WorldWideScience

Sample records for single-scattering albedo ssa

  1. Assessing the measurement of aerosol single scattering albedo by Cavity Attenuated Phase-Shift Single Scattering Monitor (CAPS PMssa)

    Science.gov (United States)

    Perim de Faria, Julia; Bundke, Ulrich; Onasch, Timothy B.; Freedman, Andrew; Petzold, Andreas

    2016-04-01

    The necessity to quantify the direct impact of aerosol particles on climate forcing is already well known; assessing this impact requires continuous and systematic measurements of the aerosol optical properties. Two of the main parameters that need to be accurately measured are the aerosol optical depth and single scattering albedo (SSA, defined as the ratio of particulate scattering to extinction). The measurement of single scattering albedo commonly involves the measurement of two optical parameters, the scattering and the absorption coefficients. Although there are well established technologies to measure both of these parameters, the use of two separate instruments with different principles and uncertainties represents potential sources of significant errors and biases. Based on the recently developed cavity attenuated phase shift particle extinction monitor (CAPS PM_{ex) instrument, the CAPS PM_{ssa instrument combines the CAPS technology to measure particle extinction with an integrating sphere capable of simultaneously measuring the scattering coefficient of the same sample. The scattering channel is calibrated to the extinction channel, such that the accuracy of the single scattering albedo measurement is only a function of the accuracy of the extinction measurement and the nephelometer truncation losses. This gives the instrument an accurate and direct measurement of the single scattering albedo. In this study, we assess the measurements of both the extinction and scattering channels of the CAPS PM_{ssa through intercomparisons with Mie theory, as a fundamental comparison, and with proven technologies, such as integrating nephelometers and filter-based absorption monitors. For comparison, we use two nephelometers, a TSI 3563 and an Aurora 4000, and two measurements of the absorption coefficient, using a Particulate Soot Absorption Photometer (PSAP) and a Multi Angle Absorption Photometer (MAAP). We also assess the indirect absorption coefficient

  2. An algorithm to determine backscattering ratio and single scattering albedo

    Digital Repository Service at National Institute of Oceanography (India)

    Suresh, T.; Desa, E.; Matondkar, S.G.P.; Mascarenhas, A.A.M.Q.; Nayak, S.R.; Naik, P.

    Algorithms to determine the inherent optical properties of water, backscattering probability and single scattering albedo at 490 and 676 nm from the apparent optical property, remote sensing reflectance are presented here. The measured scattering...

  3. Effective single scattering albedo estimation using regional climate model

    CSIR Research Space (South Africa)

    Tesfaye, M

    2011-09-01

    Full Text Available In this study, by modifying the optical parameterization of Regional Climate model (RegCM), the authors have computed and compared the Effective Single-Scattering Albedo (ESSA) which is a representative of VIS spectral region. The arid, semi...

  4. Comparisons of spectral aerosol single scattering albedo in Seoul, South Korea

    Science.gov (United States)

    Mok, Jungbin; Krotkov, Nickolay A.; Torres, Omar; Jethva, Hiren; Li, Zhanqing; Kim, Jhoon; Koo, Ja-Ho; Go, Sujung; Irie, Hitoshi; Labow, Gordon; Eck, Thomas F.; Holben, Brent N.; Herman, Jay; Loughman, Robert P.; Spinei, Elena; Lee, Seoung Soo; Khatri, Pradeep; Campanelli, Monica

    2018-04-01

    Quantifying aerosol absorption at ultraviolet (UV) wavelengths is important for monitoring air pollution and aerosol amounts using current (e.g., Aura/OMI) and future (e.g., TROPOMI, TEMPO, GEMS, and Sentinel-4) satellite measurements. Measurements of column average atmospheric aerosol single scattering albedo (SSA) are performed on the ground by the NASA AERONET in the visible (VIS) and near-infrared (NIR) wavelengths and in the UV-VIS-NIR by the SKYNET networks. Previous comparison studies have focused on VIS and NIR wavelengths due to the lack of co-incident measurements of aerosol and gaseous absorption properties in the UV. This study compares the SKYNET-retrieved SSA in the UV with the SSA derived from a combination of AERONET, MFRSR, and Pandora (AMP) retrievals in Seoul, South Korea, in spring and summer 2016. The results show that the spectrally invariant surface albedo assumed in the SKYNET SSA retrievals leads to underestimated SSA compared to AMP values at near UV wavelengths. Re-processed SKYNET inversions using spectrally varying surface albedo, consistent with the AERONET retrieval improve agreement with AMP SSA. The combined AMP inversions allow for separating aerosol and gaseous (NO2 and O3) absorption and provide aerosol retrievals from the shortest UVB (305 nm) through VIS to NIR wavelengths (870 nm).

