes for residents in 44 NPCSs. METHODS. The Italian Association of Cancer Registries (AIRTUM records cancer incidence in 23 NPCSs. For each NPCSs, the incidence of all malignant cancers combined and 35 cancer sites (coded according to ICD-10, was analysed (1996-2005. The observed cases were compared to the expected based on age (5-year period,18 classes, gender, calendar period (1996-2000; 2001-2005, geographical area (North-Centre and Centre-South and cancer sites specific rates. Standardized Incidence Ratios (SIR with 90% Confidence Intervals were computed. RESULTS. In both genders an excess was observed for overall cancer incidence (9% in men and 7% in women as well as for specific cancer sites (colon and rectum, liver, gallbladder, pancreas, lung, skin melanoma, bladder and Non Hodgkin lymphoma. Deficits were observed for gastric cancer in both genders, chronic lymphoid leukemia (men, malignant thyroid neoplasms, corpus uteri and connective and soft-tissue tumours and sarcomas (women. DISCUSSION. This report is, to our knowledge, the first one on cancer risk of residents in NPCSs. The study, although not aiming to estimate the cancer burden attributable to the environment as compared to occupation or life-style, supports the credibility of an etiologic role of environmental exposures in contaminated sites. Ongoing analyses focus on the interpretation of risk factors for excesses of specific cancer types overall and in specific NPCSs in relation to the presence of carcinogenic pollutants.
Energy Technology Data Exchange (ETDEWEB)
Bailey, Bernadine; Matthews, Patrick
2013-07-01
CAU 571 is a grouping of sites where there has been a suspected release of contamination associated with nuclear testing. This document describes the planned investigation of CAU 571, which comprises the following corrective action sites (CASs): • 09-23-03, Atmospheric Test Site S-9F • 09-23-04, Atmospheric Test Site T9-C • 09-23-12, Atmospheric Test Site S-9E • 09-23-13, Atmospheric Test Site T-9D • 09-45-01, Windrows Crater These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each CAS. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the investigation report. The sites will be investigated based on the data quality objectives (DQOs) developed on March 6, 2013, by representatives of the Nevada Division of Environmental Protection and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Site Office (now the Nevada Field Office). The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 571. The site investigation process will also be conducted in accordance with the Soils Activity Quality Assurance Plan, which establishes requirements, technical planning, and general quality practices to be applied to this activity. The potential contamination sources associated with CAU 571 CASs are from nuclear testing activities. The DQO process resulted in an assumption that total effective dose (TED) within a default contamination boundary exceeds the final action level (FAL) and requires corrective action. The presence and nature of contamination outside the default
Study of a metallurgical site in Tuscany (Italy) by radiocarbon dating
International Nuclear Information System (INIS)
Cartocci, A.; Fedi, M.E.; Taccetti, F.; Benvenuti, M.; Chiarantini, L.; Guideri, S.
2007-01-01
Tuscany represents one of the most important ancient mining districts of Italy. Metalworking activities have been present in the area since ancient times and several mining centres have been active in the region since the Etruscan period. Two of the more notable mining locations are the island of Elba and the towns of Populonia and Massa Marittima. In order to reconstruct the development of metallurgical techniques in the past, a multi-disciplinary approach is required, involving both archaeological study and archaeometric analysis of the sites of interest. One of the most complex problems is establishing the chronological history of metallurgical exploitation in ancient sites: archaeological remains are sometimes incomplete and the stratigraphy of archaeological horizons might have been deeply altered. Thus, direct dating of metallurgical slags and other remains of mining and metalworking activities using radiocarbon measurements is particularly useful for developing site chronologies. Charcoal samples from a recent excavation in Populonia were dated by AMS radiocarbon in order to reconstruct the chronological evolution of ancient metallurgical production; results reported here are consistent with archaeological observations
Study of a metallurgical site in Tuscany (Italy) by radiocarbon dating
Energy Technology Data Exchange (ETDEWEB)
Cartocci, A. [Dipartimento di Fisica dell' Universita e I.N.F.N. Sezione di Firenze, via Sansone 1, 50019 Sesto Fiorentino, Florence (Italy); Fedi, M.E. [Dipartimento di Fisica dell' Universita e I.N.F.N. Sezione di Firenze, via Sansone 1, 50019 Sesto Fiorentino, Florence (Italy)]. E-mail: fedi@fi.infn.it; Taccetti, F. [Dipartimento di Fisica dell' Universita e I.N.F.N. Sezione di Firenze, via Sansone 1, 50019 Sesto Fiorentino, Florence (Italy); Benvenuti, M. [Dipartimento di Scienze della Terra dell' Universita di Firenze, via La Pira 4, 50121 Florence (Italy); Chiarantini, L. [Dipartimento di Scienze della Terra dell' Universita di Firenze, via La Pira 4, 50121 Florence (Italy); Guideri, S. [Societa Parchi Val di Cornia S.p.a., via G. Lerario, Piombino, Livorno (Italy)
2007-06-15
Tuscany represents one of the most important ancient mining districts of Italy. Metalworking activities have been present in the area since ancient times and several mining centres have been active in the region since the Etruscan period. Two of the more notable mining locations are the island of Elba and the towns of Populonia and Massa Marittima. In order to reconstruct the development of metallurgical techniques in the past, a multi-disciplinary approach is required, involving both archaeological study and archaeometric analysis of the sites of interest. One of the most complex problems is establishing the chronological history of metallurgical exploitation in ancient sites: archaeological remains are sometimes incomplete and the stratigraphy of archaeological horizons might have been deeply altered. Thus, direct dating of metallurgical slags and other remains of mining and metalworking activities using radiocarbon measurements is particularly useful for developing site chronologies. Charcoal samples from a recent excavation in Populonia were dated by AMS radiocarbon in order to reconstruct the chronological evolution of ancient metallurgical production; results reported here are consistent with archaeological observations.
DEFF Research Database (Denmark)
Porse, B T; Garrett, R A
1995-01-01
Random mutations were generated in the lower half of the peptidyl transferase loop in domain V of 23 S rRNA from Escherichia coli using a polymerase chain reaction (PCR) approach, a rapid procedure for identifying mutants and a plasmid-based expression system. The effects of 21 single-site mutati...
Townend, John; Minelli, Cosetta; Mortimer, Kevin; Obaseki, Daniel O; Al Ghobain, Mohammed; Cherkaski, Hamid; Denguezli, Myriam; Gunesekera, Kirthi; Hafizi, Hasan; Koul, Parvaiz A; Loh, Li C; Nejjari, Chakib; Patel, Jaymini; Sooronbayev, Talant; Buist, Sonia A; Burney, Peter G J
2017-06-01
Poverty is strongly associated with mortality from COPD, but little is known of its relation to airflow obstruction.In a cross-sectional study of adults aged ≥40 years from 12 sites (N=9255), participating in the Burden of Obstructive Lung Disease (BOLD) study, poverty was evaluated using a wealth score (0-10) based on household assets. Obstruction, measured as forced expiratory volume in 1 s (FEV 1 )/forced vital capacity (FVC) (%) after administration of 200 μg salbutamol, and prevalence of FEV 1 /FVCwealth scores ranged from 4 in Blantyre (Malawi) and Kashmir (India) to 10 in Riyadh (Saudi Arabia), and the prevalence of obstruction, from 16% in Kashmir to 3% in Riyadh and Penang (Malaysia). Following adjustments for age and sex, FEV 1 /FVC increased by 0.36% (absolute change) (95%CI: 0.22, 0.49; pwealth score. Adjustments for other confounders reduced this effect to 0.23% (0.11, 0.34), but even this value remained highly significant (pwealth scores explained 38% of the variation in mean FEV 1 /FVC between sites (r 2 =0.385, p=0.031).Airflow obstruction is consistently associated with poverty at individual and community levels across several countries. Copyright ©ERS 2017.
A case study of risk assessment in contaminated site remediation in China
Ye, S.; Guo, J.; Wu, J.; Wang, J.; Chien, C.; Stahl, R.; Mack, E.; Grosso, N.
2013-12-01
A field site in Nanjing, China was selected for a case study of risk assessment in contaminated site remediation. This site is about 100m long and 100m wide. A chemical plant (1999-2010) at the site manufactured optical brightener PF, 2-Amino-4-methylphenol and 2-Nitro-4-methylphenol, totally three products. Soil and groundwater samples were collected and analyzed for PPL 126 (126 pollutants in the 'Priority Pollutants List' issued by US EPA). Values of the Dutch Standards were used as the screening criteria for soil and ground water. Low levels of ethylbenezene, chlorobenzene, 1,3-dichlorobenzene and 1,4- dichlorobenzene were detected in one soil sample. Concentrations above Dutch Target Value (DTV) of benzene, toluene, ethylbenzene, chlorobenzene, 1,2-dichlorobenzene, 1,3-dichlorobenzene, 1,4-dichlorobenzene, and/or 1,2,4-trichlorobenzene, phenol, and/or 2,4-dichlorophenol were exhibited in two groundwater samples. The ground water was especially highly impacted by bichlorobenzenes and trichlorobenzenes. The maximum concentration of impacts was 7.3 mg/L of 1,2,4-trichlorobenzene in groundwater which was 730 times higher than Dutch Intervention Values (DIV). Risk of soil and groundwater at this site was assessed according to the guidelines issued by Chinese MEP and US EPA, respectively. Finally, remedy techniques were selected according to the result of risk assessment and the characteristics of hydrogeology conditions and contaminants.
23 CFR 750.107 - Class 3 and 4 signs outside informational sites.
2010-04-01
... areas. (6) Not more than one such sign advertising activities being conducted as a single enterprise or... ENVIRONMENT HIGHWAY BEAUTIFICATION National Standards for Regulation by States of Outdoor Advertising Adjacent... traffic not served by an informational site within 12 air miles of the advertised activity; (2) Class 4...
Site Study Plan for laboratory soil mechanics, Deaf Smith County site, Texas: Revision 1
International Nuclear Information System (INIS)
1987-12-01
This Site Study Plan for laboratory soil mechanics describes the laboratory testing to be conducted on soil samples collected as part of the characterization of the Deaf Smith County site, Texas. This study provides for measurements of index, mechanical, thermal, hydrologic, chemical, and mineral properties of soils from boring throughout the site. Samples will be taken from Playa Borings/Trenching, Transportation/Utilities Foundation Borings, Repository Surface Facilities Design Foundation Borings, and Exploratory Shaft Facilities Design Foundation Borings. Data from the laboratory tests will be used for soil strata characterization, design of foundations for surface structures, design of transportation facilities and utility structures, design of impoundments, design of shaft lining, design of the shaft freeze wall, shaft permitting, performance assessment calculations, and other program requirements. A tentative testing schedule and milestone log are given. A quality assurance program will be utilized to assure that activities affecting quality are performed correctly and that appropriate documentation is maintained. 18 refs., 6 figs., 3 tabs
Vyhlidal, C; Samudio, I; Kladde, M P; Safe, S
2000-06-01
17beta-Estradiol (E2) induces transforming growth factor alpha (TGFalpha) gene expression in MCF-7 cells and previous studies have identified a 53 bp (-252 to -200) sequence containing two imperfect estrogen responsive elements (EREs) that contribute to E2 responsiveness. Deletion analysis of the TGFalpha gene promoter in this study identified a second upstream region of the promoter (-623 to -549) that is also E2 responsive. This sequence contains three GC-rich sites and an imperfect ERE half-site, and the specific cis-elements and trans-acting factors were determined by promoter analysis in transient transfection experiments, gel mobility shift assays and in vitro DNA footprinting. The results are consistent with an estrogen receptor alpha (ERalpha)/Sp1 complex interacting with an Sp1(N)(30) ERE half-site ((1/2)) motif in which both ERalpha and Sp1 bind promoter DNA. The ER/Sp1-DNA complex is formed using nuclear extracts from MCF-7 cells but not with recombinant human ERalpha or Sp1 proteins, suggesting that other nuclear factor(s) are required for complex stabilization. The E2-responsive Sp1(N)(x)ERE(1/2) motif identified in the TGFalpha gene promoter has also been characterized in the cathepsin D and heat shock protein 27 gene promoters; however, in the latter two promoters the numbers of intervening nucleotides are 23 and 10 respectively.
Risk factors for acute surgical site infections after lumbar surgery: a retrospective study.
Lai, Qi; Song, Quanwei; Guo, Runsheng; Bi, Haidi; Liu, Xuqiang; Yu, Xiaolong; Zhu, Jianghao; Dai, Min; Zhang, Bin
2017-07-19
Currently, many scholars are concerned about the treatment of postoperative infection; however, few have completed multivariate analyses to determine factors that contribute to the risk of infection. Therefore, we conducted a multivariate analysis of a retrospectively collected database to analyze the risk factors for acute surgical site infection following lumbar surgery, including fracture fixation, lumbar fusion, and minimally invasive lumbar surgery. We retrospectively reviewed data from patients who underwent lumbar surgery between 2014 and 2016, including lumbar fusion, internal fracture fixation, and minimally invasive surgery in our hospital's spinal surgery unit. Patient demographics, procedures, and wound infection rates were analyzed using descriptive statistics, and risk factors were analyzed using logistic regression analyses. Twenty-six patients (2.81%) experienced acute surgical site infection following lumbar surgery in our study. The patients' mean body mass index, smoking history, operative time, blood loss, draining time, and drainage volume in the acute surgical site infection group were significantly different from those in the non-acute surgical site infection group (p operative type in the acute surgical site infection group were significantly different than those in the non-acute surgical site infection group (p operative type, operative time, blood loss, and drainage time were independent predictors of acute surgical site infection following lumbar surgery. In order to reduce the risk of infection following lumbar surgery, patients should be evaluated for the risk factors noted above.
Inter-Site Consistency at a Multi-Site Psychiatry Clerkship
Shultes von Schlageter, Margo; Park, EunMi; Tucker, Phebe
2006-01-01
Objective: This study examines the effects of clinical site assignment within a multiple-site psychiatry clerkship program on the convergent outcome of the National Board of Medical Examiners (NBME) subject examination. Method: NBME scores, controlled for baseline pre-clerkship knowledge base as measured by second year human behavior scores, were…
Posttranscriptional modifications in the A-loop of 23S rRNAs from selected archaea and eubacteria.
Hansen, M A; Kirpekar, F; Ritterbusch, W; Vester, B
2002-02-01
Posttranscriptional modifications were mapped in helices 90-92 of 23S rRNA from the following phylogenetically diverse organisms: Haloarcula marismortui, Sulfolobus acidocaldarius, Bacillus subtilis, and Bacillus stearothermophilus. Helix 92 is a component of the ribosomal A-site, which contacts the aminoacyl-tRNA during protein synthesis, implying that posttranscriptional modifications in helices 90-92 may be important for ribosome function. RNA fragments were isolated from 23S rRNA by site-directed RNase H digestion. A novel method of mapping modifications by analysis of short, nucleotide-specific, RNase digestion fragments with Matrix Assisted Laser Desorption/Ionization Mass Spectrometry (MALDI-MS) was utilized. The MALDI-MS data were complemented by two primer extension techniques using reverse transcriptase. One technique utilizes decreasing concentrations of deoxynucleotide triphosphates to map 2'-O-ribose methylations. In the other, the rRNA is chemically modified, followed by mild alkaline hydrolysis to map pseudouridines (psis). A total of 10 posttranscriptionally methylated nucleotides and 6 psis were detected in the five organisms. Eight of the methylated nucleotides and one psi have not been reported previously. The distribution of modified nucleotides and their locations on the surface of the ribosomal peptidyl transferase cleft suggests functional importance.
Directory of Open Access Journals (Sweden)
Mary D. Ruppe
2016-12-01
Full Text Available X-linked hypophosphatemia (XLH is characterized by lower extremity deformities that lead to bone and/or joint pain that result from decreased renal tubular reabsorption leading to hypophosphatemia caused by elevated levels of fibroblast growth factor 23 (FGF23. Objective: Validate the use of SF-36v2 Health Survey (SF-36v2 and the Western Ontario and McMaster Osteoarthritis Index (WOMAC to measure previously unstudied health-related quality of life (HRQoL in XLH patients and determine the change in HRQoL before and after treatment with KRN23, a human monoclonal anti-FGF23 antibody. Methods: Twenty-eight adult outpatients with XLH received up to four doses of KRN23 administered subcutaneously every 28 days. General HRQoL was measured with the SF-36v2 and condition-related HRQoL with the WOMAC at baseline and study endpoint as a secondary outcome of a Phase 1/2, open-label, multicenter, dose-escalation trial. Results: Testing for scale discriminant validity and convergent-divergent validity supported the use of these scales in the assessment of HRQoL in XLH. Both instruments indicated impairment of physical function at baseline with all mean scores showing a trend to improved health at study endpoint compared to baseline. When corrected for multiple comparisons, the score for Role Limitations due to physical health on the SF-36v2 which measures the patient's perception of their own chronic functional impairments due to poor physical health remained significantly improved (P < 0.05, increasing to the mean score of US adults. For the WOMAC, Physical Functioning and Stiffness scores were significantly improved (P < 0.05. Conclusion: KRN23 administration was associated with significantly improved patient perception of their Physical Functioning and Stiffness due to their disease. This study demonstrates that the SF-36v2 and WOMAC are valid tools for assessing HRQoL in XLH. Keywords: X-linked hypophosphatemia, KRN23, Health-related quality of life
International Nuclear Information System (INIS)
Plant, S.W.; Adler, D.G.
1995-01-01
Ever since the US Department of Energy (DOE) created its Formerly Utilized Sites Remedial Action Program (FUSRAP) in 1974, there has been a community relations program. The community relations effort has grown as FUSRAP has grown. With 20 of 46 sites now cleaned up, considerable experience in working with FUSRAP stakeholders has been gained. Why not share that experience with others who labor on the Superfund sites? Many similarities exist between the Superfund sites and FUSRAP. FUSRAP is a large, multiple-site environmental restoration program. The challenges range from small sites requiring remedial actions measurable in weeks to major sites requiring the full remedial investigation/feasibility study process. The numerous Superfund sites throughout the United States offer the same diversity, both geographically and technically. But before DOE offers FUSRAP's community relations experience as a model, it needs to make clear that this will be a realistic model. As experiences are shared, DOE will certainly speak of the efforts that achieved its goals. But many of the problems that DOE encountered along the way will also be related. FUSRAP relies on a variety of one- and two-way communication techniques for involving stakeholders in the DOE decision-making process. Some of the techniques and experiences from the case studies are presented
This case study examines how systematic planning, an evolving conceptual site model (CSM), dynamic work strategies, and real time measurement technologies can be used to unravel complex contaminant distribution patterns...
International Nuclear Information System (INIS)
Calder, L.M.
1997-01-01
The scope of site remediation in the Canadian petroleum products industry was discussed. It was estimated that the cost to clean up the nearly 100,000 contaminated sites in Canada would be in the order of $20 billion. One alternative to the high cost of clean up is the use of risk assessment for the development of soil remediation criteria that would be appropriate to the real impact of a given contaminated site, instead of the use of arbitrary criteria that are intended to protect all sites. In this way, most dollars would be spent at cleaning up the highest risk sites. Recommendations were made as to how the science and the administration of risk assessments could be improved. It was suggested that a more holistic approach to site remediation must be taken. The issues of risk, risk trade-offs, cost-benefit, cost-effectiveness and prioritization within the site remediation context was also discussed. A comparative study of two risk assessment models, the ASTM-RBCA model used in Atlantic Canada, and the B.C. Vapour Intrusion Model Validation study was described. 23 refs., 3 tabs
Does Infection Site Matter? A Systematic Review of Infection Site Mortality in Sepsis.
Motzkus, Christine A; Luckmann, Roger
2017-09-01
Sepsis treatment protocols emphasize source control with empiric antibiotics and fluid resuscitation. Previous reviews have examined the impact of infection site and specific pathogens on mortality from sepsis; however, no recent review has addressed the infection site. This review focuses on the impact of infection site on hospital mortality among patients with sepsis. The PubMed database was searched for articles from 2001 to 2014. Studies were eligible if they included (1) one or more statistical models with hospital mortality as the outcome and considered infection site for inclusion in the model and (2) adult patients with sepsis, severe sepsis, or septic shock. Data abstracted included stage of sepsis, infection site, and raw and adjusted effect estimates. Nineteen studies were included. Infection sites most studied included respiratory (n = 19), abdominal (n = 19), genitourinary (n = 18), and skin and soft tissue infections (n = 11). Several studies found a statistically significant lower mortality risk for genitourinary infections on hospital mortality when compared to respiratory infections. Based on studies included in this review, the impact of infection site in patients with sepsis on hospital mortality could not be reliably estimated. Misclassification among infections and disease states remains a serious possibility in studies on this topic.
A study on air pollution concentration at Desa parkcity construction site
African Journals Online (AJOL)
This study assesses the effect of construction workers exposure towards the air pollution to the correlation between meteorological factor with the particulate matter and other gases concentration at a construction site in DesaParkcity. The concentration of PM was collected by using low volume sampler meanwhile CO, CO2, ...
Site specific study for possible ongoing salt dome movement
International Nuclear Information System (INIS)
Thoms, R.L.; Manning, T.A.; Paille, L.K.; Gehle, R.M.
1977-01-01
U.S. Gulf Coast salt domes, among other geologic structures, currently are being considered for storage of commercial radioactive wastes. A major concern with dome storage of long lived radioactive wastes lies with the possible tectonic movement of the host dome. Any ongoing movement of a salt dome can be monitored with a site specific complementary system of field instrumentation and finite element modelling. Field instrumentation and accompanying finite element analyses for a study dome in northwest Louisiana are described. Site specific data and early experience associated with tiltmeters over the dome are presented. Also, recommendations are made for modifications and extensions of the field instrumentation and finite element modelling appropriate to the specific site under study
Hanford tank initiative test facility site selection study
International Nuclear Information System (INIS)
Staehr, T.W.
1997-01-01
The Hanford Tanks Initiative (HTI) project is developing equipment for the removal of hard heel waste from the Hanford Site underground single-shell waste storage tanks. The HTI equipment will initially be installed in the 241-C-106 tank where its operation will be demonstrated. This study evaluates existing Hanford Site facilities and other sites for functional testing of the HTI equipment before it is installed into the 241-C-106 tank
DEFF Research Database (Denmark)
Wulff, Sanne; Pinborg, Lars Hageman; Svarer, Claus
of antipsychotic compounds on the positive symptoms. Furthermore, blockade of striatal dopamine D2 receptors have in studies shown to associate negatively with subjective well-being. Our main aim was to explore a possible predictive value of striatal dopamine D2/3 receptor binding potential (BPp) for treatment...... of 29 antipsychotic-naïve patients with schizophrenia and 26 matched healthy controls, SPECT with [123l]-IBZM was used to examine the BPP of striatal dopamine D2/3 receptors. The participants were examined at baseline and after 6 weeks of treatment with a selective D2/3 receptor antagonist, amisulpride....... Results: We found a significant inverse correlation between the striatal BPp at baseline and improvement of positive symptoms (p=0.046; R squared = 0.152) after six weeks of treatment with amisulpride. There was no association between the blockade of the D2/3 receptors and improvement of positive symptoms...
Energy Technology Data Exchange (ETDEWEB)
Drifford, M. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1967-06-15
A crystallographic study on magnesium aluminates led to the determination of crystal site average distortion. A spectroscopic study of transition elements doped spinels gave the position of the doping element in tetrahedral (A) or octahedral (B) sites, and the local distortion of the latter. The comparison of average and local parameters points to differences in the behaviour of doping elements and shows the size of (A) sites are independent of the host crystal composition while the average size of (B) sites varies with the composition. (author) [French] Une etude cristallographique des aluminates de magnesium a permis de determiner la deformation moyenne des sites cristallins. Une etude spectroscopique des aluminates de magnesium dopes avec des elements de transition a permis de localiser les dopants entre les sites tetraedriques (A) et octaedriques (B) et d'etudier la deformation locale de ces sites. La comparaison entre les parametres moyens et locaux a caracterise le comportement du dopant et montre que les dimensions des sites (A) sont independantes de la composition de la matrice, alors que les caracteristiques geometriques moyennes des sites (B) varient continument avec la composition. (auteur)
A 125Te and 23Na NMR investigation of the structure and crystallisation of sodium tellurite glasses.
Holland, D; Bailey, J; Ward, G; Turner, B; Tierney, P; Dupree, R
2005-01-01
125Te static nuclear magnetic resonance (NMR) and 23Na and 125Te magic angle spinning (MAS) NMR have been used, in conjunction with X-ray diffraction, to examine the structure and crystallisation behaviour of glasses of composition xNa2O.(1-x)TeO2 (0.075 x 0.4). The MAS NMR 23Na spectra from the glasses are broad and featureless but shift by approximately +5 ppm with increased x, i.e. as the system becomes more ionic. The static 125Te NMR spectra show an increase in axial symmetry with increasing x, indicating a shift from predominantly [TeO4] to [TeO3] structural units. The 23Na and 125Te spectra from the crystallised samples have been fitted to obtain information on the sites in the metastable crystal phases, which are the first to form on heating and which are therefore more closely related to the glass structure than thermodynamically stable crystal phases. New sodium tellurite phases are reported, including a sodium stabilised, face centred cubic phase related to delta-TeO2; a metastable form of Na2Te4O9 containing 3 sodium and 4 tellurium sites; and a metastable form of Na2Te2O5 containing 2 sodium sites. There is evidence of oxidation of TeIV to TeVI occurring in glasses with high values of x and, at x=0.40 and 0.50 (outside the glass forming range), some sodium metatellurate (Na2TeO4) is formed at the same time as sodium metatellurite (Na2TeO3). The 125Te shift is very sensitive to environment within the sodium tellurite system, covering more than 320 ppm, with anisotropies varying from 640 to 1540 ppm. The lack of features in the 125Te spectra of the glass phases, combined with the large shift range and high but variable anisotropy, means than it is not possible to obtain a unique fit to any presumed species present. Furthermore, the chemical shift anisotropy parameters for three of the four Te sites in the Na2Te4O9 phase are found to lie outside the range used for previous simulations of glass spectra.
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Discovery. 213.23a Section 213.23a Public Welfare... Discovery. The Department and any party named in the notice issued pursuant to § 213.11 shall have the right to conduct discovery (including depositions) against opposing parties. Rules 26-37 of the Federal...
International Nuclear Information System (INIS)
1987-06-01
The Meteorological/Air Quality Site Study Plan describes a field program consisting of continuous measurements of surface (10-meter) wind speed and direction, temperature, humidity, dew point, pressure, and sensible heat flux (vertical). Air quality measurements will be limited to suspended particulate matter. After the first year of measurements, a 60-meter tower will be added to incorporate measurements needed for later modeling and dose calculations; these will include upper level winds, vertical temperature structure, and vertical wind speed. All of these measurements will be made at a site located within the 9-mi 2 site area but remote from the ESF. A second site, located near and downwind from the ESF, will monitor only particulate matter. The SSP describes the need for each study; its design and design rationale; analysis, management, and use of data, schedule of field activities, organization of field personnel and sample management, and quality assurance requirements. These studies will provide data needed to satisfy requirements contained in, or derived from the Salt Repository Project Requirements Document. 38 refs., 8 figs., 3 tabs
A quantitative analysis of TIMS data obtained on the Learjet 23 at various altitudes
Jaggi, S.
1992-01-01
A series of Thermal Infrared Multispectral Scanner (TIMS) data acquisition flights were conducted on the NASA Learjet 23 at different altitudes over a test site. The objective was to monitor the performance of the TIMS (its estimation of the brightness temperatures of the ground scene) with increasing altitude. The results do not show any significant correlation between the brightness temperatures and the altitude. The analysis indicates that the estimation of the temperatures is a function of the accuracy of the atmospheric correction used for each altitude.
Towards the Study of the Early Medieval Site Bashanta-II
Directory of Open Access Journals (Sweden)
Ochir-Goryaeva Maria A.
2016-12-01
Full Text Available The authors offer preliminary results on study of a new early medieval site discovered in the Gorodovikovo District (Kalmykia during a field survey near Bashanta-I hillfort at Chapaevskoe Lake (or Tsagan nur in Kalmyk language. The new site is found 8 km to the south-west from Bashanta-I hillfort, on the bank of the Egorlyk River. The site is dated by two radiocarbon dates by the middle of the 7th – late 8th centuries, i.e. by the time of Khazar Khanate. Some preliminary studies on the site included topographical mapping, collection of stray finds and a few prospection pits. These activities yielded numerous ceramic sherds, roof tiles and debris of masonry. Judging by the existing cultural stratum, remains of stone structures made of shell stone blocks and numerous ceramic finds of good quality, the new site was a settlement of Saltovo-Mayaki Culture, presumably a satellite hillfort. The identity of ceramics and construction materials allowed the authors to name this new site as Bashanta-II.
Directory of Open Access Journals (Sweden)
Si-Nan Zhang
2012-02-01
Full Text Available RPL23A gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L23P family of ribosomal proteins, which is located in the cytoplasm. The purpose of this paper was to explore the structure and anti-cancer function of ribosomal protein L23A (RPL23A gene of the Giant Panda (Ailuropoda melanoleuca. The cDNA of RPL23A was cloned successfully from the Giant Panda using RT-PCR technology. We constructed a recombinant expression vector containing RPL23A cDNA and over-expressed it in Escherichia coli using pET28a plasmids. The expression product obtained was purified by using Ni chelating affinity chromatography. Recombinant protein of RPL23A obtained from the experiment acted on Hep-2 cells and human HepG-2 cells, then the growth inhibitory effect of these cells was observed by MTT (3-[4,5-dimethyl-2-thiazolyl]-2,5-diphenyl-2H-tetrazolium bromide assay. The result indicated that the length of the fragment cloned is 506 bp, and it contains an open-reading frame (ORF of 471 bp encoding 156 amino acids. Primary structure analysis revealed that the molecular weight of the putative RPL23A protein is 17.719 kDa with a theoretical pI 11.16. The molecular weight of the recombinant protein RPL23A is 21.265 kDa with a theoretical pI 10.57. The RPL23A gene can be really expressed in E. coli and the RPL23A protein, fusioned with the N-terminally His-tagged protein, gave rise to the accumulation of an expected 22 KDa polypeptide. The data showed that the recombinant protein RPL23A had a time- and dose-dependency on the cell growth inhibition rate. The data also indicated that the effect at low concentrations was better than at high concentrations on Hep-2 cells, and that the concentration of 0.185 μg/mL had the best rate of growth inhibition of 36.31%. All results of the experiment revealed that the recombinant protein RPL23A exhibited anti-cancer function on the Hep-2 cells. The study provides a scientific basis and aids
International Nuclear Information System (INIS)
1987-06-01
The Aesthetic Site Study Plan describes a field program consisting of identification of the visually affected area; determination of scenic quality, visual sensitivity, and visual management classes of the site and vicinity; and analysis of the level of visual contrast that would be created by the project. Field ratings of scenic quality, visual sensitivity, and visual contrast will be supplemented by a public perception survey designed to incorporate the views of the public. This plan describes the need for the study, the study design, data management and use, schedule for proposed activities, and quality assurance program. This study will provide data needed to satisfy requirements contained in, or derived from, SRPO Requirement Document (SRP-RD). 35 refs., 6 figs., 2 tabs
Directory of Open Access Journals (Sweden)
Romina di Giuseppe
Full Text Available Increased fibroblast growth factor 23 (FGF23, a bone-derived hormone involved in the regulation of phosphate and vitamin D metabolism, has been related to the development of cardiovascular disease (CVD in chronic kidney disease patients and in the general population. However, what determines higher FGF23 levels is still unclear. Also, little is known about the influence of diet on FGF23. The aim of this study was therefore to identify demographic, clinical and dietary correlates of high FGF23 concentrations in the general population.We performed a cross-sectional analysis within a randomly selected subcohort of the European Prospective Investigation into Cancer and Nutrition (EPIC-Germany comprising 2134 middle-aged men and women. The Human FGF23 (C-Terminal ELISA kit was used to measure FGF23 in citrate plasma. Dietary data were obtained at baseline via validated food frequency questionnaires including up to 148 food items.Multivariable adjusted logistic regression showed that men had a 66% lower and smokers a 64% higher probability of having higher FGF23 (≥ 90 RU/mL levels compared, respectively, with women and nonsmokers. Each doubling in parathyroid hormone, creatinine, and C-reactive protein was related to higher FGF23. Among the dietary factors, each doubling in calcium and total energy intake was related, respectively, to a 1.75 and to a 4.41 fold increased probability of having higher FGF23. Finally, each doubling in the intake of iron was related to an 82% lower probability of having higher FGF23 levels. Results did not substantially change after exclusion of participants with lower kidney function.In middle-aged men and women traditional and non-traditional CVD risk factors were related to higher FGF23 concentrations. These findings may contribute to the understanding of the potential mechanisms linking increased FGF23 to increased CVD risk.
Sector Retinitis Pigmentosa Associated With Novel Compound Heterozygous Mutations of CDH23.
Branson, Sara V; McClintic, Jedediah I; Stamper, Tara H; Haldeman-Englert, Chad R; John, Vishak J
2016-02-01
Usher syndrome is an autosomal recessive condition characterized by retinitis pigmentosa (RP) and congenital hearing loss, with or without vestibular dysfunction. Allelic variants of CDH23 cause both Usher syndrome type 1D (USH1D) and a form of nonsyndromic hearing loss (DFNB12). The authors describe here a 34-year-old patient with congenital hearing loss and a new diagnosis of sector RP who was found to have two novel compound heterozygous mutations in CDH23, including one missense (c.8530C > A; p.Pro2844Thr) and one splice-site (c.5820 + 5G > A) mutation. This is the first report of sector RP associated with these types of mutations in CDH23. Copyright 2016, SLACK Incorporated.
Directory of Open Access Journals (Sweden)
Saleem Muhammad
2015-03-01
Full Text Available (La, Nd2/3TiO3 ceramics were prepared through a conventional solid state mixed oxide route. For phase and microstructure analysis, XRD and SEM were used, respectively. Microwave dielectric properties were measured using a network analyzer. XRD patterns revealed the formation of the parent (La, Nd2/3TiO3 phase along with (La, Nd4Ti9O24 as a secondary phase. The microstructure consisted of rectangular and needle shaped grains, which decreased in size from 4 μm to 2 μm with an increase in sintering temperature from 1300 °C to 1350 °C. Decrease in grain size caused an increase in density of the samples from 4.81 g/cm3 to 5.17 g/cm3. Microwave dielectric properties of the samples calcined and sintered in air atmosphere were εr = 40.35, Q × f = 3499 GHz and τf = 0 ppm/°C, whereas for a sample calcined in nitrogen and sintered in air they were εr = 40.18, Q × f = 4077 GHz and τf = +4.9 ppm/°C, respectively.
Siting study for small platform-mounted industrial energy reactors
International Nuclear Information System (INIS)
1975-07-01
Utilizing an existing 313 MW(t) ship propulsion reactor design, a concept has been formulated for a floating platform-mounted nuclear plant and an evaluation has been made to determine reductions in construction time and cost achievable by repetitive platform construction in a shipyard. Concepts and estimates are presented for siting platform-mounted nuclear plants at the location of industrial facilities where the nuclear plants would furnish industrial process heat and/or electrical power. The representative industrial site designated for this study is considered typical of sites that might be used along the extensive network of navigable canals adjacent to the ocean and is similar to potential sites along the inland waterways of the United States
The glass block site radionuclide migration study
International Nuclear Information System (INIS)
Killey, R.W.D.; Champ, D.R.
1990-01-01
In 1960 25 nepheline syenite glass blocks containing 14 TBq of mixed fission products in 50 kg of glass were placed below the water table in a shallow sand aquifer at Chalk River Laboratories. Experimental studies undertaken at the site since 1960 have included detailed mapping of the plume of 90 Sr in 1963, 1966 and 1971. Mathematical modeling studies have employed the radiostrontium plume data in determining the split between ion exchange and chemisorption of 90 Sr, and in obtaining reaction rate data for chemisorption. The distribution of 137 Cs on downgradient soils was mapped in 1963 and 1979. An extended plume of low-level 137 Cs contamination observed in the 1979 study prompted an investigation of the role of particulate materials in radionuclide transport. IN 1983, large volume groundwater sampling and separation of cationic, anionic, and neutral dissolved species, as well as particulates, detected anionic and cationic dissolved europium isotopes (154 and 155), and again encountered particulate 137 Cs. A variety of investigations of cesium and strontium sorption have provided a data base on sediment mineralogy, particle surface features, and information on sorption sites and processes. The year 1990 saw the inauguration of a three-year program to update investigations of radionuclide release, transport, and sorption at the glass block site. The first stage of the program has been a detailed definition and simulation of the hydrogeologic setting. Plume mapping and aqueous speciation studies are in progress. This paper summarizes past investigations, reviews the status of the current program, and discusses components of future studies, including investigations of sediment sorption mechanisms. (Author) (17 refs., 8 figs.)