  5. Retrievals and uncertainty analysis of aerosol single scattering albedo from MFRSR measurements

    International Nuclear Information System (INIS)

    Yin, Bangsheng; Min, Qilong; Joseph, Everette

    2015-01-01

    Aerosol single scattering albedo (SSA) can be retrieved from the ratio of diffuse horizontal and direct normal fluxes measured from multifilter rotating shadowband radiometer (MFRSR). In this study, the measurement channels at 415 nm and 870 nm are selected for aerosol optical depth (AOD) and Angstrom coefficient retrievals, and the measurements at 415 nm are used for aerosol SSA retrievals with the constraint of retrieved Angstrom coefficient. We extensively assessed various issues impacting on the accuracy of SSA retrieval from measurements to input parameters and assumptions. For cloud-free days with mean aerosol loading of 0.13–0.60, our sensitivity study indicated that: (1) 1% calibration uncertainty can result in 0.8–3.7% changes in retrieved SSA; (2) without considering the cosine respond correction and/or forward scattering correction will result in underestimation of 1.1–3.3% and/or 0.73% in retrieved SSA; (3) an overestimation of 0.1 in asymmetry factor can result in an underestimation of 2.54–3.4% in retrieved SSA; (4) for small aerosol loading (e.g., 0.13), the uncertainty associated with the choice of Rayleigh optical depth value can result in non-negligible change in retrieved SSA (e.g., 0.015); (5) an uncertainty of 0.05 for surface albedo can result in changes of 1.49–5.4% in retrieved SSA. We applied the retrieval algorithm to the MFRSR measurements at the Atmospheric Radiation Measurements (ARM) Southern Great Plains (SGP) site. The retrieved results of AOD, Angstrom coefficient, and SSA are basically consistent with other independent measurements from co-located instruments at the site. - Highlights: • Aerosol SSA is derived from MFRSR measured diffuse to direct normal irradiance ratio. • We extensively assessed various issues impacting on the accuracy of SSA retrieval. • The issues are mainly from measurements and model input parameters and assumptions. • We applied the retrieval algorithm to the MFRSR measurements at ARM SGP

  6. Constrained energy minimization applied to apparent reflectance and single-scattering albedo spectra: a comparison

    Science.gov (United States)

    Resmini, Ronald G.; Graver, William R.; Kappus, Mary E.; Anderson, Mark E.

    1996-11-01

    Constrained energy minimization (CEM) has been applied to the mapping of the quantitative areal distribution of the mineral alunite in an approximately 1.8 km2 area of the Cuprite mining district, Nevada. CEM is a powerful technique for rapid quantitative mineral mapping which requires only the spectrum of the mineral to be mapped. A priori knowledge of background spectral signatures is not required. Our investigation applies CEM to calibrated radiance data converted to apparent reflectance (AR) and to single scattering albedo (SSA) spectra. The radiance data were acquired by the 210 channel, 0.4 micrometers to 2.5 micrometers airborne Hyperspectral Digital Imagery Collection Experiment sensor. CEM applied to AR spectra assumes linear mixing of the spectra of the materials exposed at the surface. This assumption is likely invalid as surface materials, which are often mixtures of particulates of different substances, are more properly modeled as intimate mixtures and thus spectral mixing analyses must take account of nonlinear effects. One technique for approximating nonlinear mixing requires the conversion of AR spectra to SSA spectra. The results of CEM applied to SSA spectra are compared to those of CEM applied to AR spectra. The occurrence of alunite is similar though not identical to mineral maps produced with both the SSA and AR spectra. Alunite is slightly more widespread based on processing with the SSA spectra. Further, fractional abundances derived from the SSA spectra are, in general, higher than those derived from AR spectra. Implications for the interpretation of quantitative mineral mapping with hyperspectral remote sensing data are discussed.