Directory of Open Access Journals (Sweden)
Starla Hayward
2016-04-01
Full Text Available Pneumonia infection is a significant cause of morbidity and mortality worldwide. In addition to the public health concerns, pneumonia also accounts for a significant cost to the health care system. Currently there are two leading vaccines targeted against Streptococcus pneumoniae: 23-valent pneumococcal polysaccharide vaccine (PPSV23 and 13-valent pneumococcal conjugate vaccine (PCV13. Until recently, the recommendation for adult pneumonia vaccination has been a single dose of PPSV23 for all adults aged 65 years or older. However, concerns were raised regarding the vaccine’s efficacy due to the persistent burden of pneumococcal disease in the elderly population. This paper focuses on two trials that evaluated the safety and efficacy of PCV13 in the adult population. The first study reveals improved immune response with the addition of PCV13 to PPSV23, while the second shows PCV13 was effective in the prevention of vaccine-type community-acquired pneumonia. Both studies observed adequate safety profiles for PCV13 in series with PPSV23 and with PCV13 compared to placebo.
Structuring a cost-effective site characterization
International Nuclear Information System (INIS)
Berven, B.A.; Little, C.A.; Swaja, R.E.
1990-01-01
Successful chemical and radiological site characterizations are complex activities which require meticulously detailed planning. Each layer of investigation is based upon previously generated information about the site. Baseline historical, physical, geological, and regulatory information is prerequisite for preliminary studies at a site. Preliminary studies then provide samples and measurements which define the identity of potential contaminants and define boundaries around the area to be investigated. The goal of a full site characterization is to accurately determine the extent and magnitude of contaminants and carefully define the site conditions such that the future movements of site contaminants can be assessed for potential exposure to human occupants and/or environmental impacts. Critical to this process is the selection of appropriate measurement and sampling methodology, selection and use of appropriate instrumentation and management/interpretation of site information. Site investigations require optimization between the need of information to maximize the understanding of site conditions and the cost of acquiring that information. 5 refs., 1 tab
Cicolini, Giancarlo; Manzoli, Lamberto; Simonetti, Valentina; Flacco, Maria Elena; Comparcini, Dania; Capasso, Lorenzo; Di Baldassarre, Angela; Eltaji Elfarouki, Ghaleb
2014-11-01
This multi-centre prospective field study evaluated whether peripheral venous catheter site of insertion influences the risk of catheter-related phlebitis. Potential predictors of phlebitis were also investigated. Millions of patients worldwide use peripheral venous catheters, which frequently cause local complications including phlebitis, infection and obstruction. Although phlebitis predictors have been broadly investigated, uncertainties remain on the potential effect of cannulation anatomical site, duration and the appropriate time for catheter removal. A prospective cohort design was carried out from January-June 2012. The clinical course of each patient who received a new peripheral venous catheter for any cause in five Italian hospitals was followed by trained nurses until catheter removal. The presence of phlebitis was assessed every 24 hours using the Visual Infusion Phlebitis score. Analyses were based upon multilevel mixed-effects regression. The final sample consisted of 1498 patients. The average time for catheters in situ was 65·6 hours and 23·6% of the catheters were in place beyond 96 hours. Overall phlebitis incidence was 15·4%, 94·4% of which were grade 1. The likelihood of phlebitis independently increased with increasing catheter duration, being highest after 96 hours. Compared with patients with catheter placed in the dorsum of the hand (22·8% of the sample), those with the catheter located in the antecubital fossa (34·1%) or forearm were less likely to have a phlebitis of any grade. Antecubital fossa and forearm veins may be preferential sites for peripheral venous cannulation. Our results support Centers for Disease Control and Prevention recommendations to replace catheters in adults no later than 96 hours. A relevant proportion of healthcare personnel did not adhere to such guidelines - more attention to this issue is required. © 2014 John Wiley & Sons Ltd.
Vivero, Rafael José; Torres-Gutierrez, Carolina; Bejarano, Eduar E; Peña, Horacio Cadena; Estrada, Luis Gregorio; Florez, Fernando; Ortega, Edgar; Aparicio, Yamileth; Muskus, Carlos E
2015-02-22
The location of the microhabitats where immature phlebotomine sand flies of the genus Lutzomyia develop is one of the least-known aspects of this group of medically important insects. For this reason strategies of source reduction approach for their control have not been possible in contrast to other insect vectors (such as mosquitoes), because their juvenile stages in terrestrial microhabitats is difficult to detect. Direct examination of soil samples, incubation of substrates and the use of emergence traps were the methods used to identify juvenile stages in 160 soil samples from urban and forest habitats within the foci of Leishmania transmission in Colombia. Immatures collected were identified subsequent from the rearing and emergence of adults using taxonomic keys or the analysis of the mitochondrial marker cytochrome oxidase I. Plant species associated with the natural breeding sites were identified and physicochemical properties of the soils were analyzed. A total of 38 (23.7%) sampling sites were identified as breeding sites, 142 phlebotomine sand flies were identified, belonging to 13 species of the genus Lutzomyia and two of Brumptomyia. The greatest numbers of immature were found within the tabular roots (51 immature sand flies from eight positive sites) and bases of trees (35 immature sand flies from 11 sites). The characterization and presence of the tree species (mainly Ceiba pentadra, Anacardium excelsum, Pseudosamanea guachapale) and the physicochemical properties (relative humidity and carbon/nitrogen ratio) of the soils associated with these breeding sites are significant factors in explaining the diversity and abundance of phlebotomine sand flies. Immature phlebotomine sand flies of the genus Lutzomyia in Colombia can be found in a wide variety of breeding sites rich in organic matter, high relative humidity and are associated with a typical vegetation of each locality. These results provide new perspectives for the study of the ecology of the
International Nuclear Information System (INIS)
King, Sarah C.; Pushchak, Ronald
2008-01-01
Assessing and evaluating the cumulative impacts of multiple marine aquaculture facilities has proved difficult in environmental assessment. A retrospective review of 23 existing mariculture farms in southwestern New Brunswick was conducted to determine whether cumulative interactions would have justified site approvals. Based on current scientific evidence of cumulative effects, six new criteria were added to a set of far-field impacts and other existing criteria were expanded to include regional and cumulative environmental impacts in Hargrave's [Hargrave BT. A traffic light decision system for marine finfish aquaculture siting. Ocean Coast Manag 2002; 45:215-35.] Traffic Light Decision Support System (DSS) presently used in Canadian aquaculture environmental assessments. Before mitigation, 19 of the 23 sites failed the amended set of criteria and after considering mitigation, 8 sites failed. Site and ecosystem indices yielded varying site acceptability scores; however, many sites would not have been approved if siting decisions had been made within a regional management framework and cumulative impact criteria were considered in the site evaluation process
A Case Study of a School Science Department: A Site for Workplace Learning?
Heighes, Deborah Anne
2017-01-01
This descriptive and illuminative case study of one science department in a successful, urban, secondary school in the south of England considers the science department as a site of workplace learning and the experience of beginning teachers in this context. Policy change in initial teacher training (ITT) has given schools a major role in the recruitment of trainees and emphasized the schools’ role in their training. Additionally, there continue to be significant challenges to recruit science...
Weatherwax, Ryan M; Harris, Nigel K; Kilding, Andrew E; Dalleck, Lance C
2018-01-01
Even though cardiorespiratory fitness (CRF) training elicits numerous health benefits, not all individuals have positive training responses following a structured CRF intervention. It has been suggested that the technical error (TE), a combination of biological variability and measurement error, should be used to establish specific training responsiveness criteria to gain further insight on the effectiveness of the training program. To date, most training interventions use an absolute change or a TE from previous findings, which do not take into consideration the training site and equipment used to establish training outcomes or the specific cohort being evaluated. The purpose of this investigation was to retrospectively analyze training responsiveness of two CRF training interventions using two common criteria and a site-specific TE. Sixteen men and women completed two maximal graded exercise tests and verification bouts to identify maximal oxygen consumption (VO 2 max) and establish a site-specific TE. The TE was then used to retrospectively analyze training responsiveness in comparison to commonly used criteria: percent change of >0% and >+5.6% in VO 2 max. The TE was found to be 7.7% for relative VO 2 max. χ 2 testing showed significant differences in all training criteria for each intervention and pooled data from both interventions, except between %Δ >0 and %Δ >+7.7% in one of the investigations. Training nonresponsiveness ranged from 11.5% to 34.6%. Findings from the present study support the utility of site-specific TE criterion to quantify training responsiveness. A similar methodology of establishing a site-specific and even cohort specific TE should be considered to establish when true cardiorespiratory training adaptations occur.
Investigation of Y6Mn23 and YMn12 intermetallic alloys under high hydrogen pressure
Filipek, S. M.; Sato, R.; Kuriyama, N.; Tanaka, H.; Takeichi, N.
2010-03-01
Among three intermetallic compounds existing in Y-Mn system the YMn2 and Y6Mn23 can easily form interstitial hydrides while for YMn12 existence of hydride has never been reported. At moderate hydrogen pressure YMn2 and Y6Mn23 transform into YMn2H4.5 and Y6Mn23H25 respectively. At high hydrogen pressure the YMn2 (C15 or C14 parent structure) forms a unique YMn2H6 (s.g. Fm3m) complex hydride of fluorite structure in which one Mn atom Mn(1) and Y randomly occupy the 8c sites while second manganese (Mn2) in position 4a forms complex anion with 6 hydrogen atoms located in positions 24e. Formation of YMn2H6 independently of the structure of parent phase (C14 or C15) as well as occupation of the same site (8c) by Y and Mn(1) atoms suggested that also Y6Mn23 and YMn12 could transform into YMn2H6 - type hydride in which suitable number of Y atoms will be substituted by Mn(1) in the 8c positions. This assumption was confirmed by exposing R6Mn23 and RMn12 to 1 GPa of hydrogen pressure at 1000C. Formation of (RxMn2-x)MnH6 (where x = 18/29 or 3/13 for R6Mn23 and RMn12 hydrides respectively) was confirmed by XRD. Hydrogen concentration in both R6Mn23 and RMn12 based hydrides reached H/Me = 2 thus value two times higher than in R6Mn23H25.
International Nuclear Information System (INIS)
1987-06-01
The Salt Site Study Plan (SSP) describes a program for characterizing the existing salt environment in the site vicinity. A step-by-step approach is described which proceeds from published data and planned theoretical studies, to planned laboratory studies, and finally to planned field studies, to provide the necessary data to meet program requirements contained in the Salt Repository Project - Requirements Document (SRP-RD). The plan also draws on the results of other SSP's for certain data; for example, soil salinity data are to be provided under the Soils SSP. The salt studies consist of evaluation of control and mitigation measures, salt monitoring studies, emission factors development, air models development and validation, and risk assessment. For each study, its design and design rationale; analysis, management, and use of data; schedule of activities; organization of personnel and sample management; and quality assurance requirements are described. 90 refs., 9 figs., 7 tabs
Site qualification studies of the UCG-SDB at North Knobs, Wyoming
Energy Technology Data Exchange (ETDEWEB)
Davis, B.E.; Krajewski, S.A.; Ahner, P.F.; Avasthi, J.M.; Dolde, M.E.; Greenman, C.A.; Miranda, J.E.
1979-01-01
The site qualification program for the North Knobs UCG site near Rawlins, Wyoming has been completed. This site will be the location for the field tests of Underground Coal Gasification of Steeply Dipping Beds undertaken by Gulf Research and Development Company for DOE in a cost shared contract. Site characterization included a comprehensive geotechnical analysis along with vegetation, historical, and archeological studies. The G coal seam chosen for these tests is a subbituminous B coal with a true seam thickness of 22 feet and has thin coal benches above and below the main seam. The water table is at 90 feet below the surface. Hydrologic studies have defined the seam as an aquiclude (non-aquifer). The site is deemed restorable to regulatory requirements. Evaluation of this site indicates total acceptability for the three-test program planned by GR and DC.
Millius, Arthur; Watanabe, Naoki; Weiner, Orion D.
2012-01-01
The SCAR/WAVE complex drives lamellipodium formation by enhancing actin nucleation by the Arp2/3 complex. Phosphoinositides and Rac activate the SCAR/WAVE complex, but how SCAR/WAVE and Arp2/3 complexes converge at sites of nucleation is unknown. We analyzed the single-molecule dynamics of WAVE2 and p40 (subunits of the SCAR/WAVE and Arp2/3 complexes, respectively) in XTC cells. We observed lateral diffusion of both proteins and captured the transition of p40 from diffusion to network incorporation. These results suggest that a diffusive 2D search facilitates binding of the Arp2/3 complex to actin filaments necessary for nucleation. After nucleation, the Arp2/3 complex integrates into the actin network and undergoes retrograde flow, which results in its broad distribution throughout the lamellipodium. By contrast, the SCAR/WAVE complex is more restricted to the cell periphery. However, with single-molecule imaging, we also observed WAVE2 molecules undergoing retrograde motion. WAVE2 and p40 have nearly identical speeds, lifetimes and sites of network incorporation. Inhibition of actin retrograde flow does not prevent WAVE2 association and disassociation with the membrane but does inhibit WAVE2 removal from the actin cortex. Our results suggest that membrane binding and diffusion expedites the recruitment of nucleation factors to a nucleation site independent of actin assembly, but after network incorporation, ongoing actin polymerization facilitates recycling of SCAR/WAVE and Arp2/3 complexes. PMID:22349699
Directory of Open Access Journals (Sweden)
Taeyeon Kim
Full Text Available Biological production of 2,3-butandiol (2,3-BD has received great attention as an alternative to the petroleum-based 2,3-BD production. In this study, a high production of 2,3-BD in fed-batch fermentation was investigated with a newly isolated bacterium designated as Raoultella ornithinolytica B6. The isolate produced 2,3-BD as the main product using hexoses (glucose, galactose, and fructose, pentose (xylose and disaccharide (sucrose. The effects of temperature, pH-control schemes, and agitation speeds on 2,3-BD production were explored to optimize the fermentation conditions. Notably, cell growth and 2,3-BD production by R. ornithinolytica B6 were higher at 25°C than at 30°C. When three pH control schemes (no pH control, pH control at 7, and pH control at 5.5 after the pH was decreased to 5.5 during fermentation were tested, the best 2,3-BD titer and productivity along with reduced by-product formation were achieved with pH control at 5.5. Among different agitation speeds (300, 400, and 500 rpm, the optimum agitation speed was 400 rpm with 2,3-BD titer of 68.27 g/L, but acetic acid was accumulated up to 23.32 g/L. Further enhancement of the 2,3-BD titer (112.19 g/L, yield (0.38 g/g, and productivity (1.35 g/L/h as well as a significant reduction of acetic acid accumulation (9.71 g/L was achieved by the overexpression of homologous budABC genes, the 2,3-BD-synthesis genes involved in the conversion of pyruvate to 2,3-BD. This is the first report presenting a high 2,3-BD production by R.ornithinolytica which has attracted little attention with respect to 2,3-BD production, extending the microbial spectrum of 2,3-BD producers.
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Testing Plan. 282.23 Section 282.23 Mineral... § 282.23 Testing Plan. All testing activities shall be conducted in accordance with a Testing Plan... detailed Mining Plan than is obtainable under an approved Delineation Plan, to prepare feasibility studies...
Energy Technology Data Exchange (ETDEWEB)
Mark Burmeister and Patrick Matthews
2012-11-01
The corrective action sites (CASs) within CAU 465 are located within Areas 6 and 27 of the NNSS. CAU 465 comprises the following CASs: • 00-23-01, Hydronuclear Experiment, located in Area 27 of the NNSS and known as the Charlie site. • 00-23-02, Hydronuclear Experiment, located in Area 27 of the NNSS and known as the Dog site. • 00-23-03, Hydronuclear Experiment, located in Area 27 of the NNSS and known as the Charlie Prime and Anja sites. • 06-99-01, Hydronuclear, located in Area 6 of the NNSS and known as the Trailer 13 site. The purpose of this CR is to provide documentation supporting the completed corrective actions and provide data confirming that the closure objectives for CASs within CAU 465 were met. From September 2011 through July 2012, closure activities were performed as set forth in the Streamlined Approach for Environmental Restoration Plan for CAU 465: Hydronuclear, Nevada National Security Site, Nevada.
Hand fractures: A study of their site and type in childhood
International Nuclear Information System (INIS)
Rajesh, Arumugam; Basu, Avi K.; Vaidhyanath, Ramachandran; Finlay, David
2001-01-01
AIM: The purpose of the study was to document the site and type of fractures of the hand in children up to 16 years of age. MATERIALS AND METHODS: The radiographs of 280 children who were found to have a fracture in Accident and Emergency over a one-year period were reviewed. A total of 293 fractures of the hand and 3 distal interphalangeal joint dislocations without fracture were identified. There were 293 fractures as some children had more than one fracture. RESULTS: Distal tuft fractures were commonest in the 0 to 4-year age-group; fractures of distal phalanx (both transverse and tuft) in the 5 to 8-year age-group; transverse fractures of the proximal phalanx of little finger in the 9 to 12-year age-group and transverse fractures of neck of the fifth metacarpal in the 13 to 16-year age-groups. CONCLUSION: Hand fractures are more common in older children, with a male preponderance in most groups except in the 0-4 age-group. The site of injury is different in the various corresponding age-groups, reflecting the differing mechanisms of injury. The management of hand fractures rely on a correct diagnosis and a knowledge of their common site in each age-group should aid diagnosis. Rajesh, A. et al. (2001)
International Nuclear Information System (INIS)
Dieckman, S. L.; Jendrzejczyk, J. A.; Raptis, A. C.
2000-01-01
In response to US Department of Energy (DOE) requirements for advanced cross-cutting technologies, Argonne National Laboratory is developing an on-line sensor system for the real-time monitoring of 99 Tc and 23 Na in various locations throughout radioactive-waste processing facilities. Based on nuclear magnetic resonance spectroscopy, the highly automated sensor system can provide near-real-time response with minimal sampling. The technology, in the form of a flow-through nuclear-magnetic-resonance-based on-line process sensing and control system, can rapidly monitor 99 Tc speciation and concentration (from 0.1 molar to 10 micro molar) in the feedstocks and eluents of radioactive-waste treatment processes. The system is nonintrusive, capable of withstanding harsh plant environments, and reasonably immune to contaminants. Furthermore, the system is capable of operating over large variations in pH, conductivity, and salinity. This document describes design parameters, results from sensitivity studies, and initial results obtained from oxidation-reduction studies that were conducted on technetium standards and waste specimens obtained from DOE's Hanford site. A cursory investigation of the system's capabilities to monitor 23 Na at high concentrations are also reported, as are descriptions of site requirements, implementation recommendations, and testing techniques
DEFF Research Database (Denmark)
Vester, B; Hansen, L H; Douthwaite, S
1995-01-01
the effects of mutations around position A2058 on methylation. Mutagenizing A2058 (to G or U) completely abolishes methylation of 23S rRNA by ErmE. No methylation occurred at other sites in the rRNA, demonstrating the fidelity of ErmE for A2058. Breaking the neighboring G2057-C2611 Watson-Crick base pair...... by introducing either an A2057 or a U2611 mutation, greatly reduces the rate of methylation at A2058. Methylation remains impaired after these mutations have been combined to create a new A2057-U2611 Watson-Crick base interaction. The conformation of this region in 23S rRNA was probed with chemical reagents...
Meurs, Kathryn M; Lahmers, Sunshine; Keene, Bruce W; White, Stephen N; Oyama, Mark A; Mauceli, Evan; Lindblad-Toh, Kerstin
2012-08-01
Familial dilated cardiomyopathy is a primary myocardial disease that can result in the development of congestive heart failure and sudden cardiac death. Spontaneous animal models of familial dilated cardiomyopathy exist and the Doberman pinscher dog is one of the most commonly reported canine breeds. The objective of this study was to evaluate familial dilated cardiomyopathy in the Doberman pinscher dog using a genome-wide association study for a genetic alteration(s) associated with the development of this disease in this canine model. Genome-wide association analysis identified an area of statistical significance on canine chromosome 14 (p(raw) = 9.999e-05 corrected for genome-wide significance), fine-mapping of additional SNPs flanking this region localized a signal to 23,774,190-23,781,919 (p = 0.001) and DNA sequencing identified a 16-base pair deletion in the 5' donor splice site of intron 10 of the pyruvate dehydrogenase kinase 4 gene in affected dogs (p dilation, marked pleomorphic mitochondrial alterations with megamitochondria, scattered mitochondria with whorling and vacuolization and mild aggregates of lipofuscin granules. In conclusion, we report the identification of a splice site deletion in the PDK4 gene that is associated with the development of familial dilated cardiomyopathy in the Doberman pinscher dog.
Site investigations for final disposal of high-level nuclear waste
International Nuclear Information System (INIS)
Aeikaes, T.; Laine, T.
1982-12-01
Research concerning disposal of high-level nuclear waste of the Industrial Power Company Ltd has focused on deep underground disposal in Finnish precambrian bedrock. The present target is to have a repository for high-level waste in operation by 2020. Selection of the repository site is based on site investigations. In addition to geosciences, selection of appropriate site includes many branches of studies; engineering, safety analysis, ecology, transport, demography etc. The investigations required for site selection for high-level waste have been arranged in a sequence of four phases. The aim of the phases is that investigations become more and more detailed as the selection process continues. Phase I of the investigations is the characterization of potential areas. This comprises establishment of criteria for site selection and identification of areas that meet selection criteria. Objective of these studies is to determine areas for phase II field investigations. The studies are largely made by reviewing existing data and remote-sensing techniques. Phase II field investigations will be undertaken between 1986-1992. The number of potential candidates for repository site is reduced to few preferred areas by preceeding generic study. The site selection process culminates in phase III in site confirmation studies carried out at 2...3 most suitable sites during 1992-2010. This is then followed by phase IV, which comprises very detailed investigations at the selected site. An alternative for these investigations is to undertake them by using pilot shaft and drifts. Active development is taking place in all phases concerning investigation methods, criteria, parameters, data processing and modelling. The applicability of the various investigation methods and techniques is tested in a deep borehole in phase I. The co-operation with countries with similar geological conditions makes it possible to compare results obtained by different techniques
Char-recirculation biomass gasification system--a site-specific feasibility study
International Nuclear Information System (INIS)
Purdy, K.R.; Kerr, C.P.; Hensley, B.D.
1991-01-01
A site-specific feasibility study was conducted for a char-recirculation biomass gasification plant which would dispose of the chippable solid residues of the area sawmills. The plant would receive green hardwood chips and convert them into active charcoal while producing process steam and electrical power. An economic analysis was performed on the basis of not-for-profit operation, marketing crushed active charcoal to a broker at a discounted price, and displacing purchased electric power. Given a market for the active charcoal, the plant was judged to be economically viable
This document is a project plan for a pilot study at the United Chrome NPL site, Corvallis, Oregon and includes the health and safety and quality assurance/quality control plans. The plan reports results of a bench-scale study of the treatment process as iieasured by the ...
78 FR 26356 - Notice of Environmental Site Review
2013-05-06
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Notice of Environmental Site Review York Haven Power Company, LLC Project No. 1888-030. Exelon Generation Company, LLC Project No. 405-106. Exelon Generation Company, LLC Project No. 2355-018. On May 21, 22, and 23, 2013, Commission staff will hold an environmental site review for the...
Archaeometric studies on the Hatahara archaeological site
International Nuclear Information System (INIS)
Nunes, Kelly Placa
2009-01-01
The reconstruction of the past and the understanding of historical and cultural aspects of societies that developed at archaeological sites have been enabled by archaeometric studies undertaken on ceramics located at these areas. This study aims to be a contribution to the elucidation of these aspects with the application of three physical methods of analysis: neutron activation analysis (NAA), thermoluminescence dating (TL) an electronic paramagnetic resonance (EPR) to ceramic fragments from the Hatahara archaeological site, located at central Amazon. The elemental concentrations obtained by NAA for 120 ceramic fragments were interpreted by means of cluster analysis and discriminant analysis. The results showed the existence of five distinct ceramic groups. This information, supported by archaeological interpretation, confirm the existence of four distinct occupation Phases at Hatahara site. In order to establish a chronology for the occupations, the ages of three ceramic fragments were determined by TL. The dating of two fragments did not confirm the archaeological interpretation about their occupation Phases. However, the dating of the third fragment allowed the confirmation that it belongs to the Manacapuru Phase. The determination of the burning temperatures of four ceramic fragments was performed by EPR. It was observed that although the analyzed ceramic samples belong to three distinct groups, there was no significant variation on their burning temperatures. (author)
49 CFR 1103.23 - Confidences of a client.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Confidences of a client. 1103.23 Section 1103.23... Responsibilities Toward A Client § 1103.23 Confidences of a client. (a) The practitioner's duty to preserve his client's confidence outlasts the practitioner's employment by the client, and this duty extends to the...
Energy Technology Data Exchange (ETDEWEB)
Salasovich, J.; Geiger, J.; Mosey, G.; Healey, V.
2013-05-01
The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Price Landfill site in Pleasantville, New Jersey, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site. This study did not assess environmental conditions at the site.
Energy Technology Data Exchange (ETDEWEB)
Van Geet, O.; Mosey, G.
2013-03-01
The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Tower Road site in Aurora, Colorado, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site. This study did not assess environmental conditions at the site.
A multi-site study on medical school selection, performance, motivation and engagement
Wouters, A.; Croiset, G.; Schripsema, N. R.; Cohen-Schotanus, J.; Spaai, G. W. G.; Hulsman, R. L.; Kusurkar, R. A.
Medical schools seek ways to improve their admissions strategies, since the available methods prove to be suboptimal for selecting the best and most motivated students. In this multi-site cross-sectional questionnaire study, we examined the value of (different) selection procedures compared to a
International Nuclear Information System (INIS)
Sanu, J. K.
2013-07-01
2000DX PCB/ Chloride analyser and Instrumentatal Neutron Activation Analysis (INAA) to analyse extractable organochloriine from the soil samples indicated that the nuclear technique is a better analytical technique for contaminated site investigation due to its high sensitivity, selectivity, fast and non-destructive nature. The INAA and gamma spectroscopy using HPGe detector coupled with MAESTRO 32 software provided a fast and efficient way to analyse possible PCB contamination in the soil samples and therefore proved to be very reliable method that could be conveniently used for contaminated site investigation. (au)
Sarfraz, Muhammad; Sultana, Nargis; Rashid, Umer; Akram, Muhammad Safwan; Sadiq, Abdul; Tariq, Muhammad Ilyas
2017-02-01
In search of potent inhibitors of cholinesterases, we have synthesized and evaluate a number of 2,3-dihydroquinazolin-4(1H)-one derivatives. The synthetic approach provided an efficient synthesis of the target molecules with excellent yield. All the tested compounds showed activity against both the enzymes in micromolar range. In many case, the inhibition of both enzymes are higher than or comparable to the standard drug galatamine. With the selectivity index of 2.3 for AChE, compound 5f can be considered as a potential lead compound with a feature of dual AChE/BChE inhibition with IC 50 =1.6±0.10μM (AChE) and 3.7±0.18μM (BChE). Binding modes of the synthesized compounds were explored by using GOLD (Genetic Optimization for Ligand Docking) suit v5.4.1. The computed binding modes of these compounds in the active site of AChE and BChE provide an insight into the mechanism of inhibition of these two enzyme. Copyright © 2017 Elsevier Inc. All rights reserved.
Fontenot, L W; Noble, G P; Akins, J M; Stephens, M D; Cobb, G P
2000-04-01
Livers of bullfrogs (Rana catesbeiana) from a polychlorinated biphenyl (PCB) contaminated watershed and hazardous waste site located in Pickens County, South Carolina, contained significantly higher concentrations of PCBs (2.33 and 2.26 ppm, respectively) than those from a reference site (0.05 ppm). Green frogs (R. clamitans) from the two contaminated sites also accumulated higher levels of PCBs (2.37 and 3.88 ppm, respectively) than those from the reference site (0.02 ppm). No temporal variation was observed in PCB concentrations of bullfrogs or green frogs from the contaminated sites between 1992 and 1993. Levels of PCBs in the livers of northern water snakes (Nerodia sipedon) were significantly higher in snakes from the contaminated watershed (13.70 ppm) than in those from the waste site (2.29 ppm) and two reference sites (2.50 and 1.23 ppm). When compared to frogs, significantly higher bioaccumulation occurred in water snakes from the contaminated watershed. No significant differences in PCB levels were found with respect to sex or body size (snout-vent length (SVL) or body mass) for frogs or snakes. PCBs were detected also in eggs of both frogs and snakes. Results of this study provide baseline data and document the bioaccumulation of PCB residues in frog and snake tissues; however, the significance of these tissue residues to reproduction, survival, growth/development, and population dynamics in contaminated habitats is unknown.
International Nuclear Information System (INIS)
Stricker, Michael
2014-01-01
The documentation of the police operation during the demonstration against the NPP Grohnde on 16.03.1977 and the evacuation of the occupied cooling tower site on 23.08.1977 covers the following issues: involved action forces: police Niedersachsen, police Nordrhein-Westfalen, police Schleswig-Holstein, police Bremen and the Bundesgrenzschutz; concept of the police operation, provisions (lodging and board) for the police, operating resources, details of the operation sequence; post-processing of the operation; the Grohnde trials.
Status report on geochemical field results from Atlantic study sites
International Nuclear Information System (INIS)
Wilson, T.R.S.; Thomson, J.; Hydes, D.J.; Colley, S.
1983-01-01
This report summarises the results of preliminary geochemical investigations at three North Atlantic study areas. The two eastern sites, on the Cape Verde abyssal plain (CV2) and east of Great Meteor Seamount (GME) were visited during 1982. The results presented are preliminary. Studies in the western Atlantic, close to the Nares Abyssal Plain study site are more detailed and are presented in a separate paper. The report shows for the first time the relative redox status of the three sites. The differences are unexpectedly large, the most reduced cores being recovered at GME and the most oxidised at CV2. The sporadic nature of Recent sediment accumulation at these sites is also emphasised. In order to place these preliminary results in context their relevance to the production of mathematical system models is discussed in a closing section. The necessity for such models to rest on sound foundations of geochemical understanding is noted. Suggestions on future research priorities are offered for discussion. (author)
Study on Site Conditions Based on Topographic Slope
Wu, X.; Wang, X.; Yuan, X.; Chen, M.; Dou, A.
2018-04-01
The travel-time averaged shear-wave velocity to a depth of 30m (Vs30) below the Earth's surface is widely used to classify sites in many building codes. Vs30 is also used to estimate site classification in recent ground-motion prediction equations (GMPEs), and the distribution of Vs30 has been mapped in a region or country. An alternative method has recently been proposed for evaluating global seismic site conditions or Vs30, from the SRTM (Shuttle Radar Topography Mission) DEMs (digital elevation models). The basic premise of the method is that the topographic slope can be used as a reliable proxy for Vs30 in the absence of geologically and geotechnically based site-condition maps through correlations between Vs30 measurements and topographic gradient. Here, we use different resolutions (3 arcsec, 30 arcsec) DEM data to get Vs30 data separately, analyze and compare the difference of Vs30 data and site conditions obtained from different resolution DEM data. Shandong Province in eastern China and Sichuan Province in Western China are studied respectively. It is found that the higher resolution data is better at defining spatial topographic features than the 30c data, but less improvement in its correlation with Vs30.
STUDY ON SITE CONDITIONS BASED ON TOPOGRAPHIC SLOPE
Directory of Open Access Journals (Sweden)
X. Wu
2018-04-01
Full Text Available The travel-time averaged shear-wave velocity to a depth of 30m (Vs30 below the Earth’s surface is widely used to classify sites in many building codes. Vs30 is also used to estimate site classification in recent ground-motion prediction equations (GMPEs, and the distribution of Vs30 has been mapped in a region or country. An alternative method has recently been proposed for evaluating global seismic site conditions or Vs30, from the SRTM (Shuttle Radar Topography Mission DEMs (digital elevation models. The basic premise of the method is that the topographic slope can be used as a reliable proxy for Vs30 in the absence of geologically and geotechnically based site-condition maps through correlations between Vs30 measurements and topographic gradient. Here, we use different resolutions (3 arcsec, 30 arcsec DEM data to get Vs30 data separately, analyze and compare the difference of Vs30 data and site conditions obtained from different resolution DEM data. Shandong Province in eastern China and Sichuan Province in Western China are studied respectively. It is found that the higher resolution data is better at defining spatial topographic features than the 30c data, but less improvement in its correlation with Vs30.
Pedestrian and motorists' actions at pedestrian hybrid beacon sites: findings from a pilot study.
Pulugurtha, Srinivas S; Self, Debbie R
2015-01-01
This paper focuses on an analysis of pedestrian and motorists' actions at sites with pedestrian hybrid beacons and assesses their effectiveness in improving the safety of pedestrians. Descriptive and statistical analyses (one-tail two-sample T-test and two-proportion Z-test) were conducted using field data collected during morning and evening peak hours at three study sites in the city of Charlotte, NC, before and after the installation of pedestrian hybrid beacons. Further, an analysis was conducted to assess the change in pedestrian and motorists' actions over time (before the installation; 1 month, 3 months, 6 months, and 12 months after the installation). Results showed an increase in average traffic speed at one of the pedestrian hybrid beacon sites while no specific trends were observed at the other two pedestrian hybrid beacon sites. A decrease in the number of motorists not yielding to pedestrians, pedestrians trapped in the middle of the street, and pedestrian-vehicle conflicts were observed at all the three pedestrian hybrid beacon sites. The installation of pedestrian hybrid beacons did not have a negative effect on pedestrian actions at two out of the three sites. Improvements seem to be relatively more consistent 3 months after the installation of the pedestrian hybrid beacon.
Value engineering study for seletion of verticle barrier technology at a Superfund site
International Nuclear Information System (INIS)
Bryan, E.E.; Guglielmetti, J.L.; Butler, P.B.; Brill, M.P.
1997-01-01
A value engineering (VE) study was conducted to identify and evaluate vertical barrier technologies and alignments for a Superfund project in New Castle County, Delaware. The objective was to select and recommend the most appropriate vertical barrier(s) for two separate landfills and a portion of the manufacturing plant on the site. A VE team was assembled to identify and evaluate site specific issues related to effectiveness, constructability and cost for numerous vertical barrier technologies. Several cost-effective alternatives were identified that met project objectives. The VE study concluded that a composite vertical barrier system consisting of a soil-bentonite slurry trench and steel sheet piles would provide effective containment of the North Landfill. Additionally, the geologic confining unit specified in the Record of Decision (ROD) was found to be unsuitable as a vertical barrier key and a more suitable, shallow confining unit was discovered. This paper describes the value engineering process and results of the VE study for one of the landfills
Energy-conserving site-design case study, Radisson, New York. Final report
Energy Technology Data Exchange (ETDEWEB)
1979-12-01
Radisson is a 2,950-acre new community currently being developed by the New York State Urban Development Corporation and located in central New York, 12 miles north-west of Syracuse. Case-study sites selected for this project are a 95-acre residential site and the 51-acre Town Center of the new community. Development on the Residential Site is a low-density (2.8 dwelling units/acre) mixture of single-family, townhouse and multi-family units. Development on the Town Center site is a mixture of small-scale commercial use (144,000 sq. ft.) and 330+ multi-family dwelling units. Energy-conserving plans developed for both sites have focused on passive measures to reduce energy use for space heating. Utility-system options have been identified for both sites, but require further study as to feasibility and cost. This report summarizes energy savings and cost differentials due to passive measures incorporated in both the residential and Town Center Plans. The future implementation schedule, also discussed, summarizes the procedures an schedule required for implementation of the passive measures, as well as further study required for the development of utility-system options. 4 tables.