  7. Seasonal variation of the single scattering albedo of the Jungfraujoch aerosol

    Energy Technology Data Exchange (ETDEWEB)

    Collaud Coen, M.; Weingartner, E.; Corrigan, C.; Baltensperger, U.

    2003-03-01

    The single scattering albedo ({omega}{sub 0}) represents the fraction of the light extinction due to scattering. It is there-fore a key parameter to estimate the aerosol direct radiative forcing. The seasonal and diurnal variation of the single scattering albedo was calculated for the Jungfraujoch dry aerosol, which is representative for clean remote continental conditions. The values of {omega}{sub 0} vary between 0.7 and 0.9 depending on the season and on the wavelength. (author)

  8. Retrieving Single Scattering Albedos and Temperatures from CRISM Hyperspectral Data Using Neural Networks

    Science.gov (United States)

    He, L.; Arvidson, R. E.; O'Sullivan, J. A.

    2018-04-01

    We use a neural network (NN) approach to simultaneously retrieve surface single scattering albedos and temperature maps for CRISM data from 1.40 to 3.85 µm. It approximates the inverse of DISORT which simulates solar and emission radiative streams.

  9. Aerosol optical properties measurements by a CAPS single scattering albedo monitor: Comparisons between summer and winter in Beijing, China

    Science.gov (United States)

    Han, Tingting; Xu, Weiqi; Li, Jie; Freedman, Andrew; Zhao, Jian; Wang, Qingqing; Chen, Chen; Zhang, Yingjie; Wang, Zifa; Fu, Pingqing; Liu, Xingang; Sun, Yele

    2017-02-01

    Aerosol optical properties were measured in Beijing in summer and winter using a state-of-the-art cavity attenuated phase shift single scattering albedo monitor (CAPS PMssa) along with aerosol composition measurements by aerosol mass spectrometers and aethalometers. The SSA directly measured by the CAPS PMssa showed overall agreements with those derived from colocated measurements. However, substantial differences were observed during periods with low SSA values in both summer and winter, suggesting that interpretation of low SSA values needs to be cautious. The average (±σ) extinction coefficient (bext) and absorption coefficient (bap) were 336 (±343) Mm-1 and 44 (±41) Mm-1, respectively, during wintertime, which were approximately twice those observed in summer, while the average SSA was relatively similar, 0.86 (±0.06) and 0.85 (±0.04) in summer and winter, respectively. Further analysis showed that the variations in SSA can be approximately parameterized as a function of mass fraction of secondary particulate matter (fSPM), which is SSA = 0.74 + 0.19 × fSPM (fSPM > 0.3, r2 = 0.85). The contributions of aerosol species to extinction coefficients during the two seasons were also estimated. Our results showed that the light extinction was dominantly contributed by ammonium sulfate (30%) and secondary organic aerosol (22%) in summer, while organic aerosol was the largest contributor (51%) in winter. Consistently, SPM played the major role in visibility degradation in both seasons by contributing 70% of the total extinction.

  10. Comparison of AOD, AAOD and column single scattering albedo from AERONET retrievals and in situ profiling measurements

    Science.gov (United States)

    Andrews, Elisabeth; Ogren, John A.; Kinne, Stefan; Samset, Bjorn

    2017-05-01

    Here we present new results comparing aerosol optical depth (AOD), aerosol absorption optical depth (AAOD) and column single scattering albedo (SSA) obtained from in situ vertical profile measurements with AERONET ground-based remote sensing from two rural, continental sites in the US. The profiles are closely matched in time (within ±3 h) and space (within 15 km) with the AERONET retrievals. We have used Level 1.5 inversion retrievals when there was a valid Level 2 almucantar retrieval in order to be able to compare AAOD and column SSA below AERONET's recommended loading constraint (AOD > 0.4 at 440 nm). While there is reasonable agreement for the AOD comparisons, the direct comparisons of in situ-derived to AERONET-retrieved AAOD (or SSA) reveal that AERONET retrievals yield higher aerosol absorption than obtained from the in situ profiles for the low aerosol optical depth conditions prevalent at the two study sites. However, it should be noted that the majority of SSA comparisons for AOD440 > 0.2 are, nonetheless, within the reported SSA uncertainty bounds. The observation that, relative to in situ measurements, AERONET inversions exhibit increased absorption potential at low AOD values is generally consistent with other published AERONET-in situ comparisons across a range of locations, atmospheric conditions and AOD values. This systematic difference in the comparisons suggests a bias in one or both of the methods, but we cannot assess whether the AERONET retrievals are biased towards high absorption or the in situ measurements are biased low. Based on the discrepancy between the AERONET and in situ values, we conclude that scaling modeled black carbon concentrations upwards to match AERONET retrievals of AAOD should be approached with caution as it may lead to aerosol absorption overestimates in regions of low AOD. Both AERONET retrievals and in situ measurements suggest there is a systematic relationship between SSA and aerosol amount (AOD or aerosol light

  11. Laboratory estimate of the regional shortwave refractive index and single scattering albedo of mineral dust from major sources worldwide

    Science.gov (United States)

    Di Biagio, C.; Formenti, P.; Caponi, L.; Cazaunau, M.; Pangui, E.; Journet, E.; Nowak, S.; Caquineau, S.; Andreae, M. O.; Kandler, K.; Saeed, T.; Piketh, S.; Seibert, D.; Williams, E.; Balkanski, Y.; Doussin, J. F.

    2017-12-01

    Mineral dust is one of the most abundant aerosol species in the atmosphere and strongly contributes to the global and regional direct radiative effect. Still large uncertainties persist on the magnitude and overall sign of the dust direct effect, where indeed one of the main unknowns is how much mineral dust absorbs light in the shortwave (SW) spectral range. Aerosol absorption is represented both by the imaginary part (k) of the complex refractive index or the single scattering albedo (SSA, i.e. the ratio of the scattering to extinction coefficient). In this study we present a new dataset of SW complex refractive indices and SSA for mineral dust aerosols obtained from in situ measurements in the 4.2 m3 CESAM simulation chamber at LISA (Laboratoire Interuniversitaire des Systemes Atmospheriques) in Créteil, France. Investigated dust aerosol samples were issued from major desert sources worldwide, including the African Sahara and Sahel, Eastern Asia, the Middle East, Southern Africa, Australia, and the Americas, with differing iron oxides content. Results from the present study provide a regional mapping of the SW absorption by dust and show that the imaginary part of the refractive index largely varies (by up to a factor 6, 0.003-0.02 at 370 nm and 0.001-0.003 at 950 nm) for the different source areas due to the change in the particle iron oxide content. The SSA for dust varies between 0.75-0.90 at 370 nm and 0.95-0.99 at 950 nm, with the largest absorption observed for Sahelian and Australian dust aerosols. Our range of variability for k and SSA is well bracketed by already published literature estimates, but suggests that regional‒dependent values should be used in models. The possible relationship between k and the dust iron oxides content is investigated with the aim of providing a parameterization of the regional‒dependent dust absorption to include in climate models.

  12. Measurements of Nascent Soot Using a Cavity Attenauted Phase Shift (CAPS)-based Single Scattering Albedo Monitor

    Science.gov (United States)

    Freedman, A.; Onasch, T. B.; Renbaum-Wollf, L.; Lambe, A. T.; Davidovits, P.; Kebabian, P. L.