International Nuclear Information System (INIS)
Zhang, L.; Knight, J. A.; Andrulis, I. L.; Chiarelli, A. M.; Glendon, G.; Ritvo, P.
2012-01-01
Few prospective studies have examined associations between breast cancer worry and screening behaviours in women with elevated breast cancer risks based on family history. Methods. This study included 901 high familial risk women, aged 23-71 years, from the Ontario site of the Breast Cancer Family Registry. Self-reported breast screening behaviours at year-one followup were compared between women at low (N=305), medium ( N=433), and high (N=163) levels of baseline breast cancer worry using logistic regression. Nonlinear relationships were assessed using likelihood ratio tests. Results. A significant non-linear inverted “U” relationship was observed between breast cancer worry and mammography screening (π=0. 034) for all women, where women at either low or high worry levels were less likely than those at medium to have a screening mammogram. A similar significant non-linear inverted “U” relationship was also found among all women and women at low familial risk for worry and screening clinical breast examinations (CBEs). Conclusions. Medium levels of cancer worries predicted higher rates of screening mammography and CBE among high-risk women
Rab23 is a flagellar protein in Trypanosoma brucei
Directory of Open Access Journals (Sweden)
Field Mark C
2011-06-01
Full Text Available Abstract Background Rab small GTPases are important mediators of membrane transport, and orthologues frequently retain similar locations and functions, even between highly divergent taxa. In metazoan organisms Rab23 is an important negative regulator of Sonic hedgehog signaling and is crucial for correct development and differentiation of cellular lineages by virtue of an involvement in ciliary recycling. Previously, we reported that Trypanosoma brucei Rab23 localized to the nuclear envelope 1, which is clearly inconsistent with the mammalian location and function. As T. brucei is unicellular the potential that Rab23 has no role in cell signaling was possible. Here we sought to further investigate the role(s of Rab23 in T. brucei to determine if Rab23 was an example of a Rab protein with divergent function in distinct taxa. Methods/major findings The taxonomic distribution of Rab23 was examined and compared with the presence of flagella/cilia in representative taxa. Despite evidence for considerable secondary loss, we found a clear correlation between a conventional flagellar structure and the presence of a Rab23 orthologue in the genome. By epitope-tagging, Rab23 was localized and found to be present at the flagellum throughout the cell cycle. However, RNAi knockdown did not result in a flagellar defect, suggesting that Rab23 is not required for construction or maintenance of the flagellum. Conclusions The location of Rab23 at the flagellum is conserved between mammals and trypanosomes and the Rab23 gene is restricted to flagellated organisms. These data may suggest the presence of a Rab23-mediated signaling mechanism in trypanosomes.
DEFF Research Database (Denmark)
Jørgensen, Christel Thea; Pedersen, Christian; Søtofte, Inger
1998-01-01
The new 2,3-Aziridino-2,3-dideoxyhexonamides 3 and 11 were prepared by a three-step procedure from commercially available D-glucono-1,5-lactone and D-gulono-1,4-lactone, respectively. The lactones were converted into methyl 3,4;5,6-di-O-isopropylidene-2-Omesyl esters 2 and 10, which upon treatmen...... with ammonia formed the title aziridino compounds. These were reductively cleaved by hydrazine to give 3-amino-2,3-dideoxyhexonic hydrazides 13 and 15, which were easily converted into corresponding lactone 14 and acid 16, respectively....
Investigation of Y6Mn23 and YMn12 intermetallic alloys under high hydrogen pressure
International Nuclear Information System (INIS)
Filipek, S M; Sato, R; Kuriyama, N; Tanaka, H; Takeichi, N
2010-01-01
Among three intermetallic compounds existing in Y-Mn system the YMn 2 and Y 6 Mn 23 can easily form interstitial hydrides while for YMn 12 existence of hydride has never been reported. At moderate hydrogen pressure YMn 2 and Y 6 Mn 23 transform into YMn 2 H 4.5 and Y 6 Mn 23 H 25 respectively. At high hydrogen pressure the YMn 2 (C15 or C14 parent structure) forms a unique YMn 2 H 6 (s.g. Fm3m) complex hydride of fluorite structure in which one Mn atom Mn(1) and Y randomly occupy the 8c sites while second manganese (Mn2) in position 4a forms complex anion with 6 hydrogen atoms located in positions 24e. Formation of YMn 2 H 6 independently of the structure of parent phase (C14 or C15) as well as occupation of the same site (8c) by Y and Mn(1) atoms suggested that also Y 6 Mn 23 and YMn 12 could transform into YMn 2 H 6 - type hydride in which suitable number of Y atoms will be substituted by Mn(1) in the 8c positions. This assumption was confirmed by exposing R 6 Mn 23 and RMn 12 to 1 GPa of hydrogen pressure at 100 0 C. Formation of (R x Mn 2-x )MnH 6 (where x = 18/29 or 3/13 for R 6 Mn 23 and RMn 12 hydrides respectively) was confirmed by XRD. Hydrogen concentration in both R 6 Mn 23 and RMn 12 based hydrides reached H/Me = 2 thus value two times higher than in R 6 Mn 23 H 25 .
Energy Technology Data Exchange (ETDEWEB)
Mabit, Lionel, E-mail: L.Mabit@iaea.or [Soil Science Unit, FAO/IAEA Agriculture and Biotechnology Laboratory, IAEA Laboratories Seibersdorf, PO Box 100, Wagramerstrasse 5, A-1400 Vienna (Austria); Martin, Paul [Physics, Chemistry and Instrumentation Laboratory, IAEA Laboratories Seibersdorf, PO Box 100, Wagramerstrasse 5, A-1400 Vienna (Austria); Jankong, Patcharin; Toloza, Arsenio [Soil Science Unit, FAO/IAEA Agriculture and Biotechnology Laboratory, IAEA Laboratories Seibersdorf, PO Box 100, Wagramerstrasse 5, A-1400 Vienna (Austria); Padilla-Alvarez, Roman [Physics, Chemistry and Instrumentation Laboratory, IAEA Laboratories Seibersdorf, PO Box 100, Wagramerstrasse 5, A-1400 Vienna (Austria); Zupanc, Vesna [Department of Agronomy, Biotechnical Faculty, University of Ljubljana (Slovenia)
2010-10-15
The aim of the present study was to establish a reference site and its soil characteristics for use of fallout radionuclides in erosion studies in Slovenia. Prior to this study, no reference site and baseline data existed for Slovenia for this purpose. In the agricultural area of Goricko in East Slovenia, an undisturbed forest situated in Salamenci (46{sup o}44'N, 16{sup o}7'E), was selected to establish the inventory value of fallout {sup 137}Cs and to establish a baseline level of multi-elemental fingerprint (major, minor, trace elements including heavy metals) and naturally occurring radionuclides in soils. A total of 20 soil profiles were collected at four 10 cm depth increments for evaluation of baseline level of {sup 137}Cs inventory. An exponential distribution for {sup 137}Cs was found and the baseline level inventory was established at 7300 {+-} 2500 Bq m{sup -2} with a coefficient of variation of 34%. Of this mean present-day inventory, approximately 45% is due to the Chernobyl contribution. The physical degradation of soils through erosion is linked with biochemical degradation. This study introduces an approach to establishment of the naturally occurring radionuclide and elemental fingerprints baseline levels at a reference site which can provide comparative data to those from neighbouring agricultural fields for assessment of soil redistribution magnitude using fallout radionuclides. In addition, this information will be used to determine the impact of soil erosion processes and agricultural practices on soil quality and redistribution within agricultural landscapes in Slovenia.
RECRUITMENT PROCESS IN MNC'S THROUGH SOCIAL MEDIA SITES - A STUDY
Dr. B. L. Sairam Subramaniam; B. Naveen Kumar
2017-01-01
Many organizations are carrying out recruitment process by using social media networking sites. Social networking sites are used to facilitate and improve process of recruitment method in HR management. Social networking sites address the needs of employers and job-seekers via internetworking on electronic platform likes face book, twitter, LinkedIn, naukri.com, and monster.com which increase the speed of employment, reducing the cost of recruitment, huge availability of jobseekers and improv...
A Qualitative Multi-Site Case Study: Examining Principals' Leadership Styles and School Performance
Preyear, Loukisha
2015-01-01
The purpose of this qualitative multi-site case study was to explore the impact of principals' leadership styles on student academic achievement in a high-poverty low-performing school district in Louisiana. A total of 17 participants, principals and teachers, from this school district were used in this study. Data source triangulation of…
A novel subcutaneous site of islet transplantation superior to the liver.
Yasunami, Yohichi; Nakafusa, Yuki; Nitta, Naoyoshi; Nakamura, Masafumi; Goto, Masafumi; Ono, Junko; Taniguchi, Masaru
2018-03-08
Islet transplantation is an attractive treatment for patients with insulin-dependent diabetes mellitus, and currently the liver is the favored transplantation site. However, an alternative site is desirable because of the low efficiency of hepatic transplantation, requiring 2-3 donors for a single recipient, and because the transplanted islets cannot be accessed or retrieved. We developed a novel procedure of islet transplantation to the inguinal subcutaneous white adipose tissue (ISWAT) of mice and described functional and morphological characteristics of transplanted syngeneic islets. Also, it was determined whether islet allograft rejection in the ISWAT can be prevented by immunosuppressive agents. Furthermore, it was examined whether human islets function when grafted in this particular site of immune-deficient mice. In this site, transplanted islets are engrafted as clusters and function to reverse STZ-induced diabetes in mice. Importantly, transplanted islets can be visualized by CT and are easily retrievable, and allograft rejection is preventable by blockade of co-stimulatory signals. Of much importance, the efficiency of islet transplantation in this site is superior to the liver, in which hyperglycemia of diabetic recipient mice is ameliorated after transplantation of 200 syngeneic islets (the islet number yielded from 1 mouse pancreas) to the ISWAT but not to the liver. Furthermore, human islets transplanted in this particular site function to reverse diabetes in immune-deficient mice. Thus, the ISWAT is superior to the liver as the site of islet transplantation, which may lead to improved outcome of clinical islet transplantation.
The risk of lung cancer among cooking adults: a meta-analysis of 23 observational studies.
Jia, Peng-Li; Zhang, Chao; Yu, Jia-Jie; Xu, Chang; Tang, Li; Sun, Xin
2018-02-01
Cooking has been regarded as a potential risk factor for lung cancer. We aim to investigate the evidence of cooking oil fume and risk of lung cancer. Medline and Embase were searched for eligible studies. We conducted a meta-analysis to summarize the evidences of case-control or cohort studies, with subgroup analysis for the potential discrepancy. Sensitivity analysis was employed to test the robustness. We included 23 observational studies, involving 9411 lung cancer cases. Our meta-analysis found that, for cooking female, the pooled OR of cooking oil fume exposure was 1.98 (95% CI 1.54, 2.54, I 2 = 79%, n = 15) among non-smoking population and 2.00 (95% CI 1.46, 2.74, I 2 = 75%, n = 10) among partly smoking population. For cooking males, the pooled OR of lung cancer was 1.15 (95% CI 0.71, 1.87; I 2 = 80%, n = 4). When sub grouped by ventilation condition, the pooled OR for poor ventilation was 1.20 (95% CI 1.10, 1.31, I 2 = 2%) compared to good ventilation. For different cooking methods, our results suggested that stir frying (OR = 1.89, 95% CI 1.23, 2.90; I 2 = 66%) was associated with increased risk of lung cancer while not for deep frying (OR = 1.41, 95% CI 0.87, 2.29; I 2 = 5%). Sensitivity analysis suggested our results were stable. Cooking oil fume is likely to be a risk factor for lung cancer for female, regardless of smoking status. Poor ventilation may increase the risk of lung cancer. Cooking methods may have different effect on lung cancer that deep frying may be healthier than stir frying.
Zhao, Shuzhi; Li, Tao; Li, Jun; Lu, Qianyi; Han, Changjing; Wang, Na; Qiu, Qinghua; Cao, Hui; Xu, Xun; Chen, Haibing; Zheng, Zhi
2016-03-01
The mechanisms underlying the cellular metabolic memory induced by high glucose remain unclear. Here, we sought to determine the effects of microRNAs (miRNAs) on metabolic memory in diabetic retinopathy. The miRNA microarray was used to examine human retinal endothelial cells (HRECs) following exposure to normal glucose (N) or high glucose (H) for 1 week or transient H for 2 days followed by N for another 5 days (H→N). Levels of sirtuin 1 (SIRT1) and acetylated-nuclear factor κB (Ac-NF-κB) were examined following transfection with miR-23b-3p inhibitor or with SIRT1 small interfering (si)RNA in the H→N group, and the apoptotic HRECs were determined by flow cytometry. Retinal tissues from diabetic rats were similarly studied following intravitreal injection of miR-23b-3p inhibitor. Chromatin immunoprecipitation (ChIP) analysis was performed to detect binding of NF-κB p65 to the potential binding site of the miR-23b-27b-24-1 gene promoter in HRECs. High glucose increased miR-23b-3p expression, even after the return to normal glucose. Luciferase assays identified SIRT1 as a target mRNA of miR-23b-3p. Reduced miR-23b-3p expression inhibited Ac-NF-κB expression by rescuing SIRT1 expression and also relieved the effect of metabolic memory induced by high glucose in HRECs. The results were confirmed in the retina using a diabetic rat model of metabolic memory. High glucose facilitated the recruitment of NF-κB p65 and promoted transcription of the miR-23b-27b-24-1 gene, which can be suppressed by decreasing miR-23b-3p expression. These studies identify a novel mechanism whereby miR-23b-3p regulates high-glucose-induced cellular metabolic memory in diabetic retinopathy through a SIRT1-dependent signalling pathway.
A study of invisible neutrino decay at DUNE and its effects on θ 23 measurement
Choubey, Sandhya; Goswami, Srubabati; Pramanik, Dipyaman
2018-02-01
We study the consequences of invisible decay of neutrinos in the context of the DUNE experiment. We assume that the third mass eigenstate is unstable and decays to a light sterile neutrino and a scalar or a pseudo-scalar. We consider DUNE running in 5 years neutrino and 5 years antineutrino mode and a detector volume of 40 kt. We obtain the expected sensitivity on the rest-frame life-time τ 3 normalized to the mass m 3 as τ3 /m 3 > 4 .50 × 10-11 s/eV at 90% C.L. for a normal hierarchical mass spectrum. We also find that DUNE can discover neutrino decay for τ3 /m 3 > 4 .27 × 10-11 s/eV at 90% C.L. In addition, for an unstable ν3 with an illustrative value of τ3 /m 3 = 1 .2 × 10-11 s/eV, the no decay case could get disfavoured at the 3 σ C.L. At 90% C.L. the expected precision range for this true value is obtained as 1 .71 × 10-11 > τ3 /m 3 > 9 .29 × 10-12 in units of s/eV. We also study the correlation between a non-zero τ3 /m 3 and standard oscillation parameters and find an interesting correlation in the appearance and disappearance channels with the mixing angle θ 23. This alters the octant sensitivity of DUNE, favorably (unfavorably) for true θ 23 in the lower (higher) octant. The effect of a decaying neutrino does not alter the hierarchy or CP violation discovery sensitivity of DUNE in a discernible way.
Directory of Open Access Journals (Sweden)
Hai-Jun Yang
2015-01-01
Full Text Available AIM:To evaluate the efficacy and safety of silicone oil removal with a 23G transconjunctival sutureless vitrectomy system linked disposable transfusion tube and self-made suction tip. METHODS: The suction tip was made with a 23G infusion tube be cut from the end of the 5mm. It was used to connect the disposable transfusion tube and 23G puncture cannula. The disposable transfusion tube which was cut from the end of the MaiFei's pipe was connected with the effusion box of the vitreous cutter. Intraocular silicone oil was proactive suction and removed through two incisions on pars plana ciliaris with the vitreous cutter suction system. RESULTS: Only 13 cases(9.8%need suture puncture ports in 132 cases in the operation. Operation time was 7-28min. The average operation time was 15.1± 6.2min. In early postoperative, there were 107 cases(81.1%appeared lower intraocular pressure(CONCLUSION: The surgery that silicone oil is removed through two incisions with a 23G transconjunctival sutureless vitrectomy system linked disposable transfusion tube and self-made suction tip has the advantages of safe, effective, fast, economic, and it is worthy of popularization and application in clinical.
New phenotypes generated by the G57R mutation of BUD23 in Saccharomyces cerevisiae.
Lin, Jyun-Liang; Yu, Hui-Chia; Chao, Ju-Lan; Wang, Chung; Cheng, Ming-Yuan
2012-12-01
BUD23 in Saccharomyces cerevisiae encodes for a class I methyltransferase, and deletion of the gene results in slow growth and random budding phenotypes. Herein, two BUD23 mutants defective in methyltransferase activity were generated to investigate whether the phenotypes of the null mutant might be correlated with a loss in enzymatic activity. Expression at the physiological level of both D77A and G57R mutants was able to rescue the phenotypes of the bud23-null mutant. The result implied that the methyltransferase activity of the protein was not necessary for supporting normal growth and bud site selection of the cells. High-level expression of Bud23 (G57R), but not Bud23 or Bud23 (D77A), in BUD23 deletion cells failed to complement these phenotypes. However, just like Bud23, Bud23 (G57R) was localized in a DAPI-poor region in the nucleus. Distinct behaviour in Bud23 (G57R) could not be originated from a mislocalization of the protein. Over-expression of Bud23 (G57R) in null cells also produced changes in actin organization and additional septin mutant-like phenotypes. Therefore, the absence of Bud23, Bud23 (G57R) at a high level might affect the cell division of yeast cells through an as yet unidentified mechanism. Copyright © 2012 John Wiley & Sons, Ltd.
International Nuclear Information System (INIS)
1997-12-01
This report describes a pilot study involving treatment of contaminated groundwater at a former manufactured gas plant site on the eastern seaboard of the US. The work was performed in order to provide the design basis for a full-scale groundwater extraction and treatment system at the site, as well as to develop a generic approach to selection of groundwater treatment sequences at other MGP sites. It included three main components: hydrogeologic investigations, bench-scale treatability studies, and pilot-scale treatability studies. Technologies evaluated in bench-scale work included gravity settling, filtration, and dissolved air flotation (DAF) for primary treatment of nonaqueous phase materials; biological degradation, air stripping, and carbon adsorption for secondary treatment of dissolved organics; and carbon adsorption as tertiary treatment of remaining dissolved contaminants. Pilot-scale studies focused on collecting system performance data fore three distinct levels of contamination. Two treatment trains were evaluated. One consisted of DAF, fluidized-bed biotreatment, and filtration plus carbon adsorption; the other used the same steps except to substitute air stripping for fluidized bed treatment. The final effluents produced by both treatment sequences were similar and demonstrated complete treatment of the groundwater. Besides detailing system design and performance for the treatability studies, the report includes an analysis of groundwater treatment applications to MGP sites in general, including a discussion of capital and operating costs
An Integrated Approach to Mitigation Wetland Site Selection: A Case Study in Gwacheon, Korea
Directory of Open Access Journals (Sweden)
Junga Lee
2015-03-01
Full Text Available This paper presents an integrated approach to mitigation wetland site selection using functional landscape connectivity and landscape structure. This approach enables landscape designers to evaluate the relative priorities of mitigation wetland areas based on functional landscape connectivity and wildlife mobility, as well as landscape structure, composition, and configuration. The least-cost path method is used to evaluate candidate sites for mitigation wetlands with regard to wildlife movement. A set of assessments for landscape indices using FRAGSTATS was applied to identify suitable mitigation wetland areas on the basis of landscape connectivity, composition, and configuration. The study was conducted in Gwacheon, Korea, where there are plans for regional development that will change the landscape. In the first step, a group of 14 candidate sites is identified via analysis of functional landscape connectivity using the least-cost path method. In the second step, candidate mitigation wetland areas are ranked according to landscape connectivity and composition. The five mitigation wetland areas that were found to be suitable were analyzed based on landscape configuration at the class level. This study demonstrates that functional landscape connectivity and landscape structure are important aspects to consider when identifying suitable sites for mitigation wetland planning and restoration.
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
This document summarizes the actions carried out in 2006 at some French abandoned mine sites: 1 - safety implementations and risks abatement in the framework of post-mining actions: coal mines of Ahun (23) and Argentat (19), antimony mines of Biard (87); 2 - remedial actions at the tin/tungsten mine of Puy-les-Vignes (87) and at the gold mine of Chatelet (23); 3 - 2007 post-mining perspectives; 4 - environmental aspects of abandoned mine sites: gold mines of Chatelet (23), Cheni and Bourneix (87), uranium mines of Haute-Vienne (expertise, control of effluents, financial warranties about tailings storage sites maintenance). (J.S.)
A Comparison of Online versus On-site Training in Health Research Methodology: A Randomized Study
Directory of Open Access Journals (Sweden)
Kanchanaraksa Sukon
2011-06-01
Full Text Available Abstract Background Distance learning may be useful for building health research capacity. However, evidence that it can improve knowledge and skills in health research, particularly in resource-poor settings, is limited. We compared the impact and acceptability of teaching two distinct content areas, Biostatistics and Research Ethics, through either on-line distance learning format or traditional on-site training, in a randomized study in India. Our objective was to determine whether on-line courses in Biostatistics and Research Ethics could achieve similar improvements in knowledge, as traditional on-site, classroom-based courses. Methods Subjects: Volunteer Indian scientists were randomly assigned to one of two arms. Intervention: Students in Arm 1 attended a 3.5-day on-site course in Biostatistics and completed a 3.5-week on-line course in Research Ethics. Students in Arm 2 attended a 3.5-week on-line course in Biostatistics and 3.5-day on-site course in Research Ethics. For the two course formats, learning objectives, course contents and knowledge tests were identical. Main Outcome Measures: Improvement in knowledge immediately and 3-months after course completion, compared to baseline. Results Baseline characteristics were similar in both arms (n = 29 each. Median knowledge score for Biostatistics increased from a baseline of 49% to 64% (p Conclusion On-line and on-site training formats led to marked and similar improvements of knowledge in Biostatistics and Research Ethics. This, combined with logistical and cost advantages of on-line training, may make on-line courses particularly useful for expanding health research capacity in resource-limited settings.
Radionuclide migration studies at the Nevada Test Site
International Nuclear Information System (INIS)
Thompson, J.L.
1989-01-01
The United States government routinely tests nuclear devices at the Nevada Test Site (NTS) in southern Nevada. A significant amount of radioactive material exists underground at the NTS with no containers or engineered barriers to inhibit its subsequent migration. The Department of Energy has sponsored for many years a research program on radionuclide movement in the geologic media at this location. Goals of this research program are to measure the extent of movement of radionuclides away from underground explosion sites and to determine the mechanisms by which such movement occurs. This program has acquired significance in another aspect of nuclear waste management because of the Yucca Mountain Project. Yucca Mountain at the NTS is being intensively studied as the possible site for a mined repository for high level nuclear waste. The NTS provides a unique setting for field studies concerning radionuclide migration; there is the potential for greatly increasing our knowledge of the behavior of radioactive materials in volcanogenic media. This review summarizes some of the significant findings made under this research program at the NTS and identifies reports in which the details of the research may be found. 36 refs., 4 figs
XPA A23G polymorphism and risk of digestive system cancers: a meta-analysis.
He, Lei; Deng, Tao; Luo, Hesheng
2015-01-01
Several studies have reported an association between the A23G polymorphism (rs 1800975) in the xeroderma pigmentosum group A (XPA) gene and risk of digestive system cancers. However, the results are inconsistent. In this study, we performed a meta-analysis to assess the association between XPA A23G polymorphism and the risk of digestive system cancers. Relevant studies were identified using the PubMed, Web of Science, China National Knowledge Infrastructure, WanFang, and VIP databases up to August 30, 2014. The pooled odds ratio (OR) with a 95% confidence interval (CI) was calculated using the fixed or random effects model. A total of 18 case-control studies from 16 publications with 4,170 patients and 6,929 controls were included. Overall, no significant association was found between XPA A23G polymorphism and the risk of digestive system cancers (dominant model: GA + AA versus GG, OR 0.89, 95% CI 0.74-1.08; recessive model: AA versus GA + GG, OR 0.94, 95% CI 0.74-1.20; GA versus GG, OR 0.89, 95% CI 0.77-1.03; and AA versus GG, OR 0.87, 95% CI 0.64-1.19). When the analysis was stratified by ethnicity, similar results were observed among Asians and Caucasians in all genetic models. In stratified analysis based on tumor type, we also failed to detect any association between XPA A23G polymorphism and the risk of esophageal, gastric, or colorectal cancers. This meta-analysis indicates that the XPA A23G polymorphism is not associated with a risk of digestive system cancers.
A Study On The Applicability Of SERVQUAL Dimensions Of Web Sites
Wiele, Ton; Iwaarden, Jos
2002-01-01
textabstractA survey has been undertaken amongst students of two universities (Erasmus University Rotterdam, The Netherlands, and Northeastern University Boston, USA) to study what quality factors are perceived as important in relation to their use of web sites. The results of the questionnaire survey are analysed in relation to the five service quality (SERVQUAL) dimensions (tangibles; reliability; responsiveness; assurance; empathy) as developed by Zeithaml et al [1]. There is evidence that...
Directory of Open Access Journals (Sweden)
R. G. Prinn
2010-08-01
Full Text Available HFC-23 (also known as CHF3, fluoroform or trifluoromethane is a potent greenhouse gas (GHG, with a global warming potential (GWP of 14 800 for a 100-year time horizon. It is an unavoidable by-product of HCFC-22 (CHClF2, chlorodifluoromethane production. HCFC-22, an ozone depleting substance (ODS, is used extensively in commercial refrigeration and air conditioning, in the extruded polystyrene (XPS foam industries (dispersive applications and also as a feedstock in fluoropolymer manufacture (a non-dispersive use. Aside from small markets in specialty uses, HFC-23 has historically been considered a waste gas that was, and often still is, simply vented to the atmosphere. Efforts have been made in the past two decades to reduce HFC-23 emissions, including destruction (incineration in facilities in developing countries under the United Nations Framework Convention on Climate Change's (UNFCCC Clean Development Mechanism (CDM, and by process optimization and/or voluntary incineration by most producers in developed countries. We present observations of lower-tropospheric mole fractions of HFC-23 measured by "Medusa" GC/MSD instruments from ambient air sampled in situ at the Advanced Global Atmospheric Gases Experiment (AGAGE network of five remote sites (2007–2009 and in Cape Grim air archive (CGAA samples (1978–2009 from Tasmania, Australia. These observations are used with the AGAGE 2-D atmospheric 12-box model and an inverse method to produce model mole fractions and a "top-down" HFC-23 emission history. The model 2009 annual mean global lower-tropospheric background abundance is 22.6 (±0.2 pmol mol−1. The derived HFC-23 emissions show a "plateau" during 1997–2003, followed by a rapid ~50% increase to a peak of 15.0 (+1.3/−1.2 Gg/yr in 2006. Following this peak, emissions of HFC-23 declined rapidly to 8.6 (+0.9/−1.0 Gg/yr in 2009, the lowest annual emission of the past 15 years. We derive a 1990–2008 "bottom-up" HFC-23 emission history
Ecological carrying capacity assessment of diving site: A case study of Mabul Island, Malaysia.
Zhang, Li-Ye; Chung, Shan-Shan; Qiu, Jian-Wen
2016-12-01
Despite considered a non-consumptive use of the marine environment, diving-related activities can cause damages to coral reefs. It is imminent to assess the maximum numbers of divers that can be accommodated by a diving site before it is subject to irreversible deterioration. This study aimed to assess the ecological carrying capacity of a diving site in Mabul Island, Malaysia. Photo-quadrat line transect method was used in the benthic survey. The ecological carrying capacity was assessed based on the relationship between the number of divers and the proportion of diver damaged hard corals in Mabul Island. The results indicated that the proportion of diver damaged hard corals occurred exponentially with increasing use. The ecological carrying capacity of Mabul Island is 15,600-16,800 divers per diving site per year at current levels of diver education and training with a quarterly threshold of 3900-4200 per site. Our calculation shows that management intervention (e.g. limiting diving) is justified at 8-14% of hard coral damage. In addition, the use of coral reef dominated diving sites should be managed according to their sensitivity to diver damage and the depth of the reefs. Copyright © 2016 Elsevier Ltd. All rights reserved.
23 CFR 750.105 - Signs that may be permitted in protected areas.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Signs that may be permitted in protected areas. 750.105... protected areas. (a) Erection or maintenance of the following signs may be permitted in protected areas... phenomena, historic sites, areas of natural scenic beauty or naturally suited for outdoor recreation and...
Studies on site characterization methodologies for high level radioactive waste disposal
International Nuclear Information System (INIS)
Wang Ju; Guo Yonghai; Chen Weiming
2008-01-01
This paper presents the final achievement of the project 'Studies of Site-specific Geological Environment for High Level Waste Disposal and Performance Assessment Methodology, Part Ⅰ: Studies on Site Characterization Methodologies for High Level Radioactive Waste Disposal', which is a 'Key Scientific and Technological Pre-Research Project for National Defense' during 2001-2005. The study area is Beishan area, Gansu Province, NW China--the most potential site for China's underground research laboratory and high level radioactive waste repository. The boreholes BS01, BS2, BS03 and BS04 drilled in fractured granite media in Beishan are used to conduct comprehensive studies on site characterization methodologies, including: bore hole drilling method, in situ measurement methods of hydrogeological parameters, underground water sampling technology, hydrogeochemical logging method, geo-stress measurement method, acoustic borehole televiewer measurement method, borehole radar measurement method, fault stability evaluation methods and rock joint evaluation method. The execution of the project has resulted in the establishment of an 'Integrated Methodological System for Site Characterization in Granite Site for High Level Radioactive Waste Repository' and the 8 key methodologies for site characterization: bore hole drilling method with minimum disturbance to rock mass, measurement method for hydrogeological parameters of fracture granite mass, in situ groundwater sampling methods from bore holes in fractured granite mass, fracture measurement methods by borehole televiewer and bore radar system, hydrogeochemical logging, low permeability measurement methods, geophysical methods for rock mass evaluation, modeling methods for rock joints. Those methods are comprehensive, advanced, innovative, practical, reliable and of high accuracy. The comprehensive utilization of those methods in granite mass will help to obtain systematic parameters of
Studies on Labour Safety in Construction Sites
Directory of Open Access Journals (Sweden)
S. Kanchana
2015-01-01
Full Text Available Construction industry has accomplished extensive growth worldwide particularly in past few decades. For a construction project to be successful, safety of the structures as well as that of the personnel is of utmost importance. The safety issues are to be considered right from the design stage till the completion and handing over of the structure. Construction industry employs skilled and unskilled labourers subject to construction site accidents and health risks. A proper coordination between contractors, clients, and workforce is needed for safe work conditions which are very much lacking in Indian construction companies. Though labour safety laws are available, the numerous accidents taking place at construction sites are continuing. Management commitment towards health and safety of the workers is also lagging. A detailed literature study was carried out to understand the causes of accidents, preventive measures, and development of safe work environment. This paper presents the results of a questionnaire survey, which was distributed among various categories of construction workers in Kerala region. The paper examines and discusses in detail the total working hours, work shifts, nativity of the workers, number of accidents, and type of injuries taking place in small and large construction sites.
Studies on Labour Safety in Construction Sites
Kanchana, S.; Sivaprakash, P.; Joseph, Sebastian
2015-01-01
Construction industry has accomplished extensive growth worldwide particularly in past few decades. For a construction project to be successful, safety of the structures as well as that of the personnel is of utmost importance. The safety issues are to be considered right from the design stage till the completion and handing over of the structure. Construction industry employs skilled and unskilled labourers subject to construction site accidents and health risks. A proper coordination between contractors, clients, and workforce is needed for safe work conditions which are very much lacking in Indian construction companies. Though labour safety laws are available, the numerous accidents taking place at construction sites are continuing. Management commitment towards health and safety of the workers is also lagging. A detailed literature study was carried out to understand the causes of accidents, preventive measures, and development of safe work environment. This paper presents the results of a questionnaire survey, which was distributed among various categories of construction workers in Kerala region. The paper examines and discusses in detail the total working hours, work shifts, nativity of the workers, number of accidents, and type of injuries taking place in small and large construction sites. PMID:26839916
Case study: Montclair/West Orange and Glen Ridge Radium Superfund sites
International Nuclear Information System (INIS)
Pezzella, R.; Seppi, P.; Watson, D.
1994-01-01
The Montclair/West Orange and Glen Ridge Radium Sites are located 12 miles west of New York City in three residential communities in Essex County, New Jersey. The sites are contaminated with waste materials from a local radium processing facility which ceased operations in 1926. Houses were subsequently constructed on or near the radium waste disposal areas. The waste material was also used as backfill, which caused contamination to be spread randomly over the communities. There are 769 properties between four townships that comprise the Superfund sites. The Environmental Protection Agency (EPA) conducted an aerial survey in 1981 which identified the boundaries of the sites. In 1985, the New Jersey Department of Environmental Protection (NJDEP) began a pilot study to examine the feasibility of excavation and off-site disposal of contaminated material as a permanent solution. The study was interrupted when the permit for the disposal site was revoked by the state of Nevada. Since 1990 field testing has been completed on over 725 properties and remediation and restoration has been completed on 75 properties
International Nuclear Information System (INIS)
Evenson, Grant
2012-01-01
Corrective Action Unit (CAU) 550 is located in Areas 7, 8, and 10 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 550, Smoky Contamination Area, comprises 19 corrective action sites (CASs). Based on process knowledge of the releases associated with the nuclear tests and radiological survey information about the location and shape of the resulting contamination plumes, it was determined that some of the CAS releases are co-located and will be investigated as study groups. This document describes the planned investigation of the following CASs (by study group): (1) Study Group 1, Atmospheric Test - CAS 08-23-04, Atmospheric Test Site T-2C; (2) Study Group 2, Safety Experiments - CAS 08-23-03, Atmospheric Test Site T-8B - CAS 08-23-06, Atmospheric Test Site T-8A - CAS 08-23-07, Atmospheric Test Site T-8C; (3) Study Group 3, Washes - Potential stormwater migration of contaminants from CASs; (4) Study Group 4, Debris - CAS 08-01-01, Storage Tank - CAS 08-22-05, Drum - CAS 08-22-07, Drum - CAS 08-22-08, Drums (3) - CAS 08-22-09, Drum - CAS 08-24-03, Battery - CAS 08-24-04, Battery - CAS 08-24-07, Batteries (3) - CAS 08-24-08, Batteries (3) - CAS 08-26-01, Lead Bricks (200) - CAS 10-22-17, Buckets (3) - CAS 10-22-18, Gas Block/Drum - CAS 10-22-19, Drum; Stains - CAS 10-22-20, Drum - CAS 10-24-10, Battery. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each study group. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed
II ZWICKY 23 AND FAMILY: A GROUP IN INTERACTION
Energy Technology Data Exchange (ETDEWEB)
Wehner, Elizabeth M. H.; Gallagher III, John S. [Department of Astronomy, University of Wisconsin-Madison and 475 North Charter Street, Madison, WI 53706 (United States); Cigan, Phillip J. [Cardiff University School of Physics and Astronomy Queen’s Buildings, The Parade, Cardiff, Cf24 3AA (United Kingdom); Rudie, Gwen C., E-mail: elizabeth@thewehners.net, E-mail: jsg@astro.wisc.edu, E-mail: CiganP@cardiff.ac.uk, E-mail: gwen@obs.carnegiescience.edu [The Observatories of the Carnegie Institution for Science and 813 Santa Barbara Street, Pasadena, CA 91101 (United States)
2016-09-01
II Zw 23 (UGC 3179) is a luminous (M{sub B} ∼ −21) nearby compact narrow emission line starburst galaxy with blue optical colors and strong emission lines. We present a photometric and morphological study of II Zw 23 and its interacting companion, KPG103a, using data obtained with the WIYN 3.5 m telescope in combination with a WFPC2 image from the Hubble Space Telescope archives. II Zw 23 has a highly disturbed outer structure with long trails of debris that may be contributing material toward the production of tidal dwarfs. Its central regions appear disky, a structure that is consistent with the overall rotation pattern observed in the H α velocity field measured from Densepak observations obtained with WIYN. We find additional evidence for interaction in this system, including the discovery of a new tidal loop extending from an associated dwarf galaxy, which appears to be in the process of disrupting along its orbit. We also present H α equivalent widths and discuss the relative star formation rates across this interacting system.