    2015-12-01

    Accurate, as compared to precise, measurement of aerosol absorption has always posed a significant problem for the particle radiative properties community. Filter-based instruments do not actually measure absorption but rather light transmission through the filter; absorption must be derived from this data using multiple corrections. The potential for matrix-induced effects is also great for organic-laden aerosols. The introduction of true in situ measurement instruments using photoacoustic or photothermal interferometric techniques represents a significant advance in the state-of-the-art. However, measurement artifacts caused by changes in humidity still represent a significant hurdle as does the lack of a good calibration standard at most measurement wavelengths. And, in the absence of any particle-based absorption standard, there is no way to demonstrate any real level of accuracy. We, along with others, have proposed that under the circumstance of low single scattering albedo (SSA), absorption is best determined by difference using measurement of total extinction and scattering. We discuss a robust, compact, field deployable instrument (the CAPS PMssa) that simultaneously measures airborne particle light extinction and scattering coefficients and thus the single scattering albedo (SSA) on the same sample volume. The extinction measurement is based on cavity attenuated phase shift (CAPS) techniques as employed in the CAPS PMex particle extinction monitor; scattering is measured using integrating nephelometry by incorporating a Lambertian integrating sphere within the sample cell. The scattering measurement is calibrated using the extinction measurement of non-absorbing particles. For small particles and low SSA, absorption can be measured with an accuracy of 6-8% at absorption levels as low as a few Mm-1. We present new results of the measurement of the mass absorption coefficient (MAC) of soot generated by an inverted methane diffusion flame at 630 nm. A value

  13. Modelling of strong heterogeneities in aerosol single scattering albedos over a polluted region

    Science.gov (United States)

    Mallet, M.; Pont, V.; Liousse, C.

    2005-05-01

    To date, most models dedicated to the investigation of aerosol direct or semi-direct radiative forcings have assumed the various aerosol components to be either completely externally mixed or homogeneously internally mixed. Some recent works have shown that a core-shell treatment of particles should be more realistic, leading to significant differences in the radiative impact as compared to only externally or well-internally mixed states. To account for these studies, an optical module, ORISAM-RAD, has been developed for computing aerosol radiative properties under the hypothesis of internally mixed particles with a n-layer spherical concentric structure. Mesoscale simulations using ORISAM-RAD, coupled with the 3D mesoscale model Meso-NH-C, have been performed for one selected day (06/24/2001) during the ESCOMPTE experiment in the Marseilles-Fos/Berre region, which illustrate the ability of this new module to reproduce spatial heterogeneities of measured single scattering albedo (ωo), due to industrial and/or urban pollution plumes.

  14. Vertical variability of aerosol single-scattering albedo and equivalent black carbon concentration based on in-situ and remote sensing techniques during the iAREA campaigns in Ny-Ålesund

    Science.gov (United States)

    Markowicz, K. M.; Ritter, C.; Lisok, J.; Makuch, P.; Stachlewska, I. S.; Cappelletti, D.; Mazzola, M.; Chilinski, M. T.

    2017-09-01

    This work presents a methodology for obtaining vertical profiles of aerosol single scattering properties based on a combination of different measurement techniques. The presented data were obtained under the iAREA (Impact of absorbing aerosols on radiative forcing in the European Arctic) campaigns conducted in Ny-Ålesund (Spitsbergen) during the spring seasons of 2015-2017. The retrieval uses in-situ observations of black carbon concentration and absorption coefficient measured by a micro-aethalometer AE-51 mounted onboard a tethered balloon, as well as remote sensing data obtained from sun photometer and lidar measurements. From a combination of the balloon-borne in-situ and the lidar data, we derived profiles of single scattering albedo (SSA) as well as absorption, extinction, and aerosol number concentration. Results have been obtained in an altitude range from about 400 m up to 1600 m a.s.l. and for cases with increased aerosol load during the Arctic haze seasons of 2015 and 2016. The main results consist of the observation of increasing values of equivalent black carbon (EBC) and absorption coefficient with altitude, and the opposite trend for aerosol concentration for particles larger than 0.3 μm. SSA was retrieved with the use of lidar Raman and Klett algorithms for both 532 and 880 nm wavelengths. In most profiles, SSA shows relatively high temporal and altitude variability. Vertical variability of SSA computed from both methods is consistent; however, some discrepancy is related to Raman retrieval uncertainty and absorption coefficient estimation from AE-51. Typically, very low EBC concentration in Ny-Ålesund leads to large error in the absorbing coefficient. However, SSA uncertainty for both Raman and Klett algorithms seems to be reasonable, e.g. SSA of 0.98 and 0.95 relate to an error of ±0.01 and ± 0.025, respectively.

  15. Measurement of size-dependent single scattering albedo of fresh biomass burning aerosols using the extinction-minus-scattering technique with a combination of cavity ring-down spectroscopy and nephelometry

    Directory of Open Access Journals (Sweden)

    S. Singh

    2016-11-01

    Full Text Available Biomass burning (BB aerosols have a significant effect on regional climate, and represent a significant uncertainty in our understanding of climate change. Using a combination of cavity ring-down spectroscopy and integrating nephelometry, the single scattering albedo (SSA and Ångstrom absorption exponent (AAE were measured for several North American biomass fuels. This was done for several particle diameters for the smoldering and flaming stage of white pine, red oak, and cedar combustion. Measurements were done over a wider wavelength range than any previous direct measurement of BB particles. While the offline sampling system used in this work shows promise, some changes in particle size distribution were observed, and a thorough evaluation of this method is required. The uncertainty of SSA was 6 %, with the truncation angle correction of the nephelometer being the largest contributor to error. While scattering and extinction did show wavelength dependence, SSA did not. SSA values ranged from 0.46 to 0.74, and were not uniformly greater for the smoldering stage than the flaming stage. SSA values changed with particle size, and not systematically so, suggesting the proportion of tar balls to fractal black carbon change with fuel type/state and particle size. SSA differences of 0.15–0.4 or greater can be attributed to fuel type or fuel state for fresh soot. AAE values were quite high (1.59–5.57, despite SSA being lower than is typically observed in wildfires. The SSA and AAE values in this work do not fit well with current schemes that relate these factors to the modified combustion efficiency of a burn. Combustion stage, particle size, fuel type, and fuel condition were found to have the most significant effects on the intrinsic optical properties of fresh soot, though additional factors influence aged soot.

  16. SCAP-82, Single Scattering, Albedo Scattering, Point-Kernel Analysis in Complex Geometry

    International Nuclear Information System (INIS)

    Disney, R.K.; Vogtman, S.E.

    1987-01-01

    1 - Description of problem or function: SCAP solves for radiation transport in complex geometries using the single or albedo scatter point kernel method. The program is designed to calculate the neutron or gamma ray radiation level at detector points located within or outside a complex radiation scatter source geometry or a user specified discrete scattering volume. Geometry is describable by zones bounded by intersecting quadratic surfaces within an arbitrary maximum number of boundary surfaces per zone. Anisotropic point sources are describable as pointwise energy dependent distributions of polar angles on a meridian; isotropic point sources may also be specified. The attenuation function for gamma rays is an exponential function on the primary source leg and the scatter leg with a build- up factor approximation to account for multiple scatter on the scat- ter leg. The neutron attenuation function is an exponential function using neutron removal cross sections on the primary source leg and scatter leg. Line or volumetric sources can be represented as a distribution of isotropic point sources, with un-collided line-of-sight attenuation and buildup calculated between each source point and the detector point. 2 - Method of solution: A point kernel method using an anisotropic or isotropic point source representation is used, line-of-sight material attenuation and inverse square spatial attenuation between the source point and scatter points and the scatter points and detector point is employed. A direct summation of individual point source results is obtained. 3 - Restrictions on the complexity of the problem: - The SCAP program is written in complete flexible dimensioning so that no restrictions are imposed on the number of energy groups or geometric zones. The geometric zone description is restricted to zones defined by boundary surfaces defined by the general quadratic equation or one of its degenerate forms. The only restriction in the program is that the total

  17. Aerosol single-scattering albedo and asymmetry parameter from MFRSR observations during the ARM Aerosol IOP 2003

    Directory of Open Access Journals (Sweden)

    E. I. Kassianov

    2007-06-01

    Full Text Available Multi-filter Rotating Shadowband Radiometers (MFRSRs provide routine measurements of the aerosol optical depth (τ at six wavelengths (0.415, 0.5, 0.615, 0.673, 0.870 and 0.94 μm. The single-scattering albedo0 is typically estimated from the MFRSR measurements by assuming the asymmetry parameter (g. In most instances, however, it is not easy to set an appropriate value of g due to its strong temporal and spatial variability. Here, we introduce and validate an updated version of our retrieval technique that allows one to estimate simultaneously π0 and g for different types of aerosol. We use the aerosol and radiative properties obtained during the Atmospheric Radiation Measurement (ARM Program's Aerosol Intensive Operational Period (IOP to validate our retrieval in two ways. First, the MFRSR-retrieved optical properties are compared with those obtained from independent surface, Aerosol Robotic Network (AERONET, and aircraft measurements. The MFRSR-retrieved optical properties are in reasonable agreement with these independent measurements. Second, we perform radiative closure experiments using the MFRSR-retrieved optical properties. The calculated broadband values of the direct and diffuse fluxes are comparable (~5 W/m2 to those obtained from measurements.