Mazumdar, Subhendu; Ghose, Dipankar; Saha, Goutam Kumar
2017-12-14
Although Black Kites (Milvus migrans govinda) serve as major scavenging raptor in most of the urban areas, scientific studies on this important ecosystem service provider are almost non-existent in Indian context. The present study was carried out in a metropolis in eastern India to find out the factors influencing relative abundance and roosting site selection of Black Kites. Separate generalized linear models (GLMs) were performed considering encounter rate and roosting Black Kite abundance as response variables. The study conclusively indicated that encounter rates of Black Kites were significantly influenced by the presence of garbage dumps in its vicinity. Numbers of Black Kites were also higher in the roosting sites situated closer to garbage dumps and open spaces. In addition, expected counts of Black Kites significantly increased in roosting sites situated away from buildings and water bodies. However, built-up area and tree cover around the roosting sites had no influence on the abundance of Black Kites therein. With rapid urbanization and changing offal disposal patterns, our findings would be useful to ensure continued availability of food and roosting sites of Black Kites in urban areas.
SitesIdentify: a protein functional site prediction tool
Directory of Open Access Journals (Sweden)
Doig Andrew J
2009-11-01
Full Text Available Abstract Background The rate of protein structures being deposited in the Protein Data Bank surpasses the capacity to experimentally characterise them and therefore computational methods to analyse these structures have become increasingly important. Identifying the region of the protein most likely to be involved in function is useful in order to gain information about its potential role. There are many available approaches to predict functional site, but many are not made available via a publicly-accessible application. Results Here we present a functional site prediction tool (SitesIdentify, based on combining sequence conservation information with geometry-based cleft identification, that is freely available via a web-server. We have shown that SitesIdentify compares favourably to other functional site prediction tools in a comparison of seven methods on a non-redundant set of 237 enzymes with annotated active sites. Conclusion SitesIdentify is able to produce comparable accuracy in predicting functional sites to its closest available counterpart, but in addition achieves improved accuracy for proteins with few characterised homologues. SitesIdentify is available via a webserver at http://www.manchester.ac.uk/bioinformatics/sitesidentify/
Magnetocaloric effect in (La1-xAx)2/3Ba1/3Mn1.05O3-δ
DEFF Research Database (Denmark)
Ancona-Torres, Carlos Eugenio; Menon, Mohan; Bahl, Christian Robert Haffenden
Recently, a large magnetocaloric effect has been reported in La2/3Ba1/3MnO3-δ at about 300 K. In this paper, we investigate the effect of the ion size distribution at the A site on the magnetocaloric effect of this perovskite material. This is accomplished by replacing the lanthanum by Ce, Pr......, and Nd, which allows us to study the effect of both the average size, , and the distribution, σrA, on the magnetic properties of the system. Using magnetization and heat capacity measurements, we determine the important magnetocaloric parameters ΔSM and ΔTad of (La1-xAx)2/3Ba1/3Mn1.05O3-δ powders...
Directory of Open Access Journals (Sweden)
Evans Paul M
2005-12-01
Full Text Available Abstract Background Site-directed mutagenesis is a widely-used technique for introducing mutations into a particular DNA sequence, often with the goal of creating a point mutation in the corresponding amino acid sequence but otherwise leaving the overall sequence undisturbed. However, this method provides no means for verifying its success other than sequencing the putative mutant construct: This can quickly become an expensive method for screening for successful mutations. An alternative to sequencing is to simultaneously introduce a restriction site near the point mutation in manner such that the restriction site has no effect on the translated amino acid sequence. Thus, the novel restriction site can be used as a marker for successful mutation which can be quickly and easily assessed. However, finding a restriction site that does not disturb the corresponding amino acid sequence is a time-consuming task even for experienced researchers. A fast and easy to use computer program is needed for this task. Results We wrote a computer program, called SiteFind, to help us design a restriction site within the mutation primers without changing the peptide sequence. Because of the redundancy of genetic code, a given peptide can be encoded by many different DNA sequences. Since the list of possible restriction sites for a given DNA sequence is not always obvious, SiteFind automates this task. The number of possible sequences a computer program must search through increases exponentially as the sequence length increases. SiteFind uses a novel "moving window" algorithm to reduce the number of possible sequences to be searched to a manageable level. The user enters a nucleotide sequence, specifies what amino acid residues should be changed in the mutation, and SiteFind generates a list of possible restriction sites and what nucleotides must be changed to introduce that site. As a demonstration of its use, we successfully generated a single point mutation
International Nuclear Information System (INIS)
Merchant, Thomas E.; Kun, Larry E.; Krasin, Matthew J.; Wallace, Dana; Chintagumpala, Murali M.; Woo, Shiao Y.; Ashley, David M.; Sexton, Maree; Kellie, Stewart J.; Ahern, Verity M.B.B.S.; Gajjar, Amar
2008-01-01
Purpose: Limiting the neurocognitive sequelae of radiotherapy (RT) has been an objective in the treatment of medulloblastoma. Conformal RT to less than the entire posterior fossa (PF) after craniospinal irradiation might reduce neurocognitive sequelae and requires evaluation. Methods and Materials: Between October 1996 and August 2003, 86 patients, 3-21 years of age, with newly diagnosed, average-risk medulloblastoma were treated in a prospective, institutional review board-approved, multi-institution trial of risk-adapted RT and dose-intensive chemotherapy. RT began within 28 days of definitive surgery and consisted of craniospinal irradiation (23.4 Gy), conformal PF RT (36.0 Gy), and primary site RT (55.8 Gy). The planning target volume for the primary site included the postoperative tumor bed surrounded by an anatomically confined margin of 2 cm that was then expanded with a geometric margin of 0.3-0.5 cm. Chemotherapy was initiated 6 weeks after RT and included four cycles of high-dose cyclophosphamide, cisplatin, and vincristine. Results: At a median follow-up of 61.2 months (range, 5.2-115.0 months), the estimated 5-year event-free survival and cumulative incidence of PF failure rate was 83.0% ± 5.3% and 4.9% ± 2.4% (± standard error), respectively. The targeting guidelines used in this study resulted in a mean reduction of 13% in the volume of the PF receiving doses >55 Gy compared with conventionally planned RT. The reductions in the dose to the temporal lobes, cochleae, and hypothalamus were statistically significant. Conclusion: This prospective trial has demonstrated that irradiation of less than the entire PF after 23.4 Gy craniospinal irradiation for average-risk medulloblastoma results in disease control comparable to that after treatment of the entire PF
Ecological studies of small mammals in a nuclear site on Nevada Test Site
International Nuclear Information System (INIS)
Bradley, W.G.; Moor, K.S.
1978-01-01
Ecological studies of small vertebrates in nuclear event sites in NTS began in spring 1977 with the establishment of a permanent live-trapping grid in Little Feller II. These study areas are located in Area 18, a relatively homogeneous area vegetatively and topographically. Most of the flora and fauna are typical of the Great Basin desert found in southern Nevada. Dominant vegetation includes Artemesia spp. and to a lesser extent Atriplex. Salsola is an abundant weed in areas that have been mechanically disturbed such as the vicinity of GZ. A 400-station live-trapping grid was established in Little Feller II, April 1977. Sixteen lines of live traps (25 traps per line, each trap 50 feet apart) comprise the 8.4 hectare grid encompassing GZ. Nine trapping periods have been completed to date totaling over 10,000 trap nights. Over 400 small vertebrates have been marked for permanent identification in the grid. Over 60 known residents (animals marked 3 months previously and recaptured in the same vicinity) have been collected and prepared for shipping; however, radioanalytical results were not available to include in this report. Both census and field note observations were used to develop an inventory of the vertebrates found in the study areas. Sufficient data have been generated from Little Feller II to estimate density of rodents. These data and comparative data from Area 5 (Mohave Desert), Area 11 (Transition), and Area 13 (Great Basin) are presented. It was readily apparent that rodents in general were more numerous in Little Feller II. In addition, Dipodomys ordii, a Great Basin species, was an important new addition to the rodent fauna
Energy conserving site design case study: Shenandoah, Georgia. Final report
Energy Technology Data Exchange (ETDEWEB)
1980-01-01
The case study examines the means by which energy conservation can be achieved at an aggregate community level by using proper planning and analytical techniques for a new town, Shenandoah, Georgia, located twenty-five miles southwest of Atlanta's Hartsfield International Airport. A potentially implementable energy conservation community plan is achieved by a study team examining the land use options, siting characteristics of each building type, alternate infrastructure plans, possible decentralized energy options, and central utility schemes to determine how community energy conservation can be achieved by use of pre-construction planning. The concept for the development of mixed land uses as a passively sited, energy conserving community is based on a plan (Level 1 Plan) that uses the natural site characteristics, maximizes on passive energy siting requirement, and allows flexibility for the changing needs of the developers. The Level 2 Plan is identical with Level 1 plan plus a series of decentraized systems that have been added to the residential units: the single-family detached, the apartments, and the townhouses. Level 3 Plan is similar to the Level 1 Plan except that higher density dwellings have been moved to areas adjacent to central site. The total energy savings for each plan relative to the conventional plan are indicated. (MCW)
Conformational change in full-length mouse prion: A site-directed spin-labeling study
International Nuclear Information System (INIS)
Inanami, Osamu; Hashida, Shukichi; Iizuka, Daisuke; Horiuchi, Motohiro; Hiraoka, Wakako; Shimoyama, Yuhei; Nakamura, Hideo; Inagaki, Fuyuhiko; Kuwabara, Mikinori
2005-01-01
The structure of the mouse prion (moPrP) was studied using site-directed spin-labeling electron spin resonance (SDSL-ESR). Since a previous NMR study by Hornemanna et al., [Hornemanna, Korthb, Oeschb, Rieka, Widera, Wuethricha, Glockshubera, Recombinant full-length murine prion protein, mPrP (23-231): purification and spectroscopic characterization, FEBS Lett. 413 (1997) 277-281] has indicated that N96, D143, and T189 in moPrP are localized in a Cu 2+ binding region, Helix1 and Helix2, respectively, three recombinant moPrP mutations (N96C, D143C, and T189C) were expressed in an Escherichia coli system, and then refolded by dialysis under low pH and purified by reverse-phase HPLC. By using the preparation, we succeeded in preserving a target cystein residue without alteration of the α-helix structure of moPrP and were able to apply SDSL-ESR with a methane thiosulfonate spin label to the full-length prion protein. The rotational correlation times (τ) of 1.1, 3.3, and 4.8 ns were evaluated from the X-band ESR spectra at pH 7.4 and 20 deg C for N96R1, D143R1, and T189R1, respectively. τ reflects the fact that the Cu 2+ binding region is more flexible than Helix1 or Helix2. ESR spectra recorded at various temperatures revealed two phases together with a transition point at around 20 deg C in D143R1 and T189R1, but not in N96R1. With the variation of pH from 4.0 to 7.8, ESR spectra of T189R1 at 20 deg C showed a gradual increase of τ from 2.9 to 4.8 ns. On the other hand, the pH-dependent conformational changes in N96R1 and D143R1 were negligible. These results indicated that T189 located in Helix2 possessed a structure sensitive to physiological pH changes; simultaneously, N96 in the Cu 2+ binding region and D143 in Helix1 were conserved
Sympathetic ophthalmia after 23-gauge transconjunctival sutureless vitrectomy
Directory of Open Access Journals (Sweden)
Masatoshi Haruta
2010-11-01
Full Text Available Masatoshi Haruta1, Hirokazu Mukuno2, Kazuaki Nishijima3, Hitoshi Takagi4, Mihori Kita51Department of Ophthalmology, Kurume University School of Medicine, Kurume, Fukuoka, Japan; 2Department of Ophthalmology, Konan Hospital, Kobe, Hyogo, Japan; 3Department of Ophthalmology and Visual Sciences, Kyoto University Graduate School of Medicine, Kyoto, Kyoto, Japan; 4Department of Ophthalmology, St Marianna University School of Medicine, Kawasaki, Kanagawa, Japan; 5Department of Ophthalmology, Hyogo Prefectural Amagasaki Hospital, Amagasaki, Hyogo, JapanPurpose: We report a case of a sympathetic ophthalmia that occurred after 23-gauge transconjunctival sutureless vitrectomy for a retinal detachment.Case report: A 41-year-old Japanese woman underwent combined phacoemulsification with intraocular lens implantation and 23-gauge transconjunctival sutureless vitrectomy for a rhegmatogenous retinal detachment in the right eye. Endolaser photocoagulation and silicone oil tamponade were used to manage inferior retinal holes. Four weeks after the surgery, she returned with a 5-day history of reduced vision and metamorphopsia in her left eye. Slit-lamp examination showed a shallow anterior chamber in the right eye and moderate anterior uveitis bilaterally. Silicone oil bubbles and pigment dispersion were observed in the subconjunctival space adjacent to the right eye’s superonasal sclerotomy site. Fundus examination showed multifocal serous retinal detachments in both eyes. A diagnosis of sympathetic ophthalmia was made and the patient was treated with intensive topical and systemic steroids. The subretinal fluid cleared in both eyes following treatment. Twelve months after the onset of inflammation, the patient’s condition was stable on a combination of oral cyclosporine and topical steroids. Sunset glow retinal changes remain, but there has been no evidence of recurrent inflammation.Conclusion: Sympathetic ophthalmia can develop after 23-gauge
International Nuclear Information System (INIS)
Chen, Z.; Huang, G.H.; Chakma, A.
1998-01-01
In this study, an integrated risk assessment approach is proposed for evaluating environmental risks derived from petroleum-contaminated sites. The proposed approach is composed of (i) a hydrocarbon spill screening model (HSSM) which is used for simulating immiscible flow of released hydrocarbons in vadose zone, formation of lens in capillary fringe, dissolution of pollutants at water table, and transport of the pollutants to receptors, and (ii) a fuzzy relation analysis (FRA) model which is developed for comprehensively evaluating risks caused by a number of pollutants with different impact characteristics, based on the HSSM results. This hybrid HSSM-FRA approach was applied to a case study for a petroleum-contaminated site in western Canada, where soil and groundwater was contaminated by industrial wastes containing benzene, toluene, ethylbenzene and xylenes (BTEXs). The results suggest that the HSSM-FRA can provide insight into the potential risk to the receptor of concern downward the aquifer and can serve as a basis for further remediation-related decision analysis. (author)
A study of mandibular fractures over a 5-year period of time: A retrospective study
Directory of Open Access Journals (Sweden)
Ashish Vyas
2014-01-01
Full Text Available Objective: This study aims to evaluate and compare with the existing literature on the etiology, pattern, gender, and anatomical distribution of mandibular fractures. Materials and Methods: The data of 225 cases were analyzed over a period of 5 years between March 2009 and November 2013. Of this 110 were unilateral, 23 bilateral, 18 symphysis and 74 multiple fractures. Results: Males are more affected than females.The peak incidence rate is occurring in 30-35 years of age group. The most common fracture site is parasymphysis and least common site is ramus of mandible. The most common etiological factor is road traffic accident (RTA (45.3% followed by falls (42.6%, assaults (8.9%, sport injuries (2.2%, and gunshot wounds (0.89%. Conclusion: Thus, we conclude that RTA is the leading cause of mandibular fractures and males are more affected. The most common site is parasymphysis fracture in association with angle fracture. We observed that gender was significantly associated with body and angle fracture (P = 0.04 and significant relationship between etiology with multiple site fracture such as (parasymphysis-angle, (body-condyle, (body-angle, and (symphysis-condyle was observed (P ≤ 0.05.
International Nuclear Information System (INIS)
2007-01-01
This document summarizes the actions carried out in 2006 at some French abandoned mine sites: 1 - safety implementations and risks abatement in the framework of post-mining actions: coal mines of Ahun (23) and Argentat (19), antimony mines of Biard (87); 2 - remedial actions at the tin/tungsten mine of Puy-les-Vignes (87) and at the gold mine of Chatelet (23); 3 - 2007 post-mining perspectives; 4 - environmental aspects of abandoned mine sites: gold mines of Chatelet (23), Cheni and Bourneix (87), uranium mines of Haute-Vienne (expertise, control of effluents, financial warranties about tailings storage sites maintenance). (J.S.)
Wilson, Jenny L; Peebles, Rebecka; Hardy, Kristina K; Litt, Iris F
2006-12-01
Pro-eating disorder Web sites are communities of individuals who engage in disordered eating and use the Internet to discuss their activities. Pro-recovery sites, which are less numerous, express a recovery-oriented perspective. This pilot study investigated the awareness and usage of pro-eating disorder Web sites among adolescents with eating disorders and their parents and explored associations with health and quality of life. This was a cross-sectional study of 698 families of patients (aged 10-22 years) diagnosed with an eating disorder at Stanford between 1997 and 2004. Anonymous surveys were mailed and offered in clinic. Survey content included questions about disease severity, health outcomes, Web site usage, and parental knowledge of eating disorder Web site usage. Surveys were returned by 182 individuals: 76 patients and 106 parents. Parents frequently (52.8%) were aware of pro-eating disorder sites, but an equal number did not know whether their child visited these sites, and only 27.6% had discussed them with their child. Most (62.5%) parents, however, did not know about pro-recovery sites. Forty-one percent of patients visited pro-recovery sites, 35.5% visited pro-eating disorder sites, 25.0% visited both, and 48.7% visited neither. While visiting pro-eating disorder sites, 96.0% reported learning new weight loss or purging techniques. However, 46.4% of pro-recovery site visitors also learned new techniques. Pro-eating disorder site users did not differ from nonusers in health outcomes but reported spending less time on school or schoolwork and had a longer duration of illness. Users of both pro-eating disorder and pro-recovery sites were hospitalized more than users of neither site. Pro-eating disorder site usage was prevalent among adolescents with eating disorders, yet parents had little knowledge of this. Although use of these sites was not associated with other health outcomes, usage may have a negative impact on quality of life and result in
International Nuclear Information System (INIS)
Matthews, Patrick; Burmeister, Mark
2016-01-01
The purpose of this CAP is to provide the plan for implementation of the recommended corrective action alternatives (CAAs) for CAU 568. Site characterization activities were performed in 2014, and the results are presented in Appendix A of the CAU 568 CADD. The CAAs were recommended in the CADD. The scope of work required to implement the recommended CAAs of closure in place and clean closure at 11 of the 14 CASs includes the following: The installation of physical barriers over the nine safety experiment ground zeroes to cover contamination at CASs 03-23-20 (Otero), 03-23-23 (San Juan and Pascal-C), 03-23-31 (Pascal-B, Luna, Colfax), 03-23-32 (Pascal-A), 03-23-33 (Valencia), and 03-23-34 (Chipmunk); the characterization and removal of three soil and debris piles at CAS 03-08-04, and one HCA soil pile at CAS 03-23-30; the removal of three steel well head covers (PSM) from CASs 03-23-20 (Otero), 03-23-31 (Luna), and 03-23-33 (Valencia); the removal of soil and lead PSM from two locations at CAS 03-26-04; Implementation of FFACO use restrictions at nine safety experiment ground zeroes at CASs 03-23-20, 03-23-23, 03-23-31, 03-23-32, 03-23-33, and 03-23-34; the steel well head cover at CAS 03-23-23; the areas meeting HCA conditions at CASs 03-23-19 and 03-23-31; and the Boomer crater area at CAS 03-45-01. The FFACO use restriction boundaries will be presented in the CAU 568 closure report.
Energy Technology Data Exchange (ETDEWEB)
Matthews, Patrick [Navarro Nevada Environmental Services, NV (United States); Burmeister, Mark [Navarro Nevada Environmental Services, NV (United States)
2016-05-01
The purpose of this CAP is to provide the plan for implementation of the recommended corrective action alternatives (CAAs) for CAU 568. Site characterization activities were performed in 2014, and the results are presented in Appendix A of the CAU 568 CADD. The CAAs were recommended in the CADD. The scope of work required to implement the recommended CAAs of closure in place and clean closure at 11 of the 14 CASs includes the following: The installation of physical barriers over the nine safety experiment ground zeroes to cover contamination at CASs 03-23-20 (Otero), 03-23-23 (San Juan and Pascal-C), 03-23-31 (Pascal-B, Luna, Colfax), 03-23-32 (Pascal-A), 03-23-33 (Valencia), and 03-23-34 (Chipmunk); the characterization and removal of three soil and debris piles at CAS 03-08-04, and one HCA soil pile at CAS 03-23-30; the removal of three steel well head covers (PSM) from CASs 03-23-20 (Otero), 03-23-31 (Luna), and 03-23-33 (Valencia); the removal of soil and lead PSM from two locations at CAS 03-26-04; Implementation of FFACO use restrictions at nine safety experiment ground zeroes at CASs 03-23-20, 03-23-23, 03-23-31, 03-23-32, 03-23-33, and 03-23-34; the steel well head cover at CAS 03-23-23; the areas meeting HCA conditions at CASs 03-23-19 and 03-23-31; and the Boomer crater area at CAS 03-45-01. The FFACO use restriction boundaries will be presented in the CAU 568 closure report.
Zipfel, Jonathan; Kastler, Adrian; Tatu, Laurent; Behr, Julien; Kechidi, Rachid; Kastler, Bruno
2016-01-01
Two studies recently reported that computed tomography (CT) guided infiltration of the greater occipital nerve at its intermediate site allows a high efficacy rate with long-lasting pain relief following procedure in occipital neuralgia and in various craniofacial pain syndromes. The purpose of our study was to evaluate the technical feasibility and safety of ultrasound-guided intermediate site greater occipital nerve infiltration. Retrospective study. This study was conducted at the imaging department of a 1,409 bed university hospital. Local institutional review board approval was obtained and written consent was waived. In this retrospective study, 12 patients suffering from refractory occipital neuralgia or craniofacial pain syndromes were included between April and October 2014. They underwent a total of 21 ultrasound-guided infiltrations. Infiltration of the greater occipital nerve was performed at the intermediate site of the greater occipital nerve, at its first bend between obliqus capitis inferior and semispinalis capitis muscles with local anestetics and cortivazol. Technical success was defined as satisfactory diffusion of added iodinated contrast media in the fatty space between these muscles depicted on control CT scan. We also reported first data of immediate block test efficacy and initial clinical efficacy at 7 days, one month, and 3 months, defined by a decrease of at least 50% of visual analog scale (VAS) scores. Technical success rate was 95.24%. Patients suffered from right unilateral occipital neuralgia in 3 cases, left unilateral occipital neuralgia in 2 cases, bilateral occipital neuralgia in 2 cases, migraine in one case, cervicogenic headache in one case, tension-type headache in 2 cases, and cluster headache in one case. Block test efficacy was found in 93.3% (14/15) cases. Clinical efficacy was found in 80% of cases at 7 days, in 66.7% of cases at one month and in 60% of cases at 3 months. No major complications were noted. Some of the
[2,3 diphosphoglycerate in preterm newborns].
Scopesi, F; Canini, S; Mazzella, M; Arioni, C; Lantieri, P; Serra, G
2000-01-01
It has been largely shown that during the first month of life, in the preterm neonate Hb levels and Hct percentages rapidly decrease, high HbF concentration persists and a high oxygen affinity occurs. Data are needed to establish the level at which 2,3 dyphosphoglycerate (2,3 DPG) interacts with the regulation of oxygen affinity. 24 samples, from eight uncomplicated preterm newborns (34.1 +/- 1.83 GW, 1869 +/- +/- 291 BW) obtained at the same time as those required for the clinical management of the infants, were collected on the 2nd, 7th and 14th day of life. Blood gases, total hemoglobin and hematocrit were obtained from 0.3 ml arterialised capillary blood. Assays of 2,3 DPG were made separately on 0.4 ml venous blood. As expected tHb concentration and Hct percentages significantly decreased from day 2 to day 14 in all eight cases. On the contrary 2,3 DPG and p50 values remained stable. Subsequently throughout the study period all neonates had an increased 2,3 DPG/Hb ratio that was significantly related with p50 at standard conditions (p < 0.05). Stable 2,3 DPG concentrations during all study period have been detected. The subsequent significant increased 2.3 DPG/Hb, ratio related to increased p50 values, could have a key role in a physiological mechanism aimed to ensure adequate oxygen delivery to the tissues and to counteract the higher oxygen affinity of fetal hemoglobin. A wider sample is needed to validate this hypothesis.
Sridharan, Santhya
2016-01-01
Master's thesis in International hotel and tourism management The main focus of the study is to understand what motivates a person to give electronic word of mouth (eWOM) on social networking sites. With the increasing popularity of social networking sites, lots of consumers check these sites for reviews of products and services. Based on the literature review, a scale of motives that lead to giving eWOM by means of writing comments on social networking sites was developed. The study used ...
Contaminant transport modeling studies of Russian sites
International Nuclear Information System (INIS)
Tsang, Chin-Fu
1993-01-01
Lawrence Berkeley Laboratory (LBL) established mechanisms that promoted cooperation between U.S. and Russian scientists in scientific research as well as environmental technology transfer. Using Russian experience and U.S technology, LBL developed approaches for field investigations, site evaluation, waste disposal, and remediation at Russian contaminated sites. LBL assessed a comprehensive database as well as an actual, large-scale contaminated site to evaluate existing knowledge of and test mathematical models used for the assessment of U.S. contaminated sites
Directory of Open Access Journals (Sweden)
Seiji Fukumoto
2018-02-01
Full Text Available Fibroblast growth factor 23 (FGF23 is a phosphotropic hormone mainly produced by bone. FGF23 reduces serum phosphate by suppressing intestinal phosphate absorption through reducing 1,25-dihydroxyvitamin D and proximal tubular phosphate reabsorption. Excessive actions of FG23 result in several kinds of hypophosphatemic rickets/osteomalacia including X-linked hypophosphatemic rickets (XLH and tumor-induced osteomalacia. While neutral phosphate and active vitamin D are standard therapies for child patients with XLH, these medications have several limitations both in their effects and adverse events. Several approaches that inhibit FGF23 actions including anti-FGF23 antibodies and inhibitors of FGF signaling have been shown to improve phenotypes of model mice for FG23-related hypophosphatemic diseases. In addition, clinical trials indicated that a humanized anti-FGF23 antibody increased serum phosphate and improved quality of life in patients with XLH. Furthermore, circulatory FGF23 is high in patients with chronic kidney disease (CKD. Many epidemiological studies indicated the association between high FGF23 levels and various adverse events especially in patients with CKD. However, it is not known whether the inhibition of FGF23 activities in patients with CKD is beneficial for these patients. In this review, recent findings concerning the modulation of FGF23 activities are discussed.
Energy Technology Data Exchange (ETDEWEB)
Serrato, M.; Jungho, I.; Jensen, J.; Jensen, R.; Gladden, J.; Waugh, J.
2012-01-17
Remote sensing technology can provide a cost-effective tool for monitoring hazardous waste sites. This study investigated the usability of HyMap airborne hyperspectral remote sensing data (126 bands at 2.3 x 2.3 m spatial resolution) to characterize the vegetation at U.S. Department of Energy uranium processing sites near Monticello, Utah and Monument Valley, Arizona. Grass and shrub species were mixed on an engineered disposal cell cover at the Monticello site while shrub species were dominant in the phytoremediation plantings at the Monument Valley site. The specific objectives of this study were to: (1) estimate leaf-area-index (LAI) of the vegetation using three different methods (i.e., vegetation indices, red-edge positioning (REP), and machine learning regression trees), and (2) map the vegetation cover using machine learning decision trees based on either the scaled reflectance data or mixture tuned matched filtering (MTMF)-derived metrics and vegetation indices. Regression trees resulted in the best calibration performance of LAI estimation (R{sup 2} > 0.80). The use of REPs failed to accurately predict LAI (R{sup 2} < 0.2). The use of the MTMF-derived metrics (matched filter scores and infeasibility) and a range of vegetation indices in decision trees improved the vegetation mapping when compared to the decision tree classification using just the scaled reflectance. Results suggest that hyperspectral imagery are useful for characterizing biophysical characteristics (LAI) and vegetation cover on capped hazardous waste sites. However, it is believed that the vegetation mapping would benefit from the use of 1 higher spatial resolution hyperspectral data due to the small size of many of the vegetation patches (< 1m) found on the sites.
International Nuclear Information System (INIS)
Serrato, M.; Jungho, I.; Jensen, J.; Jensen, R.; Gladden, J.; Waugh, J.
2012-01-01
Remote sensing technology can provide a cost-effective tool for monitoring hazardous waste sites. This study investigated the usability of HyMap airborne hyperspectral remote sensing data (126 bands at 2.3 x 2.3 m spatial resolution) to characterize the vegetation at U.S. Department of Energy uranium processing sites near Monticello, Utah and Monument Valley, Arizona. Grass and shrub species were mixed on an engineered disposal cell cover at the Monticello site while shrub species were dominant in the phytoremediation plantings at the Monument Valley site. The specific objectives of this study were to: (1) estimate leaf-area-index (LAI) of the vegetation using three different methods (i.e., vegetation indices, red-edge positioning (REP), and machine learning regression trees), and (2) map the vegetation cover using machine learning decision trees based on either the scaled reflectance data or mixture tuned matched filtering (MTMF)-derived metrics and vegetation indices. Regression trees resulted in the best calibration performance of LAI estimation (R 2 > 0.80). The use of REPs failed to accurately predict LAI (R 2 < 0.2). The use of the MTMF-derived metrics (matched filter scores and infeasibility) and a range of vegetation indices in decision trees improved the vegetation mapping when compared to the decision tree classification using just the scaled reflectance. Results suggest that hyperspectral imagery are useful for characterizing biophysical characteristics (LAI) and vegetation cover on capped hazardous waste sites. However, it is believed that the vegetation mapping would benefit from the use of 1 higher spatial resolution hyperspectral data due to the small size of many of the vegetation patches (< 1m) found on the sites.
Usability Testing of an Academic Library Web Site: A Case Study.
Battleson, Brenda; Booth, Austin; Weintrop, Jane
2001-01-01
Discusses usability testing as a tool for evaluating the effectiveness and ease of use of academic library Web sites; considers human-computer interaction; reviews major usability principles; and explores the application of formal usability testing to an existing site at the University at Buffalo (NY) libraries. (Author/LRW)
Jeremiah 23:23–24 as polemic against prophets' views on Yahweh's ...
African Journals Online (AJOL)
2016-05-31
May 31, 2016 ... Yahweh is also a distant God who is aware of their false and deceitful attempts to provide revelatory knowledge to the people. In this regard chapter 23:23–24 serves as a polemic against so-called false prophets and implies a threat of judgement. Jeremiah 23:23–24 as polemic against prophets' views on ...
Mortality and morbidity study of petrochemical employees in a polluted site
Directory of Open Access Journals (Sweden)
Pasetto Roberto
2012-05-01
Full Text Available Abstract Background The area of Gela was included among the 57 Italian polluted sites of national interest for environmental remediation because of its widespread contamination from a petrochemical complex. The present study investigates mortality and morbidity of the cohort of Gela petrochemical workers with the aim of disentangling occupational from residential risk. Methods Mortality was assessed for 5,627 men hired from 1960, year of the plant start-up, to 1993; it was followed up for vital status in the period 1960–2002. Morbidity was analysed for 5,431 workers neither dead nor lost to follow-up from 1960 to 2001 and was based on Hospital Discharge Records in the period 2001–2006. The work experience was classified in terms of job categories such as blue collars, white collars, and both – workers who shifted from blue to white collar (95% or vice versa. An ad hoc mobility model was applied to define qualitative categories of residence in Gela, as residents and commuters. Standardized Mortality Ratios (SMRs and Mortality Rate Ratios (MRRs were computed, the latter by using a Poisson regression model. Morbidity was analyzed in terms of Hospital Discharge Odds Ratios (HDORs through a logistic regression model. While performing the internal comparisons, white collars was the reference category for the job analysis, and commuters was the reference category for the residential analysis. Results In the light of epidemiological evidence about health risk from petrochemical industries in both occupational and environmental settings, and/or on the basis of information about occupational and residential contamination and health risk in the area of Gela, noteworthy results are shown for lung cancer [MRR: 2.11 (CI 90%; 0.96-4.63 in blue collars; 1.71 (1.09-2.69 in residents], respiratory diseases [HDOR: 2.0 (1.0-3.0 in blue collars; 1.4 (0.96-2.06 in residents] and genitourinary diseases [HDOR: 1.34 (1.06-1.68 in blue collars; 1.23 (1.04-1.45 in
Content and Form Anaysis of the Web Sites of University Libraries: A study on the Case in Turkey
Directory of Open Access Journals (Sweden)
Mesut Kurulgan
2006-06-01
Full Text Available Internet is an important medium in the process of development of information and information technologies. University library web sites are used by many users to reach information. The speed, ease and efficiency of library web site usage contributes to users' satisfaction. This study compares library web sites of state universities to the foundation universities in terms ofform and content. Evaluation criteria obtained through content analysis is measured by visiting each library Web site and measures are given as frequency distribution and percentage analysis. The study concludes that library web sites of state universities use the Internet opportunities more effectively than the library web sites of foundation universities.
International Nuclear Information System (INIS)
1987-06-01
This site plan describes utilities and solid waste studies to be conducted during the characterization of the Deaf Smith County, Texas, site for the US Department of Energy's Salt Repository Project. After utilities and solid waste information needs derived from Federal, State, and local statutes and regulations and the project specifications are briefly described, the site study plan describes the study design and rationale, the field data collection procedures and equipment, and data analysis methods and application of results, the data management strategy, the schedule of field activities, the management of the study, and the study's quality assurance program. The field data collection activities are organized into programs to characterize electrical power, natural gas, communication, water, wastewater sludge, nonradiological solid waste, nonradiological hazardous waste, and low-level radiological waste. These programs include details for the collection of project needs, identification of utilities and solid waste disposal contractor capabilities, and verification of the obtained data. Utilities and solid waste field activities will begin approximately at the time of site access. Utilities and solid waste characterization will be completed within the first year of activity. 29 refs., 6 figs., 2 tabs
Matuszewski, Paul E; Costales, Timothy; Zerhusen, Timothy; Coale, Max; Mehta, Samir; Pollak, Andrew N; OʼToole, Robert V
2016-07-01
Some have proposed that a so-called digital divide exists for orthopaedic trauma patients and that the clinical usefulness of the Internet for these patients is limited. No studies to date have confirmed this or whether patients would use a provided web resource. The hypotheses of this study were (1) a larger than expected percentage of trauma patients have access to the Internet and (2) if given access to a custom site, patients will use it. Prospective cohort. Level 1 regional trauma center. Patients who were 18 years or older with acute operative fractures participated in this study. Enrollment was initiated either before discharge or at initial outpatient follow-up. We conducted a survey of demographics, Internet usage, device type, eHealth Literacy, and intent to use the web site. Participants received a keychain containing the web address and a unique access code to our custom orthopaedic trauma web site. Percentage of patients with Internet access and percentage of patients who visited the web site. One hundred twelve patients were enrolled. Ninety-three percent (104/112) reported having Internet access (P digital divide is a myth in orthopaedic trauma. Despite widespread access and enthusiasm for our web site, few patients visited. This cautions against the allocation of resources for patient-specific web sites for orthopaedic trauma until a rationale for use can be better delineated. Therapeutic Level IV. See Instructions for Authors for a complete description of levels of evidence.
International Nuclear Information System (INIS)
1987-06-01
The Acoustics site study plan describes a field program which characterizes existing sound levels, determines the area's sound propagation characteristics, and monitors the project-related sound emissions. The plan describes for each study: the need for the study, study design, data management and use, schedule, and quality assurance requirements. These studies will provide data needed to satisfy requirements contained in, or derived from, the Salt Repository Requirements Document. 37 refs., 9 figs., 3 tabs
Preliminary studies on the Marcoule site, using a wind-tunnel
International Nuclear Information System (INIS)
Chassany, J.Ph.; Salaun-Penquer, G.