  18. THEORETICAL MODELLING STUDY ON THE RELATIONSHIP BETWEEN MULTI-FREQUENCY MICROWAVE VEGETATION INDEX AND VEGETATION PROPERTIES (OPTICAL DEPTH AND SINGLE SCATTERING ALBEDO

    Directory of Open Access Journals (Sweden)

    S. Talebi

    2018-04-01

    Full Text Available This paper presents a theoretical study of derivation Microwave Vegetation Indices (MVIs in different pairs of frequencies using two methods. In the first method calculating MVI in different frequencies based on Matrix Doubling Model (to take in to account multi scattering effects has been done and analyzed in various soil properties. The second method was based on MVI theoretical basis and its independency to underlying soil surface signals. Comparing the results from two methods with vegetation properties (single scattering albedo and optical depth indicated partial correlation between MVI from first method and optical depth, and full correlation between MVI from second method and vegetation properties. The second method to derive MVI can be used widely in global microwave vegetation monitoring.

  19. Continental pollution in the Western Mediterranean basin: large variability of the aerosol single scattering albedo and influence on the direct shortwave radiative effect

    Directory of Open Access Journals (Sweden)

    C. Di Biagio

    2016-08-01

    Full Text Available Pollution aerosols strongly influence the composition of the Western Mediterranean basin, but at present little is known on their optical properties. We report in this study in situ observations of the single scattering albedo (ω of pollution aerosol plumes measured over the Western Mediterranean basin during the TRAQA (TRansport and Air QuAlity airborne campaign in summer 2012. Cases of pollution export from different source regions around the basin and at different altitudes between  ∼  160 and 3500 m above sea level were sampled during the flights. Data from this study show a large variability of ω, with values between 0.84–0.98 at 370 nm and 0.70–0.99 at 950 nm. The single scattering albedo generally decreases with the wavelength, with some exception associated to the mixing of pollution with sea spray or dust particles over the sea surface. The lowest values of ω (0.84–0.70 between 370 and 950 nm are measured in correspondence of a fresh plume possibly linked to ship emissions over the basin. The range of variability of ω observed in this study seems to be independent of the source region around the basin, as well as of the altitude and aging time of the plumes. The observed variability of ω reflects in a large variability for the complex refractive index of pollution aerosols, which is estimated to span in the large range 1.41–1.77 and 0.002–0.097 for the real and the imaginary parts, respectively, between 370 and 950 nm. Radiative calculations in clear-sky conditions were performed with the GAME radiative transfer model to test the sensitivity of the aerosol shortwave Direct Radiative Effect (DRE to the variability of ω as observed in this study. Results from the calculations suggest up to a 50 and 30 % change of the forcing efficiency (FE, i.e. the DRE per unit of optical depth, at the surface (−160/−235 W m−2 τ−1 at 60° solar zenith angle and at the Top-Of-Atmosphere (−137/−92

  20. The single scattering properties of the aerosol particles as aggregated spheres

    International Nuclear Information System (INIS)

    Wu, Y.; Gu, X.; Cheng, T.; Xie, D.; Yu, T.; Chen, H.; Guo, J.

    2012-01-01

    The light scattering and absorption properties of anthropogenic aerosol particles such as soot aggregates are complicated in the temporal and spatial distribution, which introduce uncertainty of radiative forcing on global climate change. In order to study the single scattering properties of anthorpogenic aerosol particles, the structures of these aerosols such as soot paticles and soot-containing mixtures with the sulfate or organic matter, are simulated using the parallel diffusion limited aggregation algorithm (DLA) based on the transmission electron microscope images (TEM). Then, the single scattering properties of randomly