1961-01-01
The tests were carried out in the 3.30 x 2.20 subsonic elliptical wind-tunnel of the Marseille Institute of fluid mechanics, on a 1/1000 scale model measuring 3 m x 3 m. The aerodynamic field developing above the site, made visible by ammonium, hydro-chlorate fumes, and the residues were observed and filmed by means of a synchronised cine-camera with stroboscopic lighting for 4 wind directions. The fall-out from the various waste products was obtained from a spraying of lead acetate solution on the model and hydrogen sulphide emissions. The zones of maximum pollution can be determined from a study of the film taken during the blackening of the spots. (author) [fr
Fibroblast Growth Factor 23 (FGF23 and Disorders of Phosphate Metabolism
Directory of Open Access Journals (Sweden)
Tasuku Saito
2009-01-01
Full Text Available Derangements in serum phosphate level result in rickets/osteomalacia or ectopic calcification indicating that healthy people without these abnormalities maintain serum phosphate within certain ranges. These results indicate that there must be a regulatory mechanism of serum phosphate level. Fibroblast growth factor 23 (FGF23 was identified as the last member of FGF family. FGF23 is produced by bone and reduces serum phosphate level by suppressing phosphate reabsorption in proximal tubules and intestinal phosphate absorption through lowering 1,25-dihydroxyvitamin D level. It has been shown that excess and deficient actions of FGF23 result in hypophosphatemic rickets/osteomalacia and hyperphosphatemic tumoral calcinosis, respectively. These results indicate that FGF23 works as a hormone, and several disorders of phosphate metabolism can be viewed as endocrine diseases. It may become possible to treat patients with abnormal phosphate metabolism by pharmacologically modifying the activity of FGF23.
Directory of Open Access Journals (Sweden)
Ana M. Araújo
2017-09-01
Full Text Available Background: Transversus abdominis plane (TAP block is useful in reducing post-operative pain in laparoscopic nephrectomy compared to placebo. The purpose of this work is to compare post-operative pain and recovery after TAP block or trocar site infiltration (TSI in this surgery. Methods: A prospective, single blinded study on patients scheduled for laparoscopic nephrectomy. Patients were assigned to two groups: TSI Group: trocar site infiltration at the end of surgery; TAP Group: unilateral ultrasound-guided TAP block after induction. Sevoflurane and remifentanil, in a target controlled infusion mode, were used for maintenance of general anesthesia. Before the end of surgery paracetamol, tramadol and morphine were administered. Visual analogue scale (VAS 0–100 mm at rest and with cough was applied in three moments: in recovery room (T1 at admission and T2 before discharge and 24 h after surgery (T3. Pain scores with incentive spirometer were also evaluated at T3. In recovery, morphine was administered as a rescue drug whenever VAS > 30 mm. Time to oral intake, chair sitting, ambulation and length of hospital stay were evaluated 24 h after surgery. Statistical analysis: Student's t-test and Chi-square test, and linear regression models. A p-value 0.05. VAS at rest (TAP vs. TSI groups was: T1 = 33 ± 29 vs. 39 ± 32, T2 = 10 ± 9 vs. 17 ± 18 and T3 = 7 ± 12 vs. 10 ± 18. VAS with cough (TAP vs. TSI groups was: T1 = 51 ± 34 vs. 45 ± 32, T2 = 24 ± 24 vs. 33 ± 23 and T3 = 20 ± 23 vs. 23 ± 23. VAS with incentive spirometer (TAP vs. TSI groups was: T3 = 21 ± 27 vs. 21 ± 25. Intraoperative remifentanil consumption was similar between TAP (0.16 ± 0.07 mcg.kg−1.min−1 and TSI (0.18 ± 0.9 mcg.kg−1.min−1 groups. There were no differences in opioid consumption between TAP (4.4 ± 3.49 mg and TSI (6.87 ± 4.83 mg groups during recovery. Functional recovery parameters were not
Creep deformation behavior at long-term in P23/T23 steels
Energy Technology Data Exchange (ETDEWEB)
Sawada, K.; Tabuchi, M.; Kimura, K. [National Institute for Materials Science (Japan)
2008-07-01
Creep behavior of ASME P23/T23 steels was investigated and analyzed, focusing on creep strength degradation at long-term. Creep rupture strength at 625 C and 650 C dropped at long-term in both P23 and T23 steels. The stress exponent of minimum creep rate at 625 C and 650 C was 7.8-13 for higher stresses and 3.9-5.3 for lower stresses in the P23/T23 steels. The change of stress exponent with stress levels was consistent with the drop in creep rupture strength at long-term. The Monkman-Grant rule was confirmed in the range examined in P23 steel, while the data points deviated from the rule at long-term in the case of T23 steel. The creep ductility of P23 steel was high over a wide stress and temperature range. On the other hand, in T23 steel, creep ductility at 625 C and 650 C decreased as time to rupture increased. The change in ductility may cause the deviation from the Monkman-Grant rule. Fracture mode changed from transgranular to intergranular fracture in the long-term at 625 C and 650 C. (orig.)
Local Structure of Mn in (La1-xHox)2/3Ca1/3MnO3 Studied by X-ray Absorption Fine Structure
International Nuclear Information System (INIS)
Pietnoczka, A.; Bacewicz, R.; Antonowicz, J.; Zalewski, W.; Pekala, M.; Drozd, V.; Fagnard, J.F.; Vanderbemden, P.
2010-01-01
Results of X-ray absorption fine structure measurements in manganites (La 1-x Ho x ) 2/3 Ca 1/3 MnO 3 with 0.15 3 is doped with a divalent element such as Ca 2+ , substituting for La 3+ , holes are induced in the filled Mn d orbitals. This leads to a strong ferromagnetic coupling between Mn sites. Ca ions in La 1-x Ca x MnO 3 introduce a distortion of the crystal lattice and mixed valence Mn ions (Mn 3+ and Mn 4+ ). On the other hand, in manganites (La 1-x Ho x ) 2/3 Ca 1/3 MnO 3 the substitution of La for Ho causes a lattice distortion and induces a disorder, which reduces a magnetic interaction. The ferromagnetic transition temperature and conductivity decrease very quickly with increasing x. The magnetic and transport properties of compounds depend on the local atomic structure around Mn ions. The information on the bond lengths and Debye-Waller factor are obtained from the extended X-ray absorption fine structure (EXAFS) data analysis. The charge state of Mn is determined from the position of the absorption edge in X-ray absorption near edge structure (XANES) data. XAFS results are in good agreement with magnetic characteristics of the studied materials. (authors)
Are the users of social networking sites homogeneous? A cross-cultural study
Alarcón-del-Amo, María-del-Carmen; Gómez-Borja, Miguel-Ángel; Lorenzo-Romero, Carlota
2015-01-01
The growing use of Social Networking Sites (SNS) around the world has made it necessary to understand individuals' behaviors within these sites according to different cultures. Based on a comparative study between two different European countries (The Netherlands versus Spain), a comparison of typologies of networked Internet users has been obtained through a latent segmentation approach. These typologies are based on the frequency with which users perform different activities, their socio-demographic variables, and experience in social networking and interaction patterns. The findings show new insights regarding international segmentation in order to analyse SNS user behaviors in both countries. These results are relevant for marketing strategists eager to use the communication potential of networked individuals and for marketers willing to explore the potential of online networking as a low cost and a highly efficient alternative to traditional networking approaches. For most businesses, expert users could be valuable opinion leaders and potential brand influencers. PMID:26321971
Are the users of social networking sites homogeneous? A cross-cultural study.
Alarcón-Del-Amo, María-Del-Carmen; Gómez-Borja, Miguel-Ángel; Lorenzo-Romero, Carlota
2015-01-01
The growing use of Social Networking Sites (SNS) around the world has made it necessary to understand individuals' behaviors within these sites according to different cultures. Based on a comparative study between two different European countries (The Netherlands versus Spain), a comparison of typologies of networked Internet users has been obtained through a latent segmentation approach. These typologies are based on the frequency with which users perform different activities, their socio-demographic variables, and experience in social networking and interaction patterns. The findings show new insights regarding international segmentation in order to analyse SNS user behaviors in both countries. These results are relevant for marketing strategists eager to use the communication potential of networked individuals and for marketers willing to explore the potential of online networking as a low cost and a highly efficient alternative to traditional networking approaches. For most businesses, expert users could be valuable opinion leaders and potential brand influencers.
Are the users of Social Networking Sites homogeneous? A cross-cultural study
Directory of Open Access Journals (Sweden)
MARÍA-DEL-CARMEN eALARCÓN-DEL-AMO
2015-08-01
Full Text Available The growing use of Social Networking Sites (SNS around the world has made it necessary to understand individuals’ behaviours within these sites according to different cultures. Based on a comparative study between two different European countries (The Netherlands versus Spain, a comparison of typologies of networked Internet users has been obtained through a latent segmentation approach. These typologies are based on the frequency with which users perform different activities, their socio-demographic variables, and experience in social networking and interaction patterns. The findings show new insights regarding international segmentation in order to analyse SNS user behaviours in both countries. These results are relevant for marketing strategists eager to use the communication potential of networked individuals and for marketers willing to explore the potential of online networking as a low cost and a highly efficient alternative to traditional networking approaches. For most businesses, expert users could be valuable opinion leaders and potential brand influencers.
Web-site evaluation tools: a case study in reproductive health information.
Aslani, Azam; Pournik, Omid; Abu-Hanna, Ameen; Eslami, Saeid
2014-01-01
Internet forms an opportunity to inform, teach, and connect professionals and patients. However, much information on Internet is incomplete, inaccurate, or misleading, and not only in the medical domain. Because of the potential for damage from misleading and inaccurate health information, many organizations and individuals have published or implemented scoring tools for evaluating the appropriateness or quality of these resources. The objective of this study is to identify and summarize scoring tools that have evaluated web-sites providing reproductive health information in order to compare them and recommend an overarching evaluation tool. We searched Ovid MEDLINE(R) (1946 to July 2013) and OVID Embase (1980 to July 2013); and included English language studies that have evaluated the quality of websites providing reproductive health information. Studies only assessing the content of websites were excluded. We identified 5 scoring tools: 1-The HON (health on the net) Code of Conduct for medical and health Web sites, 2-Silberg scores, 3-Hogne Sandvik scale, 4-Jim Kapoun's Criteria for Evaluating Web Pages, and 5-The Health Information Technology Institute (HITI) criteria. We have compared these scales and identified 14 criteria: authorship, ownership, currency, objectivity/content, transparency/source, interactivity, privacy/ethics, financial disclosure, navigability/links, complementarity, advertising policy, design, quantity, and accessibility. We integrated these criteria and introduced a new tool with 10 criteria. Website evaluation tools differ in their evaluation criteria and there is a lack of consensus about which to use; therefore, an integrated easy to use set of criteria is needed.
Port-site infections by nontuberculous mycobacterium: A retrospective clinico-microbiological study
Directory of Open Access Journals (Sweden)
Roumi Ghosh
2017-01-01
Full Text Available Background: Port-site infection (PSI is a prevailing, chronic, nagging, treatment refractory complication of laparoscopic surgery (LS. It neutralizes the advantages of minimally invasive surgery and increases morbidity, treatment cost of patient, leading to loss of confidence on operating surgeon. PSIs are preventable with appropriate preoperative, intraoperative, and postoperative measures. Atypical mycobacterium is most commonly associated with nonhealing postlaparoscopic wound infections, causing outbreaks or sporadic cases worldwide. Purpose: We retrospectively studied the occurrence of nontuberculous mycobacterium (NTM from PSIs following LS that did not respond to antibiotics used for pyogenic infections and having sterile routine aerobic cultures and their antimicrobial susceptibility pattern to guide proper management. Methods: The study was done in a tertiary care hospital of Eastern India over a 1-year period which included PSI cases with delayed onset not responding to antibiotics, following different types of LS. Pus/discharge from 32 patients was collected and examined for isolation and identification of the causative agents. Gram stain and Ziehl–Neelsen staining methods were used for direct examination. Culture media included blood agar, Robertson's cooked meat broth, MacConkey agar, and Lowenstein–Jensen medium. Isolates from the cases were identified using biochemical tests or molecular methods and studied the antimicrobial susceptibility pattern by the standard microbiologic procedures. Results: Mycobacterium abscessus (13 and Mycobacterium fortuitum (2 were isolated from 15 serosanguinous drainage obtained from 32 cases by routine microbiological techniques. All isolates analyzed for antimicrobial susceptibility pattern were highly sensitive to clarithromycin (93.3%, amikacin (93.3%, and imipenem (80% but were variable to ciprofloxacin, ofloxacin, and linezolid. Conclusions: Our present study shows frequent association of
Bai, Jianwen; Shen, Zhenyao; Yan, Tiezhu
2017-09-01
An essential task in evaluating global water resource and pollution problems is to obtain the optimum set of parameters in hydrological models through calibration and validation. For a large-scale watershed, single-site calibration and validation may ignore spatial heterogeneity and may not meet the needs of the entire watershed. The goal of this study is to apply a multi-site calibration and validation of the Soil andWater Assessment Tool (SWAT), using the observed flow data at three monitoring sites within the Baihe watershed of the Miyun Reservoir watershed, China. Our results indicate that the multi-site calibration parameter values are more reasonable than those obtained from single-site calibrations. These results are mainly due to significant differences in the topographic factors over the large-scale area, human activities and climate variability. The multi-site method involves the division of the large watershed into smaller watersheds, and applying the calibrated parameters of the multi-site calibration to the entire watershed. It was anticipated that this case study could provide experience of multi-site calibration in a large-scale basin, and provide a good foundation for the simulation of other pollutants in followup work in the Miyun Reservoir watershed and other similar large areas.
Directory of Open Access Journals (Sweden)
Wiendu Nuryanti
2008-11-01
Full Text Available ABSTRAK Sebagai Warisan Budaya Dunia (World Culture Heritage yang ditetapkan oleh UNESCO pada tanggal 5 Desember 1996, Situs Sangiran merupakan bagian penting dalam sejarah manusia di dunia. Sesuai dengan keputusan Menteri Pendidikan dan Kebudayaan (Nomor 0701011977, situs tersebut telah ditetapkan sebagai cagar budaya (Widianto, et al.,1996. Penelitian ini memiliki dua tujuan utama: (1 menyusun konsepsi dasar pelestarian, dan (2 menyusun arahan desain (guidelines pelestarian Situs Sangiran. Permasalahan utama dari kajian ini adalah perubahan lahan karena faktor alam dan aktivitas manusia (pertanian, pembangunan, penambangan, ancaman pencurian, penggelapan, dan jual beli fosil, rendahnya partisipasi masyarakat dalam upaya pelestarian Situs Sangiran, dan belum adanya panduan/arahan pelestarian dan pemanfaatan wisata yang jelas. Dengan metoda kualitatif naturalistik, dihasilkan konsepsi (prinsip dasar pelestarian Situs Sangiran Sragen, dalanr masing-masing zona (zona I -3 sesuai dengan potensi tiap zona yang perlu dilestarikan dan dikernbangkan. Analisis yang digunakan dalam hal ini adalah analisis makro, meso, dan mikro. Dari kajian ini dapat disimpulkan bahwa dalam merencanakan pelestarian Situs Sangiran, hal terpenting adalah mentaati zonasi dasar situs, di mana setiap zona akan merniliki guidelines tersendiri. Guidelines terdiri atas pengembangan produk (Klaster Ngebung, Bukuran, Dayu, street furniture, serta pemberdayaan masyarakat. ABSTRACT UNESCO has established Sangiran Site as a World Culture Heritage in December 5th 1996. Its present is important to the history of mankind in the world. Widianto, et al., 1996, stated that Sangiran site has become a Cultural Site regarding to the declaration of Minister of Culture and Education (No. 070/0/1977. This Research has two main purposes, (1 to arrange a conception of basic preservation, and (2 to arrange a design guidelines of Sangiran Site Preservation. There are several major issues in
Feasibility study for the United Heckathorn Superfund Site, Richmond, California
Energy Technology Data Exchange (ETDEWEB)
Lincoff, A.H. [US Environmental Protection Agency, San Francisco, CA (United States). Region IX; Costan, G.P.; Montgomery, M.S.; White, P.J. [Pacific Northwest Lab., Richland, WA (United States)
1994-07-01
The United Heckathom Superfund Site in Richmond, California, was used to formulate pesticides from approximately 1947 to 1966. Soils at the site and sediments in the harbor were contaminated with various chlorinated pesticides, primarily DDT, as a result of these activities. The US Environmental Protection Agency listed the site on the Superfund National Priorities List in 1990. This document is part of the Remedial Investigation and Feasibility Study phase of the Superfund response, which will provide the basis for selection of a final remedy that will protect human health and the environment and achieve compliance with federal and state envirorunental laws.
Feasibility study for the United Heckathorn Superfund Site, Richmond, California
International Nuclear Information System (INIS)
Lincoff, A.H.
1994-07-01
The United Heckathom Superfund Site in Richmond, California, was used to formulate pesticides from approximately 1947 to 1966. Soils at the site and sediments in the harbor were contaminated with various chlorinated pesticides, primarily DDT, as a result of these activities. The US Environmental Protection Agency listed the site on the Superfund National Priorities List in 1990. This document is part of the Remedial Investigation and Feasibility Study phase of the Superfund response, which will provide the basis for selection of a final remedy that will protect human health and the environment and achieve compliance with federal and state envirorunental laws
International Nuclear Information System (INIS)
Tobiason, D. S.
2002-01-01
This Closure Report (CR) has been prepared for the Area 25 Contaminated Waste Dumps (CWD), Corrective Action Unit (CAU) 143 in accordance with the Federal Facility Agreement and Consent Order [FFACO] (FFACO, 1996) and the Nevada Division of Environmental Protection (NDEP)-approved Corrective Action Plan (CAP) for CAU 143: Area 25, Contaminated Waste Dumps, Nevada Test Site, Nevada. CAU 143 consists of two Corrective Action Sites (CASs): 25-23-09 CWD No.1, and 25-23-03 CWD No.2. The Area 25 CWDs are historic disposal units within the Area 25 Reactor Maintenance, Assembly, and Disassembly (R-MAD), and Engine Maintenance, Assembly, and Disassembly (E-MAD) compounds located on the Nevada Test Site (NTS). The R-MAD and E-MAD facilities originally supported a portion of the Nuclear Rocket Development Station in Area 25 of the NTS. CWD No.1 CAS 25-23-09 received solid radioactive waste from the R-MAD Compound (East Trestle and West Trench Berms) and 25-23-03 CWD No.2 received solid radioactive waste from the E-MAD Compound (E-MAD Trench)
Energy Technology Data Exchange (ETDEWEB)
Follin, Sven (SF GeoLogic AB, Taeby (Sweden)); Hartley, Lee; Jackson, Peter; Roberts, David (Serco TAP (United Kingdom)); Marsic, Niko (Kemakta Konsult AB, Stockholm (Sweden))
2008-05-15
Three versions of a site descriptive model (SDM) have been completed for the Forsmark area. Version 0 established the state of knowledge prior to the start of the site investigation programme. Version 1.1 was essentially a training exercise and was completed during 2004. Version 1.2 was a preliminary site description and concluded the initial site investigation work (ISI) in June 2005. Three modelling stages are planned for the complete site investigation work (CSI). These are labelled stage 2.1, 2.2 and 2.3, respectively. An important component of each of these stages is to address and continuously try to resolve discipline-specific uncertainties of importance for repository engineering and safety assessment. Stage 2.1 included an updated geological model for Forsmark and aimed to provide a feedback from the modelling working group to the site investigation team to enable completion of the site investigation work. Stage 2.2 described the conceptual understanding and the numerical modelling of the bedrock hydrogeology in the Forsmark area based on data freeze 2.2. The present report describes the modelling based on data freeze 2.3, which is the final data freeze in Forsmark. In comparison, data freeze 2.3 is considerably smaller than data freeze 2.2. Therefore, stage 2.3 deals primarily with model confirmation and uncertainty analysis, e.g. verification of important hypotheses made in stage 2.2 and the role of parameter uncertainty in the numerical modelling. On the whole, the work reported here constitutes an addendum to the work reported in stage 2.2. Two changes were made to the CONNECTFLOW code in stage 2.3. These serve to: 1) improve the representation of the hydraulic properties of the regolith, and 2) improve the conditioning of transmissivity of the deformation zones against single-hole hydraulic tests. The changes to the modelling of the regolith were made to improve the consistency with models made with the MIKE SHE code, which involved the introduction
Ece, Ilhan; Yilmaz, Huseyin; Alptekin, Husnu; Yormaz, Serdar; Colak, Bayram; Sahin, Mustafa
2018-03-01
Port site hernia (PSH) following laparoscopic procedures is a rare but serious complication. The aim of this study was to evaluate the rate of PSH after laparoscopic sleeve gastrectomy (LSG), and the efficacy of closure of the port site as a means of preventing PSH. A retrospective analysis was performed on 386 patients who underwent LSG between December 2009 and January 2015. 352 (91.2%) of the patient were followed up for at least 24 months. In the first 206 patients, the fascial layers of the trocar incisions were not closed, while in the next 146 cases, routine closure of the trocar sites was performed. The patients were reviewed in relation to demographics, comorbidities, complications, percentage of excess weight loss, and rates of PSH. The total cohort consisted of 220 female and 132 male patients with a mean age of 36.2 ± 12.3 years. Demographic data, initial BMI, and comorbidities were similar for the patients in both groups. The closure of the fascia was caused by the prolonged duration of the operation with no significant difference. The unclosed fascial defects were associated with a significantly increased incidence of PSH (1.3 vs. 3.9%, p port sites may result in a decreased PSH rate.
Price, V.; Temples, T.; Hodges, R.; Dai, Z.; Watkins, D.; Imrich, J.
2007-01-01
This document discusses results of applying the Integrated Ground-Water Monitoring Strategy (the Strategy) to actual waste sites using existing field characterization and monitoring data. The Strategy is a systematic approach to dealing with complex sites. Application of such a systematic approach will reduce uncertainty associated with site analysis, and therefore uncertainty associated with management decisions about a site. The Strategy can be used to guide the development of a ground-water monitoring program or to review an existing one. The sites selected for study fall within a wide range of geologic and climatic settings, waste compositions, and site design characteristics and represent realistic cases that might be encountered by the NRC. No one case study illustrates a comprehensive application of the Strategy using all available site data. Rather, within each case study we focus on certain aspects of the Strategy, to illustrate concepts that can be applied generically to all sites. The test sites selected include:Charleston, South Carolina, Naval Weapons Station,Brookhaven National Laboratory on Long Island, New York,The USGS Amargosa Desert Research Site in Nevada,Rocky Flats in Colorado,C-Area at the Savannah River Site in South Carolina, andThe Hanford 300 Area.A Data Analysis section provides examples of detailed data analysis of monitoring data.
Reading level of privacy policies on Internet health Web sites.
Graber, Mark A; D'Alessandro, Donna M; Johnson-West, Jill
2002-07-01
Most individuals would like to maintain the privacy of their medical information on the World Wide Web (WWW). In response, commercial interests and other sites post privacy policies that are designed to inform users of how their information will be used. However, it is not known if these statements are comprehensible to most WWW users. The purpose of this study was to determine the reading level of privacy statements on Internet health Web sites and to determine whether these statements can inform users of their rights. This was a descriptive study. Eighty Internet health sites were examined and the readability of their privacy policies was determined. The selected sample included the top 25 Internet health sites as well as other sites that a user might encounter while researching a common problem such as high blood pressure. Sixty percent of the sites were commercial (.com), 17.5% were organizations (.org), 8.8% were from the United Kingdom (.uk), 3.8% were United States governmental (.gov), and 2.5% were educational (.edu). The readability level of the privacy policies was calculated using the Flesch, the Fry, and the SMOG readability levels. Of the 80 Internet health Web sites studied, 30% (including 23% of the commercial Web sites) had no privacy policy posted. The average readability level of the remaining sites required 2 years of college level education to comprehend, and no Web site had a privacy policy that was comprehensible by most English-speaking individuals in the United States. The privacy policies of health Web sites are not easily understood by most individuals in the United States and do not serve to inform users of their rights. Possible remedies include rewriting policies to make them comprehensible and protecting online health information by using legal statutes or standardized insignias indicating compliance with a set of privacy standards (eg, "Health on the Net" [HON] http://www.hon.ch).
Use of Facebook: A Case Study of Singapore Students' Experience
Hew, Khe Foon; Cheung, Wing Sum
2012-01-01
Facebook has become one of the most popular social network sites among many students. However, current research on Facebook use has focused mainly on Anglo-American students. Relatively little is known about Facebook use in Singapore. Data were collected from 83 students (ages ranged from 15 to 23). This study uses a naturalistic case study…
An economic study of the site of Marcoule; Etude economique du site de Marcoule
Energy Technology Data Exchange (ETDEWEB)
Duprat, H [Commissariat a l' Energie Atomique, Marcoule (France). Centre d' Etudes Nucleaires
1964-07-01
The study of this site of the Marcoule Center shows that its regional economical influence is limited to the buying power distributed among its personnel. This entails distortions between first this supplementary buying power and the overall markets within the possible Marcoule influence zone, and secondly the concentration on Bagnols-sur-Ceze and this town's normal extension possibilities. (author) [French] L'etude du site de Marcoule demontre que son influence economique se limite, pour la region, au pouvoir d'achat distribue a son personnel. Ceci entraine une disproportion d'une part entre ce pouvoir d'achat supplementaire et l'ensemble des marches contenus dans l'aire d'influence possible de Marcoule, d'autre part entre la concentration realisee a Bagnole-sur-Ceze et la capacite d'extension normale de cette agglomeration. (auteur)
Energy Technology Data Exchange (ETDEWEB)
Salasovich, J.; Geiger, J.; Healey, V.; Mosey, G.
2013-04-01
The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Brisbane Baylands site in Brisbane, California, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.
Directory of Open Access Journals (Sweden)
Mike Serrato
2012-01-01
Full Text Available This study investigated the usability of hyperspectral remote sensing for characterizing vegetation at hazardous waste sites. The specific objectives of this study were to: (1 estimate leaf-area-index (LAI of the vegetation using three different methods (i.e., vegetation indices, red-edge positioning (REP, and machine learning regression trees, and (2 map the vegetation cover using machine learning decision trees based on either the scaled reflectance data or mixture tuned matched filtering (MTMF-derived metrics and vegetation indices. HyMap airborne data (126 bands at 2.3 × 2.3 m spatial resolution, collected over the U.S. Department of Energy uranium processing sites near Monticello, Utah and Monument Valley, Arizona, were used. Grass and shrub species were mixed on an engineered disposal cell cover at the Monticello site while shrub species were dominant in the phytoremediation plantings at the Monument Valley site. Regression trees resulted in the best calibration performance of LAI estimation (R2 > 0.80. The use of REPs failed to accurately predict LAI (R2 < 0.2. The use of the MTMF-derived metrics (matched filter scores and infeasibility and a range of vegetation indices in decision trees improved the vegetation mapping when compared to the decision tree classification using just the scaled reflectance. Results suggest that hyperspectral imagery are useful for characterizing biophysical characteristics (LAI and vegetation cover on capped hazardous waste sites. However, it is believed that the vegetation mapping would benefit from the use of higher spatial resolution hyperspectral data due to the small size of many of the vegetation patches ( < 1 m found on the sites.
Boehm, M K; Corper, A L; Wan, T; Sohi, M K; Sutton, B J; Thornton, J D; Keep, P A; Chester, K A; Begent, R H; Perkins, S J
2000-03-01
MFE-23 is the first single-chain Fv antibody molecule to be used in patients and is used to target colorectal cancer through its high affinity for carcinoembryonic antigen (CEA), a cell-surface member of the immunoglobulin superfamily. MFE-23 contains an N-terminal variable heavy-chain domain joined by a (Gly(4)Ser)(3) linker to a variable light-chain (V(L)) domain (kappa chain) with an 11-residue C-terminal Myc-tag. Its crystal structure was determined at 2.4 A resolution by molecular replacement with an R(cryst) of 19.0%. Five of the six antigen-binding loops, L1, L2, L3, H1 and H2, conformed to known canonical structures. The sixth loop, H3, displayed a unique structure, with a beta-hairpin loop and a bifurcated apex characterized by a buried Thr residue. In the crystal lattice, two MFE-23 molecules were associated back-to-back in a manner not seen before. The antigen-binding site displayed a large acidic region located mainly within the H2 loop and a large hydrophobic region within the H3 loop. Even though this structure is unliganded within the crystal, there is an unusually large region of contact between the H1, H2 and H3 loops and the beta-sheet of the V(L) domain of an adjacent molecule (strands DEBA) as a result of intermolecular packing. These interactions exhibited remarkably high surface and electrostatic complementarity. Of seven MFE-23 residues predicted to make contact with antigen, five participated in these lattice contacts, and this model for antigen binding is consistent with previously reported site-specific mutagenesis of MFE-23 and its effect on CEA binding.
Directory of Open Access Journals (Sweden)
S. M. Issa
2012-07-01
Full Text Available Landfill sites receive 92% of total annual solid waste produced by municipalities in the emirate of Abu Dhabi. In this study, candidate sites for an appropriate landfill location for the Abu Dhabi municipal area are determined by integrating geographic information systems (GIS and multi-criteria evaluation (MCE analysis. To identify appropriate landfill sites, eight input map layers including proximity to urban areas, proximity to wells and water table depth, geology and topography, proximity to touristic and archeological sites, distance from roads network, distance from drainage networks, and land slope are used in constraint mapping. A final map was generated which identified potential areas showing suitability for the location of the landfill site. Results revealed that 30% of the study area was identified as highly suitable, 25% as suitable, and 45% as unsuitable. The selection of the final landfill site, however, requires further field research.
Fiscal impacts associated with power reactor siting: a paired case study
Energy Technology Data Exchange (ETDEWEB)
Bjornstad, D.J.
1977-01-19
The paper examines the fiscal impacts associated with siting nuclear-powered electrical stations. First, a framework for examining fiscal impacts is constructed. This framework consists of four elements: the ability of a local community to raise revenues, the degree to which this ability is used, the uses to which tax revenues are applied, and the effect of tax/expenditure decisions on the local economy. Changes in these four elements caused by the siting are termed fiscal impacts. Second, this framework is applied to two communities, Waterford, Connecticut and Plymouth, Massachusetts, which host operating reactors. In each community the ability to raise revenues through the property tax--the prime local revenue source--approximately doubled. As a result both communities chose ultimately to reduce tax rates. Moreover, it appears that the annual revenues raised through the public sector as a result of the reactor siting exceeded income changes that resulted from increased local employment associated with each reactor's operation. It therefore appears that for these two towns, the primary economic impact occurred through the public sector. The report concludes with suggestions for further research into local fiscal and economic effects associated with power reactor siting.
Fiscal impacts associated with power reactor siting: a paired case study
International Nuclear Information System (INIS)
Bjornstad, D.J.
1977-01-01
The paper examines the fiscal impacts associated with siting nuclear-powered electrical stations. First, a framework for examining fiscal impacts is constructed. This framework consists of four elements: the ability of a local community to raise revenues, the degree to which this ability is used, the uses to which tax revenues are applied, and the effect of tax/expenditure decisions on the local economy. Changes in these four elements caused by the siting are termed fiscal impacts. Second, this framework is applied to two communities, Waterford, Connecticut and Plymouth, Massachusetts, which host operating reactors. In each community the ability to raise revenues through the property tax--the prime local revenue source--approximately doubled. As a result both communities chose ultimately to reduce tax rates. Moreover, it appears that the annual revenues raised through the public sector as a result of the reactor siting exceeded income changes that resulted from increased local employment associated with each reactor's operation. It therefore appears that for these two towns, the primary economic impact occurred through the public sector. The report concludes with suggestions for further research into local fiscal and economic effects associated with power reactor siting
Wu, Wenjuan; Liu, Sheng; Ruwe, Hannes; Zhang, Delin; Melonek, Joanna; Zhu, Yajuan; Hu, Xupeng; Gusewski, Sandra; Yin, Ping; Small, Ian D; Howell, Katharine A; Huang, Jirong
2016-03-01
Ribosomal RNA processing is essential for plastid ribosome biogenesis, but is still poorly understood in higher plants. Here, we show that SUPPRESSOR OF THYLAKOID FORMATION1 (SOT1), a plastid-localized pentatricopeptide repeat (PPR) protein with a small MutS-related domain, is required for maturation of the 23S-4.5S rRNA dicistron. Loss of SOT1 function leads to slower chloroplast development, suppression of leaf variegation, and abnormal 23S and 4.5S processing. Predictions based on the PPR motif sequences identified the 5' end of the 23S-4.5S rRNA dicistronic precursor as a putative SOT1 binding site. This was confirmed by electrophoretic mobility shift assay, and by loss of the abundant small RNA 'footprint' associated with this site in sot1 mutants. We found that more than half of the 23S-4.5S rRNA dicistrons in sot1 mutants contain eroded and/or unprocessed 5' and 3' ends, and that the endonucleolytic cleavage product normally released from the 5' end of the precursor is absent in a sot1 null mutant. We postulate that SOT1 binding protects the 5' extremity of the 23S-4.5S rRNA dicistron from exonucleolytic attack, and favours formation of the RNA structure that allows endonucleolytic processing of its 5' and 3' ends. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.
Impact of Annexin A 7 Deficiency on FGF23 Plasma Concentrations
Directory of Open Access Journals (Sweden)
Anja T. Umbach
2016-11-01
Full Text Available Background/Aims: The release of fibroblast growth factor FGF23, a powerful regulator of 1,25(OH2D3 formation and mineral metabolism, is stimulated by store-operated Ca2+ entry (SOCE, which is accomplished by the pore forming Ca2+ release activated channel protein Orai1. Regulators of Orai1 and thus FGF23 release include serum & glucocorticoid inducible kinase SGK1, a kinase up-regulated by glucocorticosteroids. Some effects of glucocorticoids require the presence of annexin A7, such as suppression of prostaglandin E2 in gastric glands. The present study thus explored whether annexin A7 impacts on FGF23 plasma levels. Methods: Comparisons were made between gene targeted mice lacking functional annexin A7 (Anx7-/- and their wild type littermates (Anx7+/+. Serum C-terminal-FGF23, intact FGF23, 1,25(OH2D3 and PTH concentrations were measured by ELISA or EIA. The serum and urinary phosphate concentrations were measured by colorimetry, the serum Ca2+ concentration and the urinary Ca2+ concentration by flame photometry. Results: Serum C-terminal FGF23 levels and corticosterone levels were significantly higher and serum 1,25(OH2 D3 and PTH levels were significantly lower in Anx7-/- than in Anx7+/+ mice. Water intake was slightly but significantly higher in Anx7-/- mice than in Anx7+/+ mice. No significant difference was observed between Anx7-/- and Anx7+/+ mice in urinary fluid excretion, plasma Ca2+ concentration, plasma phosphate concentration and urinary Ca2+ output. The urinary phosphate output was significantly lower in Anx7-/- mice than in Anx7+/+ mice. Conclusion: Annexin A7 deficiency upregulates FGF23 plasma levels, an effect paralleled by increased corticosterone plasma levels, as well as decreased 1,25(OH2 D3 and PTH plasma levels.
International Nuclear Information System (INIS)
Liu, L.; Fuller, G.A.; Huang, G.H.
1999-01-01
Contamination of soil and water and the resulting threat to public health and the environment are the frequent results of oil spills, leaks and other releases of gasoline, diesel fuel, heating oil and other petroleum products. Integrating an analytical groundwater solute transport model within its general framework, this paper proposes an integrated stochastic risk assessment method and ways to apply it to petroleum-contaminated sites. Both the analytical solute transport model and the general risk assessment framework are solved by the Monte Carlo simulation technique for approaching the theoretical output distribution. Results of this study show that the total cancer risk has approximately log-normal distribution, irrespective of the fact that a variety of distributions were used to define the related parameters. It is claimed that the method can improve the effectiveness of the risk assessment for subsurface, and provide useful result for site remediation decisions. 23 refs., 3 tabs., 4 figs
Enhanced On-Site Waste Management of Plasterboard in Construction Works: A Case Study in Spain
Directory of Open Access Journals (Sweden)
Ana Jiménez-Rivero
2017-03-01
Full Text Available On-site management of construction waste commonly determines its destination. In the case of plasterboard (PB, on-site segregation becomes crucial for closed-loop recycling. However, PB is commonly mixed with other wastes in Spain. In this context, the involvement of stakeholders that can contribute to reversing this current situation is needed. This paper analyzes on-site waste management of PB in Spain through a pilot study of a construction site, with the main objective of identifying best practices to increase waste prevention, waste minimization, and the recyclability of the waste. On-site visits and structured interviews were conducted. The results show five management stages: PB distribution (I; PB installation (II; Construction waste storage at the installation area (III; PB waste segregation at the installation area (IV and PB waste transfer to the PB container and storage (V. The proposed practices refer to each stage and include the merging of Stages III and IV. This measure would avoid the mixing of waste fractions in Stage III, maximizing the recyclability of PB. In addition, two requisites for achieving enhanced management are analyzed: ‘Training and commitment’ and ‘fulfilling the requirements established by the current regulation’. The results show that foremen adopted a more pessimistic attitude than installers towards a joint commitment for waste management. Moreover, not all supervisors valued the importance of a site waste management plan, regulated by the Royal Decree 105/2008 in Spain.
Molle, Céline; Zhang, Tong; Ysebrant de Lendonck, Laure; Gueydan, Cyril; Andrianne, Mathieu; Sherer, Félicie; Van Simaeys, Gaetan; Blackshear, Perry J; Leo, Oberdan; Goriely, Stanislas
2013-08-26
Interleukin (IL) 12 and IL23 are two related heterodimeric cytokines produced by antigen-presenting cells. The balance between these two cytokines plays a crucial role in the control of Th1/Th17 responses and autoimmune inflammation. Most studies focused on their transcriptional regulation. Herein, we explored the role of the adenine and uridine-rich element (ARE)-binding protein tristetraprolin (TTP) in influencing mRNA stability of IL12p35, IL12/23p40, and IL23p19 subunits. LPS-stimulated bone marrow-derived dendritic cells (BMDCs) from TTP(-/-) mice produced normal levels of IL12/23p40. Production of IL12p70 was modestly increased in these conditions. In contrast, we observed a strong impact of TTP on IL23 production and IL23p19 mRNA stability through several AREs in the 3' untranslated region. TTP(-/-) mice spontaneously develop an inflammatory syndrome characterized by cachexia, myeloid hyperplasia, dermatitis, and erosive arthritis. We observed IL23p19 expression within skin lesions associated with exacerbated IL17A and IL22 production by infiltrating γδ T cells and draining lymph node CD4 T cells. We demonstrate that the clinical and immunological parameters associated with TTP deficiency were completely dependent on the IL23-IL17A axis. We conclude that tight control of IL23 mRNA stability by TTP is critical to avoid severe inflammation.
International Nuclear Information System (INIS)
Farhatullah, N.K.; Khalil, I.H.; Nahed, H.
2015-01-01
Higher heritability estimates along with high genetic advance values are effective in envisaging gain under selection in developing genotypes. The objective of the present study was to evaluate variability, heritability and genetic advance in 10 interspecific F2-3 families of Brassica species (B. napus * B. juncea, B. napus * B. rapa). These families were studied for heterospecific introgression of biochemical traits. Low to high heritability estimates were recorded for seed quality traits. Considerable variations within F2-3 families were observed for biochemical traits. Most of the F2-3 families for oil content and erucic showed moderate to high heritability indicating the slightest influence of environment thus modification of trait by selection would be more effective. Among F2-3 introgressed families Bn-510 x Bj-109 produced high oil i.e., 49.5% while Bn-532 x Br-118 (24.4%), Bn-533 x Bj-109 (24.1%) and high protein percentage in terms of mean performance. In the present research, individual segregating progenies of interspecific cross populations i.e., which possessed combination of desirable traits, were identified which could be incorporated in the future Breeding programs and it may facilitate varietal development. (author)
Energy Technology Data Exchange (ETDEWEB)
Rios R, C.H.; Romero R, M. [Universidad Autonoma Metropolitana-Azcapotzalco, Departamento de Materiales, Av. San Pablo 180, Col. Reynosa Tamaulipas, 02200 Mexico D.F. (Mexico); Ponce R, A.; Mendoza H, L.H. [Universidad Autonoma del Estado de Hidalgo, Centro de Investigaciones Quimicas, Carretera Pachuca-Tulancingo km. 4.5, 42181 Pachuca, Hidalgo (Mexico)]. e-mail: clara_hrr@yahoo.es
2008-07-01
In this work, it is shown a theoretical quantum study of the active sites distribution on a monocrystalline surface of Cu(100). The copper surface was modeled as finite clusters of 14, 23, 38 and 53 atoms. We performed Hartree-Fock and Density Functional Theory (B3LYP) ab initio calculations employing the pseudopotentials of Hay and Wadt (LANLlMB y LANL2DZ). From calculations, we found a work function value of 4.1 eV. The mapping of the HOMO and LUMO in the frozen core approximation, allowed us finding the electrophilic and nucleophilic active sites distribution, respectively. The results indicated that electrophilic sites on the Cu(100) surface were located on hollow position and its numerical density was 8.6 x 10{sup 16} sites cm{sup -2}. From the nucleophilic local softness study, it was found that the nucleophilic sites were formed by a group of atoms and it had a numerical density of 2.4x 10{sup 16} sitescm{sup -2} . Last results indicated that adsorptions with 2 x 2 and 3 x 3 distributions can be favored onto a Cu(100) surface for the electrophilic and nucleophilic cases, respectively. (Author)
Risk factors for delayed healing at the free anterolateral thigh flap donor site
Directory of Open Access Journals (Sweden)
Yoshiro Abe
2018-01-01
Full Text Available Background The free anterolateral thigh (ALT flap has been widely used for various kinds of reconstructions. However, delayed healing at the donor site occasionally occurs due to wound dehiscence or the partial loss of grafted skin at the donor site. The aim of the present study was to identify reliable predictive factors for delayed healing at the donor site after the harvest of a free ALT flap. Methods This study included 52 patients who underwent reconstructive procedures using free ALT flaps. The delayed healing group included patients with wounds at the donor site that had not healed over 3 weeks after surgery, and the normal healing group included patients who showed wound healing within 3 weeks after surgery. Multivariate logistic regression models were created to identify the risk factors for delayed healing at the ALT flap donor site. Results Among the 52 patients, 24 (46.2% showed delayed healing at the donor site, and 6 patients required additional operative treatment. A high preoperative body mass index (BMI, smoking, and skin grafting were found to be significantly associated with delayed healing at the ALT donor site. Of the 37 patients who underwent skin grafting, 23 (62% experienced delayed healing at the donor site. Conclusions A high preoperative BMI, smoking, and skin grafting were risk factors for delayed healing at the free ALT donor site. Skin grafting at the ALT donor site should be avoided in patients with a high BMI or a habit of smoking.
A case study of optimization in the decision process: Siting groundwater monitoring wells
International Nuclear Information System (INIS)
Cardwell, H.; Huff, D.; Douthitt, J.; Sale, M.
1993-12-01
Optimization is one of the tools available to assist decision makers in balancing multiple objectives and concerns. In a case study of the siting decision for groundwater monitoring wells, we look at the influence of the optimization models on the decisions made by the responsible groundwater specialist. This paper presents a multi-objective integer programming model for determining the location of monitoring wells associated with a groundwater pump-and-treat remediation. After presenting the initial optimization results, we analyze the actual decision and revise the model to incorporate elements of the problem that were later identified as important in the decision-making process. The results of a revised model are compared to the actual siting plans, the recommendations from the initial optimization runs, and the initial monitoring network proposed by the decision maker
Majumdar, Ankush; Hazra, Tumpa; Dutta, Amit
2017-09-01
This work presents a Multi-criteria Decision Making (MCDM) tool to select a landfill site from three candidate sites proposed for Kolkata Municipal Corporation (KMC) area that complies with accessibility, receptor, environment, public acceptability, geological and economic criteria. Analytical Hierarchy Process has been used to solve the MCDM problem. Suitability of the three sites (viz. Natagachi, Gangajoara and Kharamba) as landfills as proposed by KMC has been checked by Landfill Site Sensitivity Index (LSSI) as well as Economic Viability Index (EVI). Land area availability for disposing huge quantity of Municipal Solid Waste for the design period has been checked. Analysis of the studied sites show that they are moderately suitable for landfill facility construction as both LSSI and EVI scores lay between 300 and 750. The proposed approach represents an effective MCDM tool for siting sanitary landfill in growing metropolitan cities of developing countries like India.
Directory of Open Access Journals (Sweden)
Zhongyuan Deng
2018-01-01
Full Text Available The link between polyadenylation (pA and various biological, behavioral, and pathological events of eukaryotes underlines the need to develop in vivo polyadenylation assay methods for characterization of the cis-acting elements, trans-acting factors and environmental stimuli that affect polyadenylation efficiency and/or relative usage of two alternative polyadenylation (APA sites. The current protein-based CAT or luciferase reporter systems can measure the polyadenylation efficiency of a single pA site or candidate cis element but not the choice of two APA sites. To address this issue, we developed a set of four new bicistronic reporter vectors that harbor either two luciferase or fluorescence protein open reading frames connected with one Internal Ribosome Entry Site (IRES. Transfection of single or dual insertion constructs of these vectors into mammalian cells demonstrated that they could be utilized not only to quantify the strength of a single candidate pA site or cis element, but also to accurately measure the relative usage of two APA sites at both the mRNA (qRT-PCR and protein levels. This represents the first reporter system that can study polyadenylation efficiency of a single pA site or element and regulation of two APA sites at both the mRNA and protein levels.
SABER: a computational method for identifying active sites for new reactions.
Nosrati, Geoffrey R; Houk, K N
2012-05-01
A software suite, SABER (Selection of Active/Binding sites for Enzyme Redesign), has been developed for the analysis of atomic geometries in protein structures, using a geometric hashing algorithm (Barker and Thornton, Bioinformatics 2003;19:1644-1649). SABER is used to explore the Protein Data Bank (PDB) to locate proteins with a specific 3D arrangement of catalytic groups to identify active sites that might be redesigned to catalyze new reactions. As a proof-of-principle test, SABER was used to identify enzymes that have the same catalytic group arrangement present in o-succinyl benzoate synthase (OSBS). Among the highest-scoring scaffolds identified by the SABER search for enzymes with the same catalytic group arrangement as OSBS were L-Ala D/L-Glu epimerase (AEE) and muconate lactonizing enzyme II (MLE), both of which have been redesigned to become effective OSBS catalysts, demonstrated by experiments. Next, we used SABER to search for naturally existing active sites in the PDB with catalytic groups similar to those present in the designed Kemp elimination enzyme KE07. From over 2000 geometric matches to the KE07 active site, SABER identified 23 matches that corresponded to residues from known active sites. The best of these matches, with a 0.28 Å catalytic atom RMSD to KE07, was then redesigned to be compatible with the Kemp elimination using RosettaDesign. We also used SABER to search for potential Kemp eliminases using a theozyme predicted to provide a greater rate acceleration than the active site of KE07, and used Rosetta to create a design based on the proteins identified. Copyright © 2012 The Protein Society.
Energy Technology Data Exchange (ETDEWEB)
Grant Evenson
2012-05-01
Corrective Action Unit (CAU) 550 is located in Areas 7, 8, and 10 of the Nevada National Security Site, which is approximately 65 miles northwest of Las Vegas, Nevada. CAU 550, Smoky Contamination Area, comprises 19 corrective action sites (CASs). Based on process knowledge of the releases associated with the nuclear tests and radiological survey information about the location and shape of the resulting contamination plumes, it was determined that some of the CAS releases are co-located and will be investigated as study groups. This document describes the planned investigation of the following CASs (by study group): (1) Study Group 1, Atmospheric Test - CAS 08-23-04, Atmospheric Test Site T-2C; (2) Study Group 2, Safety Experiments - CAS 08-23-03, Atmospheric Test Site T-8B - CAS 08-23-06, Atmospheric Test Site T-8A - CAS 08-23-07, Atmospheric Test Site T-8C; (3) Study Group 3, Washes - Potential stormwater migration of contaminants from CASs; (4) Study Group 4, Debris - CAS 08-01-01, Storage Tank - CAS 08-22-05, Drum - CAS 08-22-07, Drum - CAS 08-22-08, Drums (3) - CAS 08-22-09, Drum - CAS 08-24-03, Battery - CAS 08-24-04, Battery - CAS 08-24-07, Batteries (3) - CAS 08-24-08, Batteries (3) - CAS 08-26-01, Lead Bricks (200) - CAS 10-22-17, Buckets (3) - CAS 10-22-18, Gas Block/Drum - CAS 10-22-19, Drum; Stains - CAS 10-22-20, Drum - CAS 10-24-10, Battery. These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). Additional information will be obtained by conducting a corrective action investigation before evaluating CAAs and selecting the appropriate corrective action for each study group. The results of the field investigation will support a defensible evaluation of viable CAAs that will be presented in the Corrective Action Decision Document. The sites will be investigated based on the data quality objectives (DQOs) developed
Energy Technology Data Exchange (ETDEWEB)
Spencer, James; Murphy, Loretta M.; Conners, Rebecca; Sessions, Richard B.; Gamblin, Steven J. (Wales); (Bristol Med Sci); (NIMR)
2010-09-21
Pseudomonas aeruginosa is an opportunist Gram-negative bacterial pathogen responsible for a wide range of infections in immunocompromized individuals and is a leading cause of mortality in cystic fibrosis patients. A number of secreted virulence factors, including various proteolytic enzymes, contribute to the establishment and maintenance of Pseudomonas infection. One such is LasA, an M23 metallopeptidase related to autolytic glycylglycine endopeptidases such as Staphylococcus aureus lysostaphin and LytM, and to DD-endopeptidases involved in entry of bacteriophage to host bacteria. LasA is implicated in a range of processes related to Pseudomonas virulence, including stimulating ectodomain shedding of the cell surface heparan sulphate proteoglycan syndecan-1 and elastin degradation in connective tissue. Here we present crystal structures of active LasA as a complex with tartrate and in the uncomplexed form. While the overall fold resembles that of the other M23 family members, the LasA active site is less constricted and utilizes a different set of metal ligands. The active site of uncomplexed LasA contains a five-coordinate zinc ion with trigonal bipyramidal geometry and two metal-bound water molecules. Using these structures as a starting point, we propose a model for substrate binding by LasA that explains its activity against a wider range of substrates than those used by related lytic enzymes, and offer a catalytic mechanism for M23 metallopeptidases consistent with available structural and mutagenesis data. Our results highlight how LasA is a structurally distinct member of this endopeptidase family, consistent with its activity against a wider range of substrates and with its multiple roles in Pseudomonas virulence.
International Nuclear Information System (INIS)
Johannsen, Peter
1997-01-01
attention as hypothesized by Mesulam stating that the parietal cortex is polymodal, receiving input from the primary cortices of all sensory modalities. Thus, the parietal attention site is not only involved in visual spatial selective attention as claimed by some research groups. My data also indicate that the parietal attention site is organized in a 'homunculus-like' fashion, similar to the cortical connections in the Macaque monkey. In the Alzheimer patients, the primary sensory stimulations elicited an altered pattern with activation of medial frontal structures in additional to the expected activations of the primary sensory cortices. During sustained attention the patients had a tendency to activate the same attention sites as the healthy elderly, but in addition significant deactivations were noted in the left and right medial and left superior frontal gyri (Brodmann Area 10), and the right posterior cingulate gyrus (Brodmann Area 23/31). During divided attention the activation pattern in the patients was very different from that of the healthy elderly. The right medial frontal gyrus (Broadmann Area 32) was activated but not the right-sided parietal or the frontal attention sites. Deactivations were seen in the right cuneus and putamen. The different activation patterns elicited by sustained and divided attention in the Alzheimer patients provide evidence of differential deficits in two attention sbutypes in Alzheimer's disease, as reported in neuropsychological studies. The resting rCBF deficits and the altered cortical activation patterns during attention in the Alzheimer patients indicate that Alzheimer's disease is the result of a specific pathophysiological process with distinct and localized lesions indicating that the disease is not a diffuse and global brain disease. The results further support the disconnection hypothesis of Alzheimer's disease wich consider the disorder as a neocortical isolationsyndrome created by a disease process that spreads along
Webs sites of women`s studies universitary centers in spain: selection and evaluation
Directory of Open Access Journals (Sweden)
Isabel de Torres Ramírez
2006-12-01
Full Text Available After a brief introduction about the level of development of Women’s Studies in Spain and a list of their parent university institutions, Women’s Studies Web sites are assessed by measuring their usability. The aim is to improve use and accessibility of existing Web sites and, above all, provide encouragement and a model to follow by future Web sites in this area.
Site classification of Indian strong motion network using response spectra ratios
Chopra, Sumer; Kumar, Vikas; Choudhury, Pallabee; Yadav, R. B. S.
2018-03-01
In the present study, we tried to classify the Indian strong motion sites spread all over Himalaya and adjoining region, located on varied geological formations, based on response spectral ratio. A total of 90 sites were classified based on 395 strong motion records from 94 earthquakes recorded at these sites. The magnitude of these earthquakes are between 2.3 and 7.7 and the hypocentral distance for most of the cases is less than 50 km. The predominant period obtained from response spectral ratios is used to classify these sites. It was found that the shape and predominant peaks of the spectra at these sites match with those in Japan, Italy, Iran, and at some of the sites in Europe and the same classification scheme can be applied to Indian strong motion network. We found that the earlier schemes based on description of near-surface geology, geomorphology, and topography were not able to capture the effect of sediment thickness. The sites are classified into seven classes (CL-I to CL-VII) with varying predominant periods and ranges as proposed by Alessandro et al. (Bull Seismol Soc Am 102:680-695 2012). The effect of magnitudes and hypocentral distances on the shape and predominant peaks were also studied and found to be very small. The classification scheme is robust and cost-effective and can be used in region-specific attenuation relationships for accounting local site effect.
Leone, James E
2009-05-01
We describe a 23-year-old woman with muscle dysmorphia symptomatology and extreme drive for muscularity. In addition to structured case study interviews, 3 questionnaires and a series of semistructured interview questions were administered for elaboration on key issues. The case studies allowed for triangulation of data garnered from the questionnaires. Responses revealed high scores for drive for muscularity, moderate scores for the Adonis complex, and high scores for symptoms of muscle dysmorphia. Muscle dysmorphia and drive for muscularity are more prevalent in men; however, unique cases such as this need to be further explored both empirically and theoretically. Cross-cultural references are needed to assess the overall impact of global social influences. Instruments measuring muscle dysmorphia need to be devised and validated for women as well as men. The strength and conditioning professional needs to be both aware and vigilant in helping people affected with psychosomatic disorders such as muscle dysmorphia or exercise addiction.
Elucidating Key Motifs Required for Arp2/3-Dependent and Independent Actin Nucleation by Las17/WASP
Urbanek, Agnieszka N.; Smaczynska-de Rooij, Iwona I.
2016-01-01
Actin nucleation is the key rate limiting step in the process of actin polymerization, and tight regulation of this process is critical to ensure actin filaments form only at specific times and at defined regions of the cell. Arp2/3 is a well-characterised protein complex that can promote nucleation of new filaments, though its activity requires additional nucleation promotion factors (NPFs). The best recognized of these factors are the WASP family of proteins that contain binding motifs for both monomeric actin and for Arp2/3. Previously we demonstrated that the yeast WASP homologue, Las17, in addition to activating Arp2/3 can also nucleate actin filaments de novo, independently of Arp2/3. This activity is dependent on its polyproline rich region. Through biochemical and in vivo analysis we have now identified key motifs within the polyproline region that are required for nucleation and elongation of actin filaments, and have addressed the role of the WH2 domain in the context of actin nucleation without Arp2/3. We have also demonstrated that full length Las17 is able to bind liposomes giving rise to the possibility of direct linkage of nascent actin filaments to specific membrane sites to which Las17 has been recruited. Overall, we propose that Las17 functions as the key initiator of de novo actin filament formation at endocytic sites by nucleating, elongating and tethering nascent filaments which then serve as a platform for Arp2/3 recruitment and function. PMID:27637067
Timonova, L V; Lyakhova, O N; Lukashenko, S N; Aidarkhanov, A O
2015-01-01
As a result of investigations carried out on the territory of Semipalatinsk Test Site, tritium was found in different environmental objects--surface and ground waters, vegetation, air environment, and snow cover. The analysis of the data obtained has shown that contamination of environmental objects at the Semipalatinsk Test Site with tritium is associated with the places where underground nuclear tests were performed. Since tritium can originate from an activation reaction and be trapped by pock particles during a test, it was decided to examine the soil in the sites where surface and excavation tests took place. It was found that the concentration of tritium in soil correlates with the concentration of europium. Probably, the concentration of tritium in the soil depends on the character and yield of the tests performed. Findings of the study have revealed that tritium can be found in soil in significant amounts not only in sites where underground nuclear tests took place but also in sites where surface and excavation nuclear tests were carried out.
Spatial Layout of Multi-Environment Test Sites: A Case Study of Maize in Jilin Province
Directory of Open Access Journals (Sweden)
Zuliang Zhao
2018-05-01
Full Text Available Variety regional tests based on multiple environments play a critical role in understanding the high yield and adaptability of new crop varieties. However, the current approach mainly depends on experience from breeding experts and is difficulty to promote because of inconsistency between testing and actual situation. We propose a spatial layout method based on the existing systematic regional test network. First, the method of spatial clustering was used to cluster the planting environment. Then, we used spatial stratified sampling to determine the minimum number of test sites in each type of environment. Finally, combined with the factors such as the convenience of transportation and the planting area, we used spatial balance sampling to generate the layout of multi-environment test sites. We present a case study for maize in Jilin Province and show the utility of the method with an accuracy of about 94.5%. The experimental results showed that 66.7% of sites are located in the same county and the unbalanced layout of original sites is improved. Furthermore, we conclude that the set of operational technical ideas for carrying out the layout of multi-environment test sites based on crop varieties in this paper can be applied to future research.
Valentina Accoto; Pierluigi Bullo; Ruben Faccio; Leonardo Mason; Andrea Sottani
2017-01-01
The study consisted in the analysis of the mobilization mechanisms of hexavalent chromium (Cr(VI)) into groundwater from a decommissioned contaminated factory. The site is located in the Province of Vicenza and formerly was a chrome-plating plant. The subsoil consists predominantly of gravelly deposits with a thickness of at least one hundred meters. An unconfined aquifer is present with water table at about 23 m depth bgl. During the seven years of monitoring (2008-2014), the fluctuation of ...
African Journals Online (AJOL)
Dr Olaleye
Systemic phosphate homeostasis is maintained through several hormonal mechanisms which involve fibroblast growth factor 23 (FGF-23), α-klotho, vitamin D and parathyroid hormone. FGF-23 is known to be the major regulator of phosphate balance (Mirams et al., 2004). FGF-23 is a phosphaturic hormone, which is.
Directory of Open Access Journals (Sweden)
Sung-Ho Kil
2015-11-01
Full Text Available This study employs a diverse set of variables to explain slope stabilization on stable versus failure-prone revegetated cut-slopes in Korea. A field survey was conducted at potential unstable sites and stable sites using 23 variables. Through a non-parametric test of the field survey results, 15 variables were identified as primary determinants of slope failure. Of these variables, one described physical characteristics (elapsed year; four variables described vegetation properties (plant community, vegetation coverage rate, number of trees, and number of herbs; and 10 variables represented soil properties (porosity, soil hardness, water content, sand ratio and silt ratio of soil texture, tensile strength, permeability coefficient, soil depth, soil acidity, salt concentration, and organic matter. Slope angle, which was mainly considered in previous studies, of variables in physical characteristics was not statistically selected as one of the 15 variables because most of sites were located on steep slopes. The vegetation community, vegetation coverage, and number of trees influence slope stabilization. Vegetation coverage is highly correlated with other soil and vegetation variables, making it a major indicator of slope stabilization. All soil variables were related to slope failure such that subsequent slope failure was related to the method of slope revegetation rather than the environmental condition of the slope. Slope failure did not occur in revegetated slopes that matched the characteristics of the surrounding landscape and contained a large number of native trees. Most soil and vegetation variables showed differing values for whether a revegetated slope is potentially unstable or stable.
Energy Technology Data Exchange (ETDEWEB)
Tomberlin, G.; Mosey, G.
2013-03-01
Under the RE-Powering America's Land initiative, the U.S. Environmental Protection Agency (EPA) provided funding to the National Renewable Energy Laboratory (NREL) to support a feasibility study of biomass renewable energy generation at the former Farmland Industries site in Lawrence, Kansas. Feasibility assessment team members conducted a site assessment to gather information integral to this feasibility study. Information such as biomass resources, transmission availability, on-site uses for heat and power, community acceptance, and ground conditions were considered.
Relationship of 2,3-diphosphoglycerate and 2,3-diphosphoglycerate mutase in various mammals.
Chemtob, S; Gibb, W; Bard, H
1980-01-01
To investigate a possible mechanism involved in the regulation of 2,3-diphosphoglycerate (2,3-DPG) synthesis, 2,3-DPG mutase (DPGM) was measured in different mammals presenting large differences in 2,3-DPG concentration between fetal, neonatal and adult life to see the activity of this enzyme, necessary for 2,3-DPG synthesis, was related to the levels of 2,3-DPG. The data demonstrated that the minimal levels of 2,3-DPG in the adult sheep are likely due to the very low levels of DPGM. Also these findings show that the increases in 2,3-DPG levels, found in the newborn sheep during the 1st week of life, in adult rabbit and guinea pig when compared with their fetuses, are not due to an increase in levels of the DPGM.
Web Site of King Faysal for Researches and Islamic Studies :Evaluative Case Study . 2
Directory of Open Access Journals (Sweden)
Hind Badi Aly al-Badi
2007-06-01
Full Text Available This study makes evaluation to the website of King Faisal Islamic Study & Research Center (KFISRC in relation to its site, advanced design, services rendered, public users and easy-to-search including its discharged duties; content, form and scope.The study aims to evaluate the website of KFISRC published in the Internet as well as the volume of its sample users, and to determine the motivations of use.The study was conducted on the Second Semester in 1426H. / 2005G. The researcher has relied in the evaluation case study on "on-line access" in the Internet; a matter which was imposed by the nature and objectives of the study and followed by an evaluation-analysis methodology based on the measures derived from Website & Information Resources Measures in the Internet. The information were gathered using the questionnaire forms which were distributed to a random sample of 15% of the society slide subject of the study totaling 1755 of post-graduate female students; i.e. Master degree; enrolled in Library & Information, Arabic Language and History Departments of Faculty of Arts & Humanities , King Abdulaziz University, Jeddah; and post-graduate female students; i.e. Master degree; enrolled in Faculty of Da'wa & Fundamentals of Religion, Umm Al-Qura University, Makkah Al-Mukarramah, including male and female staff of KFISRC. The study has reached to the number of findings, mainly as follows:The volume of the users has reached to 40.7% of the sampling. One of the reasons of the decreasing percentage in the number of the site users of KFISRC is that 32.4% did not know about the existence of the site in the Internet; whereas, 24.1% of the sampling whose most important motivation to use the site is to know whether the resources searched by them would be available in the data-bases of the KFISRC or not
Web Site of King Faysal for Researches and Islamic Studies :Evaluative Case Study . 1
Directory of Open Access Journals (Sweden)
Hind Badi Aly al-Badi
2007-03-01
Full Text Available This study makes evaluation to the website of King Faisal Islamic Study & Research Center (KFISRC in relation to its site, advanced design, services rendered, public users and easy-to-search including its discharged duties; content, form and scope.The study aims to evaluate the website of KFISRC published in the Internet as well as the volume of its sample users, and to determine the motivations of use.The study was conducted on the Second Semester in 1426H. / 2005G. The researcher has relied in the evaluation case study on "on-line access" in the Internet; a matter which was imposed by the nature and objectives of the study and followed by an evaluation-analysis methodology based on the measures derived from Website & Information Resources Measures in the Internet. The information were gathered using the questionnaire forms which were distributed to a random sample of 15% of the society slide subject of the study totaling 1755 of post-graduate female students; i.e. Master degree; enrolled in Library & Information, Arabic Language and History Departments of Faculty of Arts & Humanities , King Abdulaziz University, Jeddah; and post-graduate female students; i.e. Master degree; enrolled in Faculty of Da'wa & Fundamentals of Religion, Umm Al-Qura University, Makkah Al-Mukarramah, including male and female staff of KFISRC. The study has reached to the number of findings, mainly as follows:The volume of the users has reached to 40.7% of the sampling. One of the reasons of the decreasing percentage in the number of the site users of KFISRC is that 32.4% did not know about the existence of the site in the Internet; whereas, 24.1% of the sampling whose most important motivation to use the site is to know whether the resources searched by them would be available in the data-bases of the KFISRC or not
Sepsis does not alter red blood cell glucose metabolism or Na+ concentration: A 2H-, 23Na-NMR study
International Nuclear Information System (INIS)
Hotchkiss, R.S.; Song, S.K.; Ling, C.S.; Ackerman, J.J.; Karl, I.E.
1990-01-01
The effects of sepsis on intracellular Na+ concentration ([Na+]i) and glucose metabolism were examined in rat red blood cells (RBCs) by using 23Na- and 2H-nuclear magnetic resonance (NMR) spectroscopy. Sepsis was induced in 15 halothane-anesthetized female Sprague-Dawley rats by using the cecal ligation and perforation technique; 14 control rats underwent cecal manipulation without ligation. The animals were fasted for 36 h, but allowed free access to water. At 36 h postsurgery, RBCs were examined by 23Na-NMR by using dysprosium tripolyphosphate as a chemical shift reagent. Human RBCs from 17 critically ill nonseptic patients and from 7 patients who were diagnosed as septic were also examined for [Na+]i. Five rat RBC specimens had [Na+]i determined by both 23Na-NMR and inductively coupled plasma-atomic emission spectroscopy (ICP-AES). For glucose metabolism studies, RBCs from septic and control rats were suspended in modified Krebs-Henseleit buffer containing [6,6-2H2]glucose and examined by 2H-NMR. No significant differences in [Na+]i or glucose utilization were found in RBCs from control or septic rats. There were no differences in [Na+]i in the two groups of patients. The [Na+]i determined by NMR spectroscopy agreed closely with measurements using ICP-AES and establish that 100% of the [Na+]i of the RBC is visible by NMR. Glucose measurements determined by 2H-NMR correlated closely (correlation coefficient = 0.93) with enzymatic analysis. These studies showed no evidence that sepsis disturbed RBC membrane function or metabolism
Energy Technology Data Exchange (ETDEWEB)
Simon, J.; Mosey, G.
2013-01-01
The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Kerr McGee site in Columbus, Mississippi, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.
Energy Technology Data Exchange (ETDEWEB)
Stoltenberg, B.; Konz, C.; Mosey, G.
2013-03-01
The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Crazy Horse Landfill site in Salinas, California, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) was contacted to provide technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, operation and maintenance requirements, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.
International Nuclear Information System (INIS)
Mizutani, Kimihiko; Toyoda, Mayuko; Sagara, Kenta; Takahashi, Nobuyuki; Sato, Atsuko; Kamitaka, Yuji; Tsujimura, Seiya; Nakanishi, Yuji; Sugiura, Toshiyuki; Yamaguchi, Shotaro; Kano, Kenji; Mikami, Bunzo
2010-01-01
The crystal structure of bilirubin oxidase (BOD) from M. verrucaria has been determined at 2.3 Å resolution using a merohedrally twinned crystal. BOD has four copper-coordination sites that are almost identical to those of other multicopper oxidases and is also very similar to them in overall structure. Bilirubin oxidase (BOD), a multicopper oxidase found in Myrothecium verrucaria, catalyzes the oxidation of bilirubin to biliverdin. Oxygen is the electron acceptor and is reduced to water. BOD is used for diagnostic analysis of bilirubin in serum and has attracted considerable attention as an enzymatic catalyst for the cathode of biofuel cells that work under neutral conditions. Here, the crystal structure of BOD is reported for the first time. Blue bipyramid-shaped crystals of BOD obtained in 2-methyl-2,4-pentanediol (MPD) and ammonium sulfate solution were merohedrally twinned in space group P6 3 . Structure determination was achieved by the single anomalous diffraction (SAD) method using the anomalous diffraction of Cu atoms and synchrotron radiation and twin refinement was performed in the resolution range 33–2.3 Å. The overall organization of BOD is almost the same as that of other multicopper oxidases: the protein is folded into three domains and a total of four copper-binding sites are found in domains 1 and 3. Although the four copper-binding sites were almost identical to those of other multicopper oxidases, the hydrophilic Asn residue (at the same position as a hydrophobic residue such as Leu in other multicopper oxidases) very close to the type I copper might contribute to the characteristically high redox potential of BOD
Wildlife studies on the Hanford site: 1994 Highlights report
Energy Technology Data Exchange (ETDEWEB)
Cadwell, L.L. [ed.
1995-04-01
The purposes of the project are to monitor and report trends in wildlife populations; conduct surveys to identify, record, and map populations of threatened, endangered, and sensitive plant and animal species; and cooperate with Washington State and federal and private agencies to help ensure the protection afforded by law to native species and their habitats. Census data and results of surveys and special study topics are shared freely among cooperating agencies. Special studies are also conducted as needed to provide additional information that may be required to assess, protect, or manage wildlife resources at Hanford. This report describes highlights of wildlife studies on the Site in 1994. Redd counts of fall chinook salmon in the Hanford Reach suggest that harvest restrictions directed at protecting Snake River salmon may have helped Columbia River stocks as well. The 1994 count (5619) was nearly double that of 1993 and about 63% of the 1989 high of approximately 9000. A habitat map showing major vegetation and land use cover types for the Hanford Site was completed in 1993. During 1994, stochastic simulation was used to estimate shrub characteristics (height, density, and canopy cover) across the previously mapped Hanford landscape. The information provided will be available for use in determining habitat quality for sensitive wildlife species. Mapping Site locations of plant species of concern continued during 1994. Additional sensitive plant species data from surveys conducted by TNC were archived. The 10 nesting pairs of ferruginous hawks that used the Hanford Site in 1993 represented approximately 25% of the Washington State population.
Wildlife studies on the Hanford site: 1994 Highlights report
International Nuclear Information System (INIS)
Cadwell, L.L.
1995-04-01
The purposes of the project are to monitor and report trends in wildlife populations; conduct surveys to identify, record, and map populations of threatened, endangered, and sensitive plant and animal species; and cooperate with Washington State and federal and private agencies to help ensure the protection afforded by law to native species and their habitats. Census data and results of surveys and special study topics are shared freely among cooperating agencies. Special studies are also conducted as needed to provide additional information that may be required to assess, protect, or manage wildlife resources at Hanford. This report describes highlights of wildlife studies on the Site in 1994. Redd counts of fall chinook salmon in the Hanford Reach suggest that harvest restrictions directed at protecting Snake River salmon may have helped Columbia River stocks as well. The 1994 count (5619) was nearly double that of 1993 and about 63% of the 1989 high of approximately 9000. A habitat map showing major vegetation and land use cover types for the Hanford Site was completed in 1993. During 1994, stochastic simulation was used to estimate shrub characteristics (height, density, and canopy cover) across the previously mapped Hanford landscape. The information provided will be available for use in determining habitat quality for sensitive wildlife species. Mapping Site locations of plant species of concern continued during 1994. Additional sensitive plant species data from surveys conducted by TNC were archived. The 10 nesting pairs of ferruginous hawks that used the Hanford Site in 1993 represented approximately 25% of the Washington State population
[Study on genetic instability of nm23H1 gene in Chinese with original gallbladder tumor].
Lu, Hai Ying; Zhang, Guo Qiang; Li, Ji Cheng
2006-06-01
The aim of this study was to examine the microsatellite instability (MSI) and loss of heterozygosity (LOH) of locus D17S396 on chromosome 17 and their influence on the expression of nm23H1 in gallbladder tumors, which may provide experimental basis for the tumor occurrence and metastasis. Techniques such as DNA extraction from formalin-fixed paraffin-embedded tissues, polymerase chain reaction-single strand conformation polymorphism (PCR-SSCP), ordinary silver stain were used to study MSI and LOH of locus D17S396. Envision immunohistochemistry and Leica-Qwin computer imaging techniques were used to assess the expression of gene nm23H1. In our experiment, the frequency of genetic instability of malignant gallbladder tumors was 42.55%, which was higher than that of gallbladder adenomas, while there were no genetic instability occurred in chronic cholecystitis tissue. The frequency of LOH seemed higher with the deteriorism of gallbladder tumor. Among 47 gallbladder carcinomas, the frequency of LOH and MSI were different between different differentiation cases (P gallbladder carcinoma, gallbladder adenoma and chronic cholecystitis tissue were different (P gallbladder carcinomas, the positive frequency of nm23H1 protein in LOH positive group was lower than that of LOH negative group (P gallbladder tumor. Both MSI and LOH of nm23H1 gene controlled the development of gallbladder tumor independently in different paths. MSI may be an early stage molecule marker of gallbladder carcinoma. LOH may be molecule marker for the deteriorism of gallbladder tissue, which could inhibit the expression of nm23H1 in local tissue of gallbladder carcinoma and endow it with high aggressive and poor prognosis. Increasing the amount of nm23H1 protein expression could effectively restrain gallbladder carcinoma metastasis and improve prognosis of patients.
International Nuclear Information System (INIS)
Hutchison, J.; Jernigan, G.
1989-12-01
The Environmental Restoration and Waste Management Five-Year Plan (FYP) covers the period for FY 1989 through FY 1995. The plan establishes a Department of Energy -- Headquarters (DOE-HQ) agenda for cleanup and compliance against which overall progress can be measured. The FYP covers three areas: Corrective Activities, Environmental Restoration, and Waste Management Operations. Corrective Activities are those activities necessary to bring active or standby facilities into compliance with local, state, and federal environmental regulations. Environmental restoration activities include the assessment and cleanup of surplus facilities and inactive waste sites. Waste management operations includes the treatment, storage, and disposal of wastes which are generated as a result of ongoing operations. This Site Specific Plan (SSP) has been prepared by the Savannah River Site (SRS) in order to show how environmental restoration and waste management activities that were identified during the preparation of the FYP will be implemented, tracked, and reported. The SSP describes DOE Savannah River (DOE-SR) and operating contractor, Westinghouse Savannah River Company (WSRC), organizations that are responsible, for undertaking the activities identified in this plan. The SSP has been prepared in accordance with guidance received from DOE-HQ. DOE-SR is accountable to DOE-HQ for the implementation of this plan. 8 refs., 46 figs., 23 tabs
Site study plan for non-routine laboratory rock mechanics, Deaf Smith County Site, Texas: Revision 1
International Nuclear Information System (INIS)
1987-12-01
This Site Study Plan describes the non-routine rock mechanics and thermal properties laboratory testing program planned for the characterization of site-specific geologic materials for the Deaf Smith County site, Texas. The study design provides for measurements of index, mechanical, thermomechanical, thermal and special properties for the host salt, and where appropriate, for nonhost lithologies. The types of tests which will be conducted are constant stress (creep) tests, constant strain (stress relaxation) tests, constant strain-rate tests, constant stress-rate tests, cyclic loading tests, hollow cylinder tests, uniaxial and triaxial compression tests, direct tension tests, indirect (triaxial) shear tests, thermal property determinations (conductivity, specific heat, expansivity, and diffusivity), fracture healing tests, thermal decrepitation tests, moisture content determinations, and petrographic and micromechanics analyses. Tests will be conducted at confining pressures up to 30 MPa and temperatures up to 300/degree/C. These data are used to construct mathematical models for the phenomenology of salt deformation. The models are then used in finite-element codes to predict repository response. A tentative testing schedule and milestone log are given. The duration of the testing program is expected to be approximately 5 years. 44 refs., 13 figs., 13 tabs
Energy Technology Data Exchange (ETDEWEB)
Cabak, M.A.; Beck, M.L.; Gillam, C.; Sassaman, K.E.
1996-02-01
This report documents the archaeological investigation of Site 7 of the proposed Three Rivers Regional Landfill and Technology Center in Aiken County on the United States Department of Energy`s Savannah River Site (SRS) in Aiken and Barnwell Counties, South Carolina. Pedestrian and subsurface survey techniques were used to investigate the 1,403-acre project area. Survey resulted in the discovery of 23 previously unrecorded sites and 11 occurrences; six previously recorded sites were also investigated. These sites consist of six prehistoric sites, nine historic sites, and 14 sites with both prehistoric and historic components. Sites locations and project area boundaries are provided on a facsimile of a USGS 7.5 topographic map. The prehistoric components consist of very small, low-density lithic and ceramic scatters; most contain less than 10 artifacts. Six of the prehistoric components are of unknown cultural affiliation, the remaining prehistoric sites were occupied predominately in the Woodland period. The historic sites are dominated by postbellum/modem home places of tenant and yeoman farmers but four historic sites were locations of antebellum house sites (38AK136, 38AK613, 38AK660, and 38AK674). The historic sites also include an African-American school (38AK677).
Russu, I M; Wu, S S; Bupp, K A; Ho, N T; Ho, C
1990-04-17
High-resolution 1H and 31P nuclear magnetic resonance spectroscopy has been used to investigate the binding of 2,3-diphosphoglycerate to human normal adult hemoglobin and the molecular interactions involved in the allosteric effect of the 2,3-diphosphoglycerate molecule on hemoglobin. Individual hydrogen ion NMR titration curves have been obtained for 22-26 histidyl residues of hemoglobin and for each phosphate group of 2,3-diphosphoglycerate with hemoglobin in both the deoxy and carbonmonoxy forms. The results indicate that 2,3-diphosphoglycerate binds to deoxyhemoglobin at the central cavity between the two beta chains and the binding involves the beta 2-histidyl residues. Moreover, the results suggest that the binding site of 2,3-diphosphoglycerate to carbonmonoxyhemoglobin contains the same (or at least some of the same) amino acid residues responsible for binding in the deoxy form. As a result of the specific interactions with 2,3-diphosphoglycerate, the beta 2-histidyl residues make a significant contribution to the alkaline Bohr effect under these experimental conditions (up to 0.5 proton/Hb tetramer). 2,3-Diphosphoglycerate also affects the individual hydrogen ion equilibria of several histidyl residues located away from the binding site on the surface of the hemoglobin molecule, and, possibly, in the heme pockets. These results give the first experimental demonstration that long-range electrostatic and/or conformational effects of the binding could play an important role in the allosteric effect of 2,3-diphosphoglycerate on hemoglobin.(ABSTRACT TRUNCATED AT 250 WORDS)
Directory of Open Access Journals (Sweden)
Mamta Parashar
2016-01-01
Full Text Available Introduction: Workers represent half the world′s population and are major contributors to economic and social development. Tobacco consumption in construction site workers has been considered a big challenge. Objectives: (1 To assess the prevalence of nicotine dependence among tobacco users. (2 To study the correlates of nicotine dependence among the construction site workers. Methodology: A cross sectional study was conducted using a predesigned and pretested structured proforma. The study was conducted among all construction site workers aged 18yrs and above in campus of Hamdard Institute of Medical Sciences and Research and associated HAH centenary hospital, New Delhi.Karl Fagerstrom Nicotine Dependence Questionnaire was used to assess dependence on nicotine. Results: The mean age of construction site workers was 32.04±11.6 years. Among the workers, majority (91% were tobacco user. Among the users, 60% found it difficult to refrain from smoking/chewing in places where use of tobacco is not allowed (e.g. hospitals, government offices, cinemas, Libraries etc. 55% of the users smoked or chewed tobacco during the first hours after waking than during the rest of the day. On multivariate analysis, the factors which were found to be significantly associated with nicotine dependence were lower income group (OR 2.57, CI:1.66-3.99, smokeless tobacco use (OR 2.36,CI:1.30-4.27 and lower education (OR = 2.86 (95% CI 1.97-4.16 for illiterate. Discussion: The prevalence of tobacco use (91% among construction workers is very high compared to that in the general population. Recognition of construction sites as work places and proper implementation of law is needed.
Gevorkyan-Airapetov, Lada; Zohary, Keren; Popov-Celeketic, Dusan; Mapa, Koyeli; Hell, Kai; Neupert, Walter; Azem, Abdussalam; Mokranjac, Dejana
2009-02-20
The TIM23 complex is the major translocase of the mitochondrial inner membrane responsible for the import of essentially all matrix proteins and a number of inner membrane proteins. Tim23 and Tim50, two essential proteins of the complex, expose conserved domains into the intermembrane space that interact with each other. Here, we describe in vitro reconstitution of this interaction using recombinantly expressed and purified intermembrane space domains of Tim50 and Tim23. We established two independent methods, chemical cross-linking and surface plasmon resonance, to track their interaction. In addition, we identified mutations in Tim23 that abolish its interaction with Tim50 in vitro. These mutations also destabilized the interaction between the two proteins in vivo, leading to defective import of preproteins via the TIM23 complex and to cell death at higher temperatures. This is the first study to describe the reconstitution of the Tim50-Tim23 interaction in vitro and to identify specific residues of Tim23 that are vital for the interaction with Tim50.
Web-Based Recruiting for Health Research Using a Social Networking Site: An Exploratory Study
Fenner, Yeshe; Garland, Suzanne M; Moore, Elya E; Jayasinghe, Yasmin; Fletcher, Ashley; Tabrizi, Sepehr N; Gunasekaran, Bharathy
2012-01-01
Background Recruitment of young people for health research by traditional methods has become more expensive and challenging over recent decades. The Internet presents an opportunity for innovative recruitment modalities. Objective To assess the feasibility of recruiting young females using targeted advertising on the social networking site Facebook. Methods We placed an advertisement on Facebook from May to September 2010, inviting 16- to 25-year-old females from Victoria, Australia, to participate in a health study. Those who clicked on the advertisement were redirected to the study website and were able to express interest by submitting their contact details online. They were contacted by a researcher who assessed eligibility and invited them to complete a health-related survey, which they could do confidentially and securely either at the study site or remotely online. Results A total of 551 females responded to the advertisement, of whom 426 agreed to participate, with 278 completing the survey (139 at the study site and 139 remotely). Respondents’ age distribution was representative of the target population, while 18- to 25-year-olds were more likely to be enrolled in the study and complete the survey than 16- to 17-year-olds (prevalence ratio = 1.37, 95% confidence interval 1.05–1.78, P = .02). The broad geographic distribution (major city, inner regional, and outer regional/remote) and socioeconomic profile of participants matched the target population. Predictors of participation were older age, higher education level, and higher body mass index. Average cost in advertising fees per compliant participant was US $20, making this highly cost effective. Conclusions Results demonstrate the potential of using modern information and communication technologies to engage young women in health research and penetrate into nonurban communities. The success of this method has implications for future medical and population research in this and other demographics
Web-based recruiting for health research using a social networking site: an exploratory study.
Fenner, Yeshe; Garland, Suzanne M; Moore, Elya E; Jayasinghe, Yasmin; Fletcher, Ashley; Tabrizi, Sepehr N; Gunasekaran, Bharathy; Wark, John D
2012-02-01
Recruitment of young people for health research by traditional methods has become more expensive and challenging over recent decades. The Internet presents an opportunity for innovative recruitment modalities. To assess the feasibility of recruiting young females using targeted advertising on the social networking site Facebook. We placed an advertisement on Facebook from May to September 2010, inviting 16- to 25-year-old females from Victoria, Australia, to participate in a health study. Those who clicked on the advertisement were redirected to the study website and were able to express interest by submitting their contact details online. They were contacted by a researcher who assessed eligibility and invited them to complete a health-related survey, which they could do confidentially and securely either at the study site or remotely online. A total of 551 females responded to the advertisement, of whom 426 agreed to participate, with 278 completing the survey (139 at the study site and 139 remotely). Respondents' age distribution was representative of the target population, while 18- to 25-year-olds were more likely to be enrolled in the study and complete the survey than 16- to 17-year-olds (prevalence ratio=1.37, 95% confidence interval 1.05-1.78, P=.02). The broad geographic distribution (major city, inner regional, and outer regional/remote) and socioeconomic profile of participants matched the target population. Predictors of participation were older age, higher education level, and higher body mass index. Average cost in advertising fees per compliant participant was US $20, making this highly cost effective. Results demonstrate the potential of using modern information and communication technologies to engage young women in health research and penetrate into nonurban communities. The success of this method has implications for future medical and population research in this and other demographics.
International Nuclear Information System (INIS)
Diwan, R.M.
1990-01-01
The influence of hydrogen on the tensile properties and ductility behavior of NASA-23 alloy were analyzed. NASA-23 and other referenced alloys in cast and hipped conditions were solution treated and aged under selected conditions and characterized using optical metallography, scanning electron microscopy, and electron microprobe analysis techniques. The yield strength of NASA-23 is not affected much by hydrogen under tensile tests carried at 5000 psig conditions; however, the ultimate strength and ductility properties are degraded. This implies that the physical mechanisms operating would be related to the plastic deformation process. The fracture surfaces characteristics of NASA-23 specimens tensile tested in hydrogen, helium, and air were also analyzed. These revealed surface cracks around specimen periphery with the fracture surface showing a combination of intergranular and transgranular modes of fracture. It is seen that the specimens charged in hydrogen seem to favor a more brittle fracture mode in comparison to air and helium charged specimens. The AMCC casting characterization program is to be analyzed for their hydrogen behavior. As a result of this program, the basic microstructural factors and fracture characteristics in some cases were analyzed
International Nuclear Information System (INIS)
Meier, P.M.; Morell, D.
1976-09-01
The report is an analysis of a hypothetical nuclear energy center (NEC) conducted in support of the recently completed study by the Nuclear Regulatory Commission, mandated by the Congress in the Energy Reorganization Act of 1974. The intent of the analysis of the hypothetical, or ''surrogate'', site was to inject a local and regional perspective into the assessment of technical, environmental, institutional, and socioeconomic issues which could be adequately addressed only by reference to a specific site. The hypothetical NEC site in Ocean County, New Jersey, was chosen to illustrate the problems and impacts of potential energy centers in coastal and near-coastal sites in relatively close proximity to large metropolitan areas. Earlier studies of hypothetical energy centers on the Mississippi River at River Bend, La., and on the Columbia River near Hanford, Washington, were also re-examined for their relevance to this new study effort. Neither Ocean County, nor any of the other surrogate sites, have been considered for actual construction of an NEC, nor does their selection for study purposes imply any judgement of desirability. Indeed, the major finding of the report presented is that Ocean County is a relatively poor location for an energy center, and this may well be true of many coastal locations similar to the Jersey shore. The objective in selecting surrogate sites, then, was not to find the best locations, but to select sites that would illustrate the broadest range of potential public policy and siting issues
Study of a conceptual nuclear energy center at Green River, Utah. Site selection
International Nuclear Information System (INIS)
1981-08-01
The siting requirements are described for a NEC. The methodology used, primary and secondary screening criteria and the results and conclusions are also presented. Appended to the report are detailed discussions of two siting factors, and evaluation of Nuclear Regulatory Commission (NRC) demographic siting criteria and a fatal flaw analyses for terrestrial and aquatic ecology
Study of a conceptual nuclear energy center at Green River, Utah. Site selection
Energy Technology Data Exchange (ETDEWEB)
1981-08-01
The siting requirements are described for a NEC. The methodology used, primary and secondary screening criteria and the results and conclusions are also presented. Appended to the report are detailed discussions of two siting factors, and evaluation of Nuclear Regulatory Commission (NRC) demographic siting criteria and a fatal flaw analyses for terrestrial and aquatic ecology.
Establishing a site for A Slovenian LILW repository - 16151
International Nuclear Information System (INIS)
VIRSEK, SANDI; SPILER, JANJA; VESELIC, MIRAN
2009-01-01
In this paper we will describe the practice and siting process for a LILW repository in Slovenia. Slovenia is a small country, and, consequently, its nuclear programme is small. It does include almost everything that large programmes have, but we still do not have a repository. In 2004, the Slovenian Radwaste management agency (ARAO) initiated a new procedure to find a proper location for a LILW repository. ARAO asked all Slovenian communities to participate. All communities have the option to withdraw from the process until they have approved the site. We received eight responses, and we prepared methodologies with different parameters to evaluate all potential sites. All sites were assessed by Slovenian experts, and determinations were based on using prepared methodologies. On the basis of their expert opinions, we prepared a pre-feasibility study and chose the three most suitable sites. With these three we continued the process. After that time, one of the communities withdrew from the procedure, and another one reversed its proposed site and proposed a new one. For the third site we continued with the programme, and we prepared a feasibility study with a Strategic Environmental Impact Assessment and preliminary safety calculations for the comparison of different concepts of disposal units. If everything goes according to the plan for this site and the concept, we expect site approval in the first half of 2009. After that, we will start preparing everything necessary for building permission. (authors)
Safety aspects of geological studies around nuclear installations sites
International Nuclear Information System (INIS)
Faure, J.
1988-01-01
The experience of geological studies of about forty french nuclear sites allows to set out the objectives, the phases and the geographic extensions of workings to be realized for confirming a site. The data to be collected for the safety analysis are specified; they concern the local and regional geology, the geotechnical characteristics and the essential elements for evaluating the hazards related to the soil liquefaction, the surface fracturing and in some cases the volcanic risks. It is necessary to follow up the geology during the installation construction and life. 8 refs. (F.M.)
A Site Wide Perspective on Uranium Geochemistry at the Hanford Site
Energy Technology Data Exchange (ETDEWEB)
Zachara, John M.; Brown, Christopher F.; Christensen, J. N.; Davis, Jim A.; Dresel, P. Evan; Liu, Chongxuan; Kelly, S. D.; McKinley, James P.; Serne, R. Jeffrey; Um, Wooyong
2007-10-26
Uranium (U) is an important risk-driving contaminant at the Hanford Site. Over 200,000 kg have been released to the vadose zone over the course of site operations, and a number of vadose zone and groundwater plumes containing the uranyl cation [UO22+, U(VI)] have been identified. U is recognized to be of moderate-to-high mobility, conditions dependent. The site is currently making decisions on several of these plumes with long-lasting implications, and others are soon to come. Uranium is one of nature’s most intriguing and chemically complex elements. The fate and transport of U(VI) has been studied over the long lifetime of the Hanford Site by various contractors, along with the Pacific Northwest National Laboratory (PNNL) and its collaborators. Significant research has more recently been contributed by the national scientific community with support from the U.S. Department of Energy’s (DOE) Office of Science through its Environmental Remediation Sciences Division (ERSD). This report represents a first attempt to integrate these findings into a cohesive view of the subsurface geochemistry of U at the Hanford Site. The objective is to inform all interested Hanford parties about the in-ground inventory of U and its geochemical behavior. This report also comments on the prospects for the development of a robust generic model to more accurately forecast future U(VI) migration at different Hanford waste sites, along with further research necessary to reach this goal.
Site specific plan. [Environmental Restoration and Waste Management, Savannah River Site
Energy Technology Data Exchange (ETDEWEB)
Hutchison, J.; Jernigan, G.
1989-12-01
The Environmental Restoration and Waste Management Five-Year Plan (FYP) covers the period for FY 1989 through FY 1995. The plan establishes a Department of Energy -- Headquarters (DOE-HQ) agenda for cleanup and compliance against which overall progress can be measured. The FYP covers three areas: Corrective Activities, Environmental Restoration, and Waste Management Operations. Corrective Activities are those activities necessary to bring active or standby facilities into compliance with local, state, and federal environmental regulations. Environmental restoration activities include the assessment and cleanup of surplus facilities and inactive waste sites. Waste management operations includes the treatment, storage, and disposal of wastes which are generated as a result of ongoing operations. This Site Specific Plan (SSP) has been prepared by the Savannah River Site (SRS) in order to show how environmental restoration and waste management activities that were identified during the preparation of the FYP will be implemented, tracked, and reported. The SSP describes DOE Savannah River (DOE-SR) and operating contractor, Westinghouse Savannah River Company (WSRC), organizations that are responsible, for undertaking the activities identified in this plan. The SSP has been prepared in accordance with guidance received from DOE-HQ. DOE-SR is accountable to DOE-HQ for the implementation of this plan. 8 refs., 46 figs., 23 tabs.
Social Networking Sites as Virtual Communities of Practice: A Mixed Method Study
Davis, Lorretta J.
2010-01-01
Membership in social networking sites is increasing rapidly. Social networking sites serve many purposes including networking, communication, recruitment, and sharing knowledge. Social networking sites, public or private, may be hosted on applications such as Facebook and LinkedIn. As individuals begin to follow and participate in social…
Quantifying and visualizing site performance in clinical trials.
Yang, Eric; O'Donovan, Christopher; Phillips, JodiLyn; Atkinson, Leone; Ghosh, Krishnendu; Agrafiotis, Dimitris K
2018-03-01
One of the keys to running a successful clinical trial is the selection of high quality clinical sites, i.e., sites that are able to enroll patients quickly, engage them on an ongoing basis to prevent drop-out, and execute the trial in strict accordance to the clinical protocol. Intuitively, the historical track record of a site is one of the strongest predictors of its future performance; however, issues such as data availability and wide differences in protocol complexity can complicate interpretation. Here, we demonstrate how operational data derived from central laboratory services can provide key insights into the performance of clinical sites and help guide operational planning and site selection for new clinical trials. Our methodology uses the metadata associated with laboratory kit shipments to clinical sites (such as trial and anonymized patient identifiers, investigator names and addresses, sample collection and shipment dates, etc.) to reconstruct the complete schedule of patient visits and derive insights about the operational performance of those sites, including screening, enrollment, and drop-out rates and other quality indicators. This information can be displayed in its raw form or normalized to enable direct comparison of site performance across studies of varied design and complexity. Leveraging Covance's market leadership in central laboratory services, we have assembled a database of operational metrics that spans more than 14,000 protocols, 1400 indications, 230,000 unique investigators, and 23 million patient visits and represents a significant fraction of all clinical trials run globally in the last few years. By analyzing this historical data, we are able to assess and compare the performance of clinical investigators across a wide range of therapeutic areas and study designs. This information can be aggregated across trials and geographies to gain further insights into country and regional trends, sometimes with surprising results. The
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Holidays. 23.11 Section 23.11... STATUTES § 23.11 Holidays. If the date determined under §§ 23.2 to 23.10 falls on a Federal holiday, then... that is not a Federal holiday. ...
Environmentally acceptable endpoints for PAHs at a manufactured gas plant site
Energy Technology Data Exchange (ETDEWEB)
Stroo, H.F.; Jensen, R.; Loehr, R.C.; Nakles, D.V.; Fairbrother, A.; Liban, C.B. [ThermoRetec Corp., Carson, CA (USA)
2000-09-01
Samples from a former manufactured gas plant (MGP) site in Santa Barbara, CA were tested to evaluate the environmentally acceptable endpoints (EAE) process for setting risk-based cleanup criteria. The research was part of an ongoing effort to develop and demonstrate a protocol for assessing risk-based criteria for MGP sites that incorporates the availability of polycyclic aromatic hydrocarbons (PAHs). Six soil samples were subjected to a battery of physical and biological tests that focused on determining the 'availability' of the soil-bound contaminants to groundwater, ecological receptors, and human receptors. Results demonstrated that sorption to soil, matrix effects, aging, and treatment can significantly reduce chemical availability. Including these reduced availability results in risk assessment calculations yielded environmentally protective cleanup levels almost 3-10 times greater than levels derived using California default risk assessment assumptions. Using an EAE-based approach for MGP soils, especially those containing lampblack, could provide more realistic risk assessment. 23 refs., 6 tabs.
Promoting Teachers' Positive Attitude towards Web Use: A Study in Web Site Development
Akpinar, Yavuz; Bayramoglu, Yusuf
2008-01-01
The purpose of the study was to examine effects of a compact training for developing web sites on teachers' web attitude, as composed of: web self efficacy, perceived web enjoyment, perceived web usefulness and behavioral intention to use the web. To measure the related constructs, the Web Attitude Scale was adapted into Turkish and tested with a…
Refinement of a Method for Identifying Probable Archaeological Sites from Remotely Sensed Data
Tilton, James C.; Comer, Douglas C.; Priebe, Carey E.; Sussman, Daniel; Chen, Li
2012-01-01
To facilitate locating archaeological sites before they are compromised or destroyed, we are developing approaches for generating maps of probable archaeological sites, through detecting subtle anomalies in vegetative cover, soil chemistry, and soil moisture by analyzing remotely sensed data from multiple sources. We previously reported some success in this effort with a statistical analysis of slope, radar, and Ikonos data (including tasseled cap and NDVI transforms) with Student's t-test. We report here on new developments in our work, performing an analysis of 8-band multispectral Worldview-2 data. The Worldview-2 analysis begins by computing medians and median absolute deviations for the pixels in various annuli around each site of interest on the 28 band difference ratios. We then use principle components analysis followed by linear discriminant analysis to train a classifier which assigns a posterior probability that a location is an archaeological site. We tested the procedure using leave-one-out cross validation with a second leave-one-out step to choose parameters on a 9,859x23,000 subset of the WorldView-2 data over the western portion of Ft. Irwin, CA, USA. We used 100 known non-sites and trained one classifier for lithic sites (n=33) and one classifier for habitation sites (n=16). We then analyzed convex combinations of scores from the Archaeological Predictive Model (APM) and our scores. We found that that the combined scores had a higher area under the ROC curve than either individual method, indicating that including WorldView-2 data in analysis improved the predictive power of the provided APM.
Energy Technology Data Exchange (ETDEWEB)
Prince, Martin R. [Weill Cornell Medical College, Department of Radiology, New York, NY (United States); Columbia College of Physicians and Surgeons, Department of Radiology, New York, NY (United States); Lee, Hae Giu [Seoul St. Mary' s Hospital, The Catholic University of Korea, College of Medicine, Department of Radiology, Seoul (Korea, Republic of); Lee, Chang-Hee [Korea University Guro Hospital, Department of Radiology, Seoul (Korea, Republic of); Youn, Sung Won [Catholic University of Daegu Medical Center, Department of Radiology, Daegu (Korea, Republic of); Lee, In Ho [Chungnam National University Hospital, Chungnam National University School of Medicine, Department of Radiology, Daejeon (Korea, Republic of); Yoon, Woong [Chonnam National University Hospital, Department of Radiology, Gwangju (Korea, Republic of); Yang, Benqiang [General Hospital of Shenyang Military Region, Department of Radiology, Shenyang (China); Wang, Haiping [Tangshan Worker' s Hospital, Department of Radiology, Tangshan (China); Wang, Jin [Third Affiliated Hospital of Sun Yat-Sen University, Department of Radiology, Guangzhou (China); Shih, Tiffany Ting-fang [National Taiwan University, Medical College and Hospital, Department of Radiology and Medical Imaging, Taipei (China); Huang, Guo-Shu [National Defense Medical Center, Department of Radiology, Tri-Service General Hospital, Taipei (China); Lirng, Jiing-Feng [Taipei Veterans General Hospital, Department of Radiology, Taipei (China); Palkowitsch, Petra [Medical and Clinical Affairs Radiology, Bayer Pharmaceutical Division, Berlin (Germany); Collaboration: on behalf of the GARDIAN study group
2017-01-15
To investigate the safety and tolerability of gadobutrol at the recommended dose in patients requiring contrast-enhanced magnetic resonance imaging/angiography (MRI/MRA) in the routine setting. GARDIAN prospectively enrolled 23,708 patients undergoing routine gadobutrol-enhanced MRI/MRA for approved indications at 272 study centres in Europe, Asia, North America, and Africa and monitored for adverse events. Median gadobutrol dose was 0.11 mmol/kg body weight. The overall incidence of adverse drug reactions (ADRs) was 0.7 % (n = 170 patients), with similar incidences in patients with renal impairment or cardiac disease, from different geographic regions and in different gadobutrol dose groups. Patients at risk for contrast media reaction had an ADR incidence of 2.5 %. Five patients (0.02 %) experienced serious adverse events, four were drug-related. One patient experienced a fatal anaphylactoid shock, assessed to be related to injection of gadobutrol. The contrast quality of gadobutrol-enhanced images was rated by treating physicians as good or excellent in 97 % cases, with similar ratings in all patient subgroups and indications. The GARDIAN study shows that gadobutrol at the recommended dose is well tolerated across a large, diverse patient population. (orig.)
International Nuclear Information System (INIS)
Prince, Martin R.; Lee, Hae Giu; Lee, Chang-Hee; Youn, Sung Won; Lee, In Ho; Yoon, Woong; Yang, Benqiang; Wang, Haiping; Wang, Jin; Shih, Tiffany Ting-fang; Huang, Guo-Shu; Lirng, Jiing-Feng; Palkowitsch, Petra
2017-01-01
To investigate the safety and tolerability of gadobutrol at the recommended dose in patients requiring contrast-enhanced magnetic resonance imaging/angiography (MRI/MRA) in the routine setting. GARDIAN prospectively enrolled 23,708 patients undergoing routine gadobutrol-enhanced MRI/MRA for approved indications at 272 study centres in Europe, Asia, North America, and Africa and monitored for adverse events. Median gadobutrol dose was 0.11 mmol/kg body weight. The overall incidence of adverse drug reactions (ADRs) was 0.7 % (n = 170 patients), with similar incidences in patients with renal impairment or cardiac disease, from different geographic regions and in different gadobutrol dose groups. Patients at risk for contrast media reaction had an ADR incidence of 2.5 %. Five patients (0.02 %) experienced serious adverse events, four were drug-related. One patient experienced a fatal anaphylactoid shock, assessed to be related to injection of gadobutrol. The contrast quality of gadobutrol-enhanced images was rated by treating physicians as good or excellent in 97 % cases, with similar ratings in all patient subgroups and indications. The GARDIAN study shows that gadobutrol at the recommended dose is well tolerated across a large, diverse patient population. (orig.)
Groundwater numerical modelling of the Fjaellveden study site - evaluation of parameter variations
International Nuclear Information System (INIS)
Larsson, N.A.
1987-10-01
The sensitivity/uncertainty of the hydraulic conductivity distribution in crystalline rocks is considered at the Fjaellveden study site - a site included in the Swedish site selection programme for final storage of spent nuclear fuel. A three-dimensional FEM-model assuming steady-state flow with constant fluid properties under saturated conditions is used. The bedrock of the site is divided into three hydraulic units; rock mass, local and regional fracture zones. The data set of hydraulic conductivity of each unit has been treated statistically in various ways, reflecting different aspects of the physical conditions of the site. A total of nine cases have been prepared, all based on 214 data points. (orig./HP)
19 CFR 146.23 - Accountability for merchandise in a zone.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Accountability for merchandise in a zone. 146.23 Section 146.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY....23 Accountability for merchandise in a zone. (a) Identification of merchandise—(1) General. A zone...
Pseudoknot in domain II of 23 S rRNA is essential for ribosome function
DEFF Research Database (Denmark)
Rosendahl, G; Hansen, L H; Douthwaite, S
1995-01-01
The structure of domain II in all 23 S (and 23 S-like) rRNAs is constrained by a pseudoknot formed between nucleotides 1005 and 1138, and between 1006 and 1137 (Escherichia coli numbering). These nucleotides are exclusively conserved as 1005C.1138G and 1006C.1137G pairs in all Bacteria, Archaea...... increased accessibility in the rRNA structure close to the sites of the mutations. The degree to which the mutations increase rRNA accessibility correlates with the severity of their phenotypic effects. Nucleotide 1131G is extremely reactive to dimethyl sulphate modification in wild-type subunits...
Mechanism of 2,3-butanediol stereoisomers formation in a newly isolated Serratia sp. T241.
Zhang, Liaoyuan; Guo, Zewang; Chen, Jiebo; Xu, Quanming; Lin, Hui; Hu, Kaihui; Guan, Xiong; Shen, Yaling
2016-01-12
Serratia sp. T241, a newly isolated xylose-utilizing strain, produced three 2,3-butanediol (2,3-BD) stereoisomers. In this study, three 2,3-butanediol dehydrogenases (BDH1-3) and one glycerol dehydrogenase (GDH) involved in 2,3-BD isomers formation by Serratia sp. T241 were identified. In vitro conversion showed BDH1 and BDH2 could catalyzed (3S)-acetoin and (3R)-acetoin into (2S,3S)-2,3-BD and meso-2,3-BD, while BDH3 and GDH exhibited the activities from (3S)-acetoin and (3R)-acetoin to meso-2,3-BD and (2R,3R)-2,3-BD. Four encoding genes were assembled into E. coli with budA (acetolactate decarboxylase) and budB (acetolactate synthase), responsible for converting pyruvate into acetoin. E. coli expressing budAB-bdh1/2 produced meso-2,3-BD and (2S,3S)-2,3-BD. Correspondingly, (2R,3R)-2,3-BD and meso-2,3-BD were obtained by E. coli expressing budAB-bdh3/gdh. These results suggested four enzymes might contribute to 2,3-BD isomers formation. Mutants of four genes were developed in Serratia sp. T241. Δbdh1 led to reduced concentration of meso-2,3-BD and (2S,3S)-2,3-BD by 97.7% and 87.9%. (2R,3R)-2,3-BD with a loss of 73.3% was produced by Δbdh3. Enzyme activity assays showed the decrease of 98.4% and 22.4% by Δbdh1 and Δbdh3 compared with the wild strain. It suggested BDH1 and BDH3 played important roles in 2,3-BD formation, BDH2 and GDH have small effects on 2,3-BD production by Serratia sp. T241.
Study on detecting leachate leakage of municipal solid waste landfill site.
Liu, Jiangang; Cao, Xianxian; Ai, Yingbo; Zhou, Dongdong; Han, Qiting
2015-06-01
The article studies the detection of the leakage passage of leachate in a waste landfill dam. The leachate of waste landfill has its own features, like high conductivity, high chroma and an increasing temperature, also, the horizontal flow velocity of groundwater on the leakage site increases. This article proposes a comprehensive tracing method to identify the leakage site of an impermeable membrane by using these features. This method has been applied to determine two leakage sites of the Yahu municipal solid waste landfill site in Pingshan District, Shenzhen, China, which shows that there are two leachate leakage passages in the waste landfill dam A between NZK-2 and NZK-3, and between NZK-6 and NZK-7. © The Author(s) 2015.
Role of active site rigidity in activity: MD simulation and fluorescence study on a lipase mutant.
Directory of Open Access Journals (Sweden)
Md Zahid Kamal
Full Text Available Relationship between stability and activity of enzymes is maintained by underlying conformational flexibility. In thermophilic enzymes, a decrease in flexibility causes low enzyme activity while in less stable proteins such as mesophiles and psychrophiles, an increase in flexibility is associated with enhanced enzyme activity. Recently, we identified a mutant of a lipase whose stability and activity were enhanced simultaneously. In this work, we probed the conformational dynamics of the mutant and the wild type lipase, particularly flexibility of their active site using molecular dynamic simulations and time-resolved fluorescence techniques. In contrast to the earlier observations, our data show that active site of the mutant is more rigid than wild type enzyme. Further investigation suggests that this lipase needs minimal reorganization/flexibility of active site residues during its catalytic cycle. Molecular dynamic simulations suggest that catalytically competent active site geometry of the mutant is relatively more preserved than wild type lipase, which might have led to its higher enzyme activity. Our study implies that widely accepted positive correlation between conformation flexibility and enzyme activity need not be stringent and draws attention to the possibility that high enzyme activity can still be accomplished in a rigid active site and stable protein structures. This finding has a significant implication towards better understanding of involvement of dynamic motions in enzyme catalysis and enzyme engineering through mutations in active site.
Directory of Open Access Journals (Sweden)
Marianne Deschamps
Full Text Available We use stone tool refitting to assess palimpsest formation and stratigraphic integrity in the basal units of the Gruta da Oliveira archeo-stratigraphic sequence, layers 15-27, which TL and U-series dating places in late Marine Isotope Stage (MIS 5 or early MIS 4. As in most karst contexts, the formation of this succession involved multiple and complex phenomena, including subsidence, bioturbation, carnivore activity and runoff as agents of potential post-depositional disturbance. During phases of stabilization, such as represented by layers 15, 21 and 22, the excavated area was inhabited and refits corroborate that post-depositional displacement is negligible. Layers 23-25 and 16-19 correspond to subdivisions that slice thick geological units primarily formed of material derived from the cave's entrance via slope dynamics. Refit links are consistent with rapid fill-up of the interstitial spaces found in the Karren-like bedrock (for layers 23-25, or left between large boulders after major roof-collapse events (for layers 16-19. Layers 26 (the "Mousterian Cone" and 27 are a "bottom-of-hourglass" deposit underlying the main sedimentary body; the refits show that this deposit consists of material derived from layers 15-25 that gravitated through fissures open in the sedimentary column above. Layer 20, at the interface between two major stratigraphic ensembles, requires additional analysis. Throughout, we found significant vertical dispersion along the contact between sedimentary fill and cave wall. Given these findings, a preliminary analysis of technological change across the studied sequence organized the lithic assemblages into five ensembles: layer 15; layers 16-19; layer 20; layers 21-22; layers 23-25. The lower ensembles show higher percentages of flint and of the Levallois method. Uniquely at the site, the two upper ensembles feature bifaces and cleavers.
Crystal structure of the mixed-metal trisulfide BaCu1/3Ta2/3S3
Directory of Open Access Journals (Sweden)
Kejun Bu
2017-05-01
Full Text Available The mixed-metal title compound, BaCu1/3Ta2/3S3 [barium copper(II tantalum(V trisulfide], was prepared through solid-state reactions. The crystal structure adopts the BaTaS3 structure type and consists of face-sharing [MS6] (M = Ta,Cu octahedra (point-group symmetry -3m. that are condensed into infinite chains along [001]. Adjacent chains are linked through the barium cations (site symmetry -6m2, which exhibit a coordination number of twelve. The M site is occupied by 2/3 of TaV and 1/3 of CuII, whereby the average M—S distances are slightly longer than those of ordered BaTaS3. The classical charge balance of the title compound can be represented by [Ba2+] [(Ta/Cu4+] [S2−]3.
Helmer, K. G.; Chou, M-C.; Preciado, R. I.; Gimi, B.; Rollins, N. K.; Song, A.; Turner, J.; Mori, S.
2016-01-01
MRI-based multi-site trials now routinely include some form of diffusion-weighted imaging (DWI) in their protocol. These studies can include data originating from scanners built by different vendors, each with their own set of unique protocol restrictions, including restrictions on the number of available gradient directions, whether an externally-generated list of gradient directions can be used, and restrictions on the echo time (TE). One challenge of multi-site studies is to create a common imaging protocol that will result in a reliable and accurate set of diffusion metrics. The present study describes the effect of site, scanner vendor, field strength, and TE on two common metrics: the first moment of the diffusion tensor field (mean diffusivity, MD), and the fractional anisotropy (FA). We have shown in earlier work that ROI metrics and the mean of MD and FA histograms are not sufficiently sensitive for use in site characterization. Here we use the distance between whole brain histograms of FA and MD to investigate within- and between-site effects. We concluded that the variability of DTI metrics due to site, vendor, field strength, and echo time could influence the results in multi-center trials and that histogram distance is sensitive metrics for each of these variables. PMID:27350723
Helmer, K G; Chou, M-C; Preciado, R I; Gimi, B; Rollins, N K; Song, A; Turner, J; Mori, S
2016-02-27
MRI-based multi-site trials now routinely include some form of diffusion-weighted imaging (DWI) in their protocol. These studies can include data originating from scanners built by different vendors, each with their own set of unique protocol restrictions, including restrictions on the number of available gradient directions, whether an externally-generated list of gradient directions can be used, and restrictions on the echo time (TE). One challenge of multi-site studies is to create a common imaging protocol that will result in a reliable and accurate set of diffusion metrics. The present study describes the effect of site, scanner vendor, field strength, and TE on two common metrics: the first moment of the diffusion tensor field (mean diffusivity, MD), and the fractional anisotropy (FA). We have shown in earlier work that ROI metrics and the mean of MD and FA histograms are not sufficiently sensitive for use in site characterization. Here we use the distance between whole brain histograms of FA and MD to investigate within- and between-site effects. We concluded that the variability of DTI metrics due to site, vendor, field strength, and echo time could influence the results in multi-center trials and that histogram distance is sensitive metrics for each of these variables.
Directory of Open Access Journals (Sweden)
Fraser P. R.
2014-03-01
Full Text Available The reaction 22Ne(p, γ23Na is key to the NeNa cycle of stellar nucleogenesis, and better understanding of the 22Mg(p, γ23Al reaction is needed to understand the 22Na puzzle in ONe white dwarf novae. We aim to study these reactions using a multi-channel algebraic scattering (MCAS formalism for low-energy nucleon-nucleus scattering, recently expanded to investigate radiative capture. As a first step towards this goal, we here calculate the energy levels of the mass-23 (Ne, Mg, Na, Al nuclei. This is not only because the resonant structure of these nuclei are related to the astrophysical -rates of interest, but also because the interaction parameters determined for describing the energy levels are an integral part of the future calculation of the astrophysical reactions when using the MCAS scheme.
Israeli Public Exposure As A Result Of Site Industrial Radiography: Paramenyl Findings
International Nuclear Information System (INIS)
Keren, M.; Rotenberg, L.
1999-01-01
In order to minimize accident possibilities due to Site Industrial Radiography [1], Radiation Safety Division (RSD) of The Ministry of The Environment ordered users of this technology to report their work program in advance. Thus, inspection may be executed by RSD during filming. This work presents results of sample inspections done by RSD during 1997. Accumulated exposure for the public was maximum 23 μ μSv, compared to maximum allowed dose of 300 μ Sv/a (1000 μ Sv/a[2] constrained by 0.3) allowed to the public
Alvarado, David M; Aferol, Hyuliya; McCall, Kevin; Huang, Jason B; Techy, Matthew; Buchan, Jillian; Cady, Janet; Gonzales, Patrick R; Dobbs, Matthew B; Gurnett, Christina A
2010-07-09
Clubfoot is a common musculoskeletal birth defect for which few causative genes have been identified. To identify the genes responsible for isolated clubfoot, we screened for genomic copy-number variants with the Affymetrix Genome-wide Human SNP Array 6.0. A recurrent chromosome 17q23.1q23.2 microduplication was identified in 3 of 66 probands with familial isolated clubfoot. The chromosome 17q23.1q23.2 microduplication segregated with autosomal-dominant clubfoot in all three families but with reduced penetrance. Mild short stature was common and one female had developmental hip dysplasia. Subtle skeletal abnormalities consisted of broad and shortened metatarsals and calcanei, small distal tibial epiphyses, and thickened ischia. Several skeletal features were opposite to those described in the reciprocal chromosome 17q23.1q23.2 microdeletion syndrome associated with developmental delay and cardiac and limb abnormalities. Of note, during our study, we also identified a microdeletion at the locus in a sibling pair with isolated clubfoot. The chromosome 17q23.1q23.2 region contains the T-box transcription factor TBX4, a likely target of the bicoid-related transcription factor PITX1 previously implicated in clubfoot etiology. Our result suggests that this chromosome 17q23.1q23.2 microduplication is a relatively common cause of familial isolated clubfoot and provides strong evidence linking clubfoot etiology to abnormal early limb development. Copyright 2010 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Johannsen, Peter
1997-12-31
attention as hypothesized by Mesulam stating that the parietal cortex is polymodal, receiving input from the primary cortices of all sensory modalities. Thus, the parietal attention site is not only involved in visual spatial selective attention as claimed by some research groups. My data also indicate that the parietal attention site is organized in a `homunculus-like` fashion, similar to the cortical connections in the Macaque monkey. In the Alzheimer patients, the primary sensory stimulations elicited an altered pattern with activation of medial frontal structures in additional to the expected activations of the primary sensory cortices. During sustained attention the patients had a tendency to activate the same attention sites as the healthy elderly, but in addition significant deactivations were noted in the left and right medial and left superior frontal gyri (Brodmann Area 10), and the right posterior cingulate gyrus (Brodmann Area 23/31). During divided attention the activation pattern in the patients was very different from that of the healthy elderly. The right medial frontal gyrus (Broadmann Area 32) was activated but not the right-sided parietal or the frontal attention sites. Deactivations were seen in the right cuneus and putamen. The different activation patterns elicited by sustained and divided attention in the Alzheimer patients provide evidence of differential deficits in two attention sbutypes in Alzheimer`s disease, as reported in neuropsychological studies. The resting rCBF deficits and the altered cortical activation patterns during attention in the Alzheimer patients indicate that Alzheimer`s disease is the result of a specific pathophysiological process with distinct and localized lesions indicating that the disease is not a diffuse and global brain disease. The results further support the disconnection hypothesis of Alzheimer`s disease wich consider the disorder as a neocortical isolationsyndrome created by a disease process that spreads along
Parameters of importance to determine in geoscientific site studies
International Nuclear Information System (INIS)
Andersson, Johan; Almen, K.E.; Ericsson, L.O.; Karlsson, Fred; Stroem, A.; Fredriksson, Anders; Stanfors, R.
1996-12-01
This report identifies and describes parameters, that may be determined in a site characterization study, for performing functional and safety analyses of a deep rock repository for radioactive wastes. The report discusses data needs for rock engineering and for description of other environmental aspects. It is intended that the report be used as a basis for formulating the criteria of acceptance in evaluating a candidate site. The report describes how different parameters influence the safety function, and how they are evaluated in practice. The logical order of performing measurements, due to the need of in-data and influence on other measurements is also discussed. 65 refs
Plant remains of archaeological site Casa Vieja, Callango (Ica
Directory of Open Access Journals (Sweden)
José Roque
2013-06-01
Full Text Available A paleoethnobotanical study was carried out at the Middle Horizon archaeological site of Casa Vieja, located in Callango within the Lower Ica Valley. A total of 23 species were identified, all determined to be of the Magnoliopyta Division, 78 % (or 18 species were Magnoliopsid and 22% (or 15 species Liliopsid. The Fabaceae are the best represented family with 6 species. Most of the analyzed samples correspond to seeds of Gossypium barbadense “cotton”. Seventy percent of the species were probably used as food; 48% for artifact-making and construction and 52% for medicinal and curative purposes.
Diwan, Ravinder M.
1990-01-01
This work is part of the overall advanced main combustion chamber (AMCC) casting characterization program of the Materials and Processes Laboratory of the Marshall Space Flight Center. The influence of hydrogen on the tensile properties and ductility behavior of NASA-23 alloy were analyzed. NASA-23 and other referenced alloys in cast and hipped conditions were solution treated and aged under selected conditions and characterized using optical metallography, scanning electron microscopy, and electron microprobe analysis techniques. The yield strength of NASA-23 is not affected much by hydrogen under tensile tests carried at 5000 psig conditions; however, the ultimate strength and ductility properties are degraded. This implies that the physical mechanisms operating would be related to the plastic deformation process. The fracture surfaces characteristics of NASA-23 specimens tensile tested in hydrogen, helium, and air were also analyzed. These revealed surface cracks around specimen periphery with the fracture surface showing a combination of intergranular and transgranular modes of fracture. It is seen that the specimens charged in hydrogen seem to favor a more brittle fracture mode in comparison to air and helium charged specimens. The AMCC casting characterization program is to be analyzed for their hydrogen behavior. As a result of this program, the basic microstructural factors and fracture characteristics in some cases were analyzed.
Engineering study of generic site criteria for selected DOE plutonium facilities
International Nuclear Information System (INIS)
Kingsbury, R.J.; Greenwood, J.M.; Sandoval, M.D.
1980-09-01
The objectives of this study were to identify criteria that would be applied to selection of a site for plutonium facilities such as those at the Rocky Flats Plant, to establish the relative importance of these criteria, and to identify suitable areas within the United States for location of plutonium facilities with respect to these criteria. Sources of the site criteria identified include federal laws, federal agency regulations, state laws and regulations, and requirements associated with operations to be performed at the site. The criteria identified during the study were organized into 14 major categories. The relative importnace of each category and each criterion within the categories were established using group decision-making techniques. The major criteria categories, their assigned weight on a scale of 1 to 10, and their relative priority ranks are as follows: geology/seismicity; public safety; environmental impact; meteorology; hydrology; topography; transportation; utilities; personnel; safeguards/security; land area and availability; land use compatibility; and, public acceptance. A suitability analysis of the continental United States was performed using only those criteria that could be mapped at a national scale. Suitability was assessed with respect to each of these criteria, and individual suitability maps were prepared. A composite suitability map was generated using computerized overlay techniques. This map provides a starting point for identifying specific candidate sites if an actual site selection were to be conducted
Liu, Fuming; Yi, Shuping; Ma, Haiyi; Huang, Junyi; Tang, Yukun; Qin, Jianbo; Zhou, Wan-Huan
2017-12-20
This paper presents a demonstration of an integrated risk assessment and site investigation for groundwater contamination through a case study, in which the geologic and hydrogeological feature of the site and the blueprint of the fossil power plant (FPP) were closely analyzed. Predictions for groundwater contamination in case of accidents were performed by groundwater modeling system (GMS) and modular three-dimensional multispecies transport model (MT3DMS). Results indicate that the studied site area presents a semi-isolated hydrogeological unit with multiplicity in stratum lithology, the main aquifers at the site are consisted of the filled karst development layer with a thickness between 6.0 and 40.0 m. The poor permeability of the vadose zone at the FPP significantly restricted the infiltration of contaminants through the vadose zone to the subsurface. The limited influence of rarely isotropic porous karstified carbonate rocks on the groundwater flow system premised the simulate scenarios of plume migration. Analysis of the present groundwater chemistry manifested that that the groundwater at the site and the local area are of the HCO 3 -Ca, HCO 3 , and SO 4 -Ca types. A few of the water samples were contaminated by coliform bacteria and ammonia nitrogen as a result of the local cultivation. Prediction results indicate that the impact of normal construction and operation processes on the groundwater environment is negligible. However, groundwater may be partly contaminated within a certain period in the area of leakage from the diesel tanks, the industrial wastewater pool, and the cooling tower water tank in case of accidents. On a positive note, none of the plumes would reach the local sensitive areas for groundwater using. Finally, an anti-seepage scheme and a monitoring program are proposed to safeguard the groundwater protection. The integrated method of the site investigation and risk assessment used in this case study can facilitate the protection of
Site study plan for geochemical analytical requirements and methodologies: Revision 1
International Nuclear Information System (INIS)
1987-12-01
This site study plan documents the analytical methodologies and procedures that will be used to analyze geochemically the rock and fluid samples collected during Site Characterization. Information relating to the quality aspects of these analyses is also provided, where available. Most of the proposed analytical procedures have been used previously on the program and are sufficiently sensitive to yield high-quality analyses. In a few cases improvements in analytical methodology (e.g., greater sensitivity, fewer interferences) are desired. Suggested improvements to these methodologies are discussed. In most cases these method-development activities have already been initiated. The primary source of rock and fluid samples for geochemical analysis during Site Characterization will be the drilling program, as described in various SRP Site Study Plans. The Salt Repository Project (SRP) Networks specify the schedule under which the program will operate. Drilling will not begin until after site ground water baseline conditions have been established. The Technical Field Services Contractor (TFSC) is responsible for conducting the field program of drilling and testing. Samples and data will be handled and reported in accordance with established SRP procedures. A quality assurance program will be utilized to assure that activities affecting quality are performed correctly and that the appropriate documentation is maintained. 28 refs., 9 figs., 14 tabs
Donation return time at fixed and mobile donation sites
Carey, Patricia M.; High, Patrick M.; Schlumpf, Karen S.; Johnson, Bryce R.; Mast, Alan E.; Rios, Jorge A.; Simon, Toby L.; Wilkinson, Susan L.
2013-01-01
BACKGROUND This study investigated the effect of blood donation environment, fixed or mobile with differing sponsor types, on donation return time. STUDY DESIGN AND METHODS Data from 2006 through 2009 at six US blood centers participating in the Retrovirus Epidemiology Donor Study-II (REDS-II) were used for analysis. Descriptive statistics stratified by whole blood (WB), plateletpheresis (PP), and double red blood cell (R2) donations were obtained for fixed and mobile locations, including median number of donations and median interdonation interval. A survival analysis estimated median return time at fixed and mobile sites, while controlling for censored return times, demographics, blood center, and mandatory recovery times. RESULTS Two-thirds (67.9%) of WB donations were made at mobile sites, 97.4% of PP donations were made at fixed sites, and R2 donations were equally distributed between fixed and mobile locations. For donations at fixed sites only or alternating between fixed and mobile sites, the highest median numbers of donations were nine and eight, respectively, and the shortest model-adjusted median return times (controlling for mandatory eligibility times of 56 and 112 days) were 36 and 30 days for WB and R2 donations, respectively. For PP donations, the shortest model-adjusted median return time was 23 days at a fixed location and the longest was 693 days at community locations. CONCLUSION WB, PP, and R2 donors with the shortest time between donations were associated with fixed locations and those alternating between fixed and mobile locations, even after controlling for differing mandatory recovery times for the different blood donation procedures. PMID:21745215
Yassa, Rafik Rd; Khalfaoui, Mahdi Y; Veravalli, Karunakar; Evans, D Alun
2017-03-01
The aims of the current study were to determine whether pre-operative urinary tract infections in patients presenting acutely with neck of femur fractures resulted in a delay to surgery and whether such patients were at increased risk of developing post-operative surgical site infections. A retrospective review of all patients presenting with a neck of femur fracture, at a single centre over a one-year period. The hospital hip fracture database was used as the main source of data. UK University Teaching Hospital. All patients ( n = 460) presenting across a single year study period with a confirmed hip fracture. The presence of pre-operative urinary tract infection, the timing of surgical intervention, the occurrence of post-operative surgical site infection and the pathogens identified. A total of 367 patients were operated upon within 24 hours of admission. Urinary infections were the least common cause of delay. A total of 99 patients (21.5%) had pre-operative urinary tract infection. Post-operatively, a total of 57 (12.4%) patients developed a surgical site infection. Among the latter, 31 (54.4%) did not have a pre-operative urinary infection, 23 (40.4%) patients had a pre-operative urinary tract infection, 2 had chronic leg ulcers and one patient had a pre-operative chest infection. Statistically, there was a strong relationship between pre-operative urinary tract infection and the development of post-operative surgical site infection ( p -value: 0.0005). The results of our study indicate that pre-operative urinary tract infection has a high prevalence amongst those presenting with neck of femur fractures, and this is a risk factor for the later development of post-operative surgical site infection.
On-site disposal as a decommissioning strategy
International Nuclear Information System (INIS)
1999-11-01
On-site disposal is not a novel decommissioning strategy in the history of the nuclear industry. Several projects based on this strategy have been implemented. Moreover, a number of studies and proposals have explored variations within the strategy, ranging from in situ disposal of entire facilities or portions thereof to disposal within the site boundary of major components such as the reactor pressure vessel or steam generators. Regardless of these initiatives, and despite a significant potential for dose, radioactive waste and cost reduction, on-site disposal has often been disregarded as a viable decommissioning strategy, generally as the result of environmental and other public concerns. Little attention has been given to on-site disposal in previous IAEA publications in the field of decommissioning. The objective of this report is to establish an awareness of technical factors that may or may not favour the adoption of on-site disposal as a decommissioning strategy. In addition, this report presents an overview of relevant national experiences, studies and proposals. The expected end result is to show that, subject to safety and environmental protection assessment, on-site disposal can be a viable decommissioning option and should be taken into consideration in decision making
Directory of Open Access Journals (Sweden)
Cornelius Remschmidt
2016-11-01
Full Text Available Abstract Background In many industrialized countries routine vaccination with the 23-valent pneumococcal polysaccharide vaccine (PPSV-23 is recommended to prevent pneumococcal disease in the elderly. However, vaccine-induced immunity wanes after a few years, and there are controversies around revaccination with PPSV-23. Here, we systematically assessed the effectiveness and safety of PPSV-23 revaccination. Method We conducted a systematic literature review in MEDLINE, EMBASE, and Cochrane Central Register of Controlled Trials from inception to June 2015. We included all study types that compared effectiveness, immunogenicity and/or safety of PPSV-23 as a primary vs. a revaccination dose in persons aged 50 years and older. With respect to immunogenicity, we calculated the ratio of geometric mean antibody concentrations and opsonophagocytic indexes at identical time-points after primary and revaccination. Additionally, we compared rates and severity of adverse events (AEs after primary and revaccination. Results We included 14 observational studies. 10 studies had a prospective design and analysed data on (i the same individuals after a first and a second dose of PPSV-23 given 1 to 10 years later (n = 5 or (ii two groups consisting of participants receiving PPSV-23 who were either vaccine-naïve or had received a first PPSV-23 dose 3 to 13 years earlier (n = 5. Three studies used electronic data bases to compare AEs after primary vs. revaccination doses of PPSV-23 after 1 to 10 years and one study had a cross-sectional design. Number of participants in the non-register-based and register-based studies ranged from 29 to 1414 and 360 to 316,000, respectively. 11 out of 14 included studies were at high risk of bias, three studies had an unclear risk of bias. None of the studies reported data on clinical effectiveness. Immunogenicity studies revealed that during the first two months antibody levels tended to be lower after revaccination as compared to
International Nuclear Information System (INIS)
Cappucci, A.J. Jr.; Bowman, M.E.; Goff, L.
1997-01-01
A review was performed which identified open-quotes Lessons Learnedclose quotes from the development of the 5480.23 Tritium Safety Analysis Report (SAR) and the Technical Safety Requirements (TSR) for the Tritium Facilities (TF). The open-quotes Lessons Learnedclose quotes were based on an evaluation of the use of the SRS procedures, processes, and work practices which contributed to the success or lack thereof. This review also identified recommendations and suggestions for improving the development of SARs and TSRs at SRS. The 5480.23 SAR describes the site for the TF, the various process systems in the process buildings, a complete hazards and accident analysis of the most significant hazards affecting the nearby offsite population, and the selection of safety systems, structures, and components to protect both the public and site workers. It also provides descriptions of important programs and processes which add defense in depth to public and worker protection
Haukka, Eija; Leino-Arjas, Päivi; Ojajärvi, Anneli; Takala, Esa-Pekka; Viikari-Juntura, Eira; Riihimäki, Hilkka
2011-04-01
Among 385 female kitchen workers, we examined (1) whether mental stress and psychosocial factors at work (job control, skill discretion, supervisor support, co-worker relationships, and hurry) predict multiple-site musculoskeletal pain (MSP; defined as pain at ≥ 3 of seven sites) and (2) reversedly, whether MSP predicts these psychosocial factors. Data were collected by questionnaire at 3-month intervals during 2 years. Trajectory analysis was applied. Four trajectories of MSP prevalence emerged: Low, Descending, Ascending, and High. For the psychosocial factors, a two-trajectory model (Ascending or High vs. Low) yielded the best fit. In logistic regression analysis, with the Low MSP trajectory as reference, poor co-worker relationships (odds ratio [OR] 3.9), mental stress (3.1) and hurry (2.1) at baseline predicted belonging to the High MSP trajectory. Also MSP at baseline predicted the trajectories (Ascending vs. Low) of low job control (2.2) and mental stress (3.2). Adverse changes in most psychosocial factors were associated with belonging to the High (ORs between 2.3 and 8.6) and Ascending (2.7-5.5) MSP trajectories. In generalized estimating equations, time-lagged by 3 months, all psychosocial factors but two predicted MSP (1.4-2.1), allowing, e.g. for MSP at baseline, and vice versa, MSP predicted low job control, low supervisor support, and mental stress (1.4-2.0), after adjustment for e.g. the relevant psychosocial factor at baseline. In conclusion, we found that several psychosocial factors predicted MSP and that MSP predicted several psychosocial factors. The results suggest a cumulative process in which adverse psychosocial factors and MSP influence each other. Copyright © 2010 European Federation of International Association for the Study of Pain Chapters. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
1982-01-01
A method used for siting a compressed air energy storage (CAES) system using geotechnical and environmental criteria is explained using the siting of a proposed 220 MW water-compensated CAES plant in Illinois as an example. Information is included on the identification and comparative ranking of 28 geotechnically and environmental sites in Illinois, the examination of fatal flaws, e.g., mitigation, intensive studies, costly studies, permit denials, at 7 sites; and the selection of 3 sites for further geological surveying. (LCL)
Critical (public) masses: a case study of a radioactive waste site
International Nuclear Information System (INIS)
Williams, R.G.; Payne, B.A.
1985-01-01
Increasing public sensitivity to radioactive and other hazardous waste issues often results in opposition that ranges from presentations by individuals at various public meetings to organizations initiating legal action in the courts. Organized opposition to proposed plans by the US Department of Energy (DOE) for a Surplus Facilities Management Program site near Weldon Spring, Missouri, has emerged during the two years that DOE has been involved in developing plans for this waste management site. An important aspect in the development of the major interest group in this case was the reliance on extra-local expertise at both the state and national levels. The group received organizational strategies, information on radioactive waste, legal advice, and direction from state and local environmental interest groups and various state agencies. In this paper, the authors present the historical development of organized public response and agency response to DOE's plans for the Weldon Spring site. The role of the interest group has emerged as one of a watchdog, scrutinizing and evaluating data publications, and plans. Other organizations now rely on the group as a clearinghouse for information. This case is of particular importance to other waste management projects because it demonstrates the effective use of networking between various interest groups and agencies from the local to the national level. The authors believe that the emergence of such groups and their ties with a variety of extra-local organizations will be the rule rather than the exception in future waste projects. Agency personnel and project sponsors will find that an interactive, cooperative approach with such groups is an effective way to resolve waste issues. 9 references
Critical (public) masses: a case study of a radioactive waste site
International Nuclear Information System (INIS)
Williams, R.G.; Payne, B.A.
1985-01-01
Increasing public sensitivity to radioactive and other hazardous waste issues often results in opposition that ranges from presentations by individuals at various public meetings to organizations initiating legal action in the courts. Organized opposition to proposed plans by the US Department of Energy (DOE) for a Surplus Facilities Management Program site near Weldon Spring, Missouri, has emerged during the two years that DOE has been involved in developing plans for this waste management site. An important aspect in the development of the major interest group in this case was the reliance on extra-local expertise at both the state and national levels. The group received organizational strategies, information on radioactive waste, legal advice, and direction from state and local environmental interest groups and various state agencies. In this paper, we present the historical development of organized public response and agency response to DOE's plans for the Weldon Spring site. The role of the interest group has emerged as one of a watchdog, scrutinizing and evaluating data, publications, and plans. Other organizations now rely on the group as a clearinghouse for information. This case is of particular importance to other waste management projects because it demonstrates the effective use of networking between various interest groups and agencies from the local to the national level. We believe that the emergence of such groups and their ties with a variety of extra-local organizations will be the rule rather than the exception in future waste projects. Agency personnel and project sponsors will find that an interactive, cooperative approach with such groups is an effective way to resolve waste issues
Reading Psalm 23 In African Context
Directory of Open Access Journals (Sweden)
David T. Adamo
2018-04-01
Full Text Available The book of Psalms is the best known, most discussed and most cited book of the Old Testament. Psalm 23 especially is the most loved book of the Psalms. That must have been the reason why it was named ‘an American icon’ and the ‘nightingale of the Psalms’. Two major ways of reading this Psalm are: as a shepherd to a sheep and as God to a human. The author of this article reads Psalms 23 Africentrically, that is, as God to a human. This means that Psalms 23 is read for the purpose of protection, provision, healing and success in all aspects of life, which are the main concerns of African people. It means reading Psalm 23 existentially with African life interest. Intradisciplinary and/or interdisciplinary implications: This article is concerned with biblical studies, African Traditional Religion and culture and African Biblical Hermeneutics. It seeks to challenge the traditional Eurocentric approaches for its methodological approaches that do not make biblical studies adequately relevant to African Christianity. The book of Psalms is used as a perfect example of how it can be interpreted relevantly in Africa. Further implication is that there will be reduction of the Bible and Christianity looking like a foreign book and religion.
Energy Technology Data Exchange (ETDEWEB)
Stricker, Michael
2014-07-01
The documentation of the police operation during the demonstration against the NPP Grohnde on 16.03.1977 and the evacuation of the occupied cooling tower site on 23.08.1977 covers the following issues: involved action forces: police Niedersachsen, police Nordrhein-Westfalen, police Schleswig-Holstein, police Bremen and the Bundesgrenzschutz; concept of the police operation, provisions (lodging and board) for the police, operating resources, details of the operation sequence; post-processing of the operation; the Grohnde trials.
Future offshore sites for wind turbines - 2025; Denmark; Fremtidens havmoelleplaceringer - 2025
Energy Technology Data Exchange (ETDEWEB)
2007-04-15
The committee has analysed 23 concrete siting possibilities at 7 main areas. The committee recommends that any extension of ocean wind farms is decided according to cost priorities. The selected sites for establishing offshore wind farms are: Djursland-Anholt in Kattegat, Horns Rev, Jammerbugten and off Ringkoebing in the North Sea, Store Middelgrund in Kattegat, and Kriegers Flak and Roenne Banke in the Baltic Sea. Wind data and power potential are presented for each of the selected sites. (ln)
Swiss post office on the Meyrin site
2006-01-01
As of 4 September 2006, the post office on the Meyrin site will be open to the public from 9.00 a.m. to 4.00 p.m non-stop Mondays to Fridays. NB: the Meyrin 1 post office (23, avenue de Feuillasse) is open from 8.00 a.m. to 6.00 p.m. and the Meyrin 2 Village post office (3, chemin Antoine-Verchère) from 8.00 a.m. to 12.00 a.m. and from 3.00 p.m. to 6.00 p.m. For further information, please contact the Meyin Site post office on 72798. Relations with the Host States Service http://www.cern.ch/relations/ relations.secretariat@cern.ch Tel. 72848
SWISS POST OFFICE ON THE MEYRIN SITE
2006-01-01
As of 4 September 2006, the post office on the Meyrin site will be open to the public from 9.00 a.m. to 4.00 p.m non-stop Mondays to Fridays. NB: the Meyrin 1 post office (23, avenue de Feuillasse) is open from 8.00 a.m. to 6.00 p.m. and the Meyrin 2 Village post office (3, chemin Antoine-Verchère) from 8.00 a.m. to 12.00 a.m. and from 3.00 p.m. to 6.00 p.m. For further information, please contact the Meyin Site post office on 72798. Relations with the Host States Service http://www.cern.ch/relations/ relations.secretariat@cern.ch Tel. 72848
Side by Side: What a Comparative Usability Study Told Us about a Web Site Redesign
Dougan, Kirstin; Fulton, Camilla
2009-01-01
Library Web sites must compete against easy-to-use sites, such as Google Scholar, Google Books, and Wikipedia, for students' time and attention. Library Web sites must therefore be designed with aesthetics and user perceptions at the forefront. The Music and Performing Arts Library at Urbana-Champaign's Web site was overcrowded and in much need of…
2[125I]Iodomelatonin binding sites in spleens of guinea pigs
International Nuclear Information System (INIS)
Poon, A.M.S.; Pang, S.F.
1992-01-01
2-[ 125 I]Iodomelatonin was found to bind specifically to the membrane preparations of the spleens of guinea pigs with high affinity. The binding was rapid, stable, saturable and reversible. Scatchard analysis of the binding assays revealed an equilibrium dissociation constant (Kd) of 49.8±4.12 pmol/l and binding site density (Bmax) of 0.69±0.082 fmol/mg protein at mid-light. There was no significant change in the Kd or the Bmax at mid-dark. Kinetic analysis showed a Kd of 23.13±4.81 pmol/l, in agreement to that derived from the saturation studies. The 2-[ 125 I]iodomelatonin binding sites have the following order of potency: 2-iodomelatonin > melatonin > 6-chloromelatonin much-gt N-acetylserotonin, 6-hydroxymelatonin > 5-methoxytryptamine, 5-methoxytryptophol > serotonin, 5-methoxyindole-3-acetic acid > 5-hydroxytryptophol, 3-acetylindole, 1-acetylindole-3-carboxyaldehyde, L-tryptophan > tryptamine, 5-hydroxyindole-3-acetic acid. Differential centrifugation studies showed that the binding sites are localized mainly in the nuclear fraction, the rest are distributed in the microsomal fraction, mitochondrial fraction and cytosolic fraction. The demonstration of 2-[ 125 I]iodomelatonin binding sites in the spleen suggests the presence of melatonin receptors and a direct mechanism of action of melatonin on the immune system
Energy Technology Data Exchange (ETDEWEB)
Sessler, J.L.; Mody, T.D. (Texas Univ., Austin, TX (United States). Dept. of Chemistry); Ramasamy, R.; Sherry, A.D. (Texas Univ., Dallas, TX (United States))
1992-05-01
The synthesis and characterization of a novel dysprosium(III) crown-ether texaphyrin (Dy(BCTxp)){sup 2+} is reported. This complex was designed to serve as a ditopic chelate for both dysprosium(III) and sodium cations. {sup 23}Sodium NMR spectroscopic studies indicates that titration of Na{sup +} with increasing concentrations of (Dy(BCTxp)){sup 2+} results in a shift toward higher frequency and gives a net hyperfine shift of 0.86 ppm. Sodium complexation is taking place into the crown subunit in (Dy(BCTxp)){sup 2+} and the degree of complexation is not reduced substantially by the positive charge on the dysprosium(III) portion of this binucleating system.
Energy Technology Data Exchange (ETDEWEB)
Simon, J.; Mosey, G.
2013-01-01
The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Sky Park Landfill site in Eau Claire, Wisconsin, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.
Energy Technology Data Exchange (ETDEWEB)
Stoltenberg, B.; Konz, C.; Mosey, G.
2013-05-01
The U.S. Environmental Protection Agency (EPA), in accordance with the RE-Powering America's Land initiative, selected the Former Fort Ord Army Base (FOAB) site in Marina, California, for a feasibility study of renewable energy production. The National Renewable Energy Laboratory (NREL) provided technical assistance for this project. The purpose of this report is to assess the site for a possible photovoltaic (PV) system installation and estimate the cost, performance, and site impacts of different PV options. In addition, the report recommends financing options that could assist in the implementation of a PV system at the site.
International Nuclear Information System (INIS)
Lappin, A.R.
1988-01-01
The Waste Isolation Pilot Plant (WIPP) is being excavated at a depth of approximately 655 m in bedded halites. Site-characterization activities at the WIPP site began in 1976. Characterization activities since 1983 have had the objective of updating the conceptual model for the geologic and hydrologic behavior of the WIPP site and vicinity. This paper discusses aspects of the general conceptual model significant to both site characterization and performance assessment. The geological and hydrologic behavior of the WIPP site and vicinity is transient, and has been transient since at least deposition of the Permian Salado Formation containing the underground workings of the WIPP facility. The Salado Formation deforms regionally in response to gravity, but is very low in permeability, except within approximately two meters of the WIPP facility. The Culebra Dolomite Member of the Rustler Formation dominates the hydrology at the WIPP site. Hydrologic measurements, geologic studies, major-element and minor-element distributions in Culebra fluids, and the results of isotopic studies (stable-isotope, radiocarbon, uranium-disequilibrium, and 87 Sr/ 86 Sr) are consistent with the interpretations that, although the Culebra dominates flow within the Rustler at the WIPP site and Rustler karst is not present, there has been limited vertical fluid movement within the Rustler and between the Rustler and the overlying Dewey Lake Red Beds
Bachoura, Abdo; Guitton, Thierry G; Smith, R Malcolm; Vrahas, Mark S; Zurakowski, David; Ring, David
2011-09-01
Orthopaedic surgical-site infections prolong hospital stays, double rehospitalization rates, and increase healthcare costs. Additionally, patients with orthopaedic surgical-site infections (SSI) have substantially greater physical limitations and reductions in their health-related quality of life. However, the risk factors for SSI after operative fracture care are unclear. We determined the incidence and quantified modifiable and nonmodifiable risk factors for SSIs in patients with orthopaedic trauma undergoing surgery. We retrospectively indentified, from our prospective trauma database and billing records, 1611 patients who underwent 1783 trauma-related procedures between 2006 and 2008. Medical records were reviewed and demographics, surgery-specific data, and whether the patients had an SSI were recorded. We determined which if any variables predicted SSI. Six factors independently predicted SSI: (1) the use of a drain, OR 2.3, 95% CI (1.3-3.8); (2) number of operations OR 3.4, 95% CI (2.0-6.0); (3) diabetes, OR 2.1, 95% CI (1.2-3.8); (4) congestive heart failure (CHF), OR 2.8, 95% CI (1.3-6.5); (5) site of injury tibial shaft/plateau, OR 2.3, 95% CI (1.3-4.2); and (6) site of injury, elbow, OR 2.2, 95% CI (1.1-4.7). The risk factors for SSIs after skeletal trauma are most strongly determined by nonmodifiable factors: patient infirmity (diabetes and heart failure) and injury complexity (site of injury, number of operations, use of a drain). Level II, prognostic study. See the Guideline for Authors for a complete description of levels of evidence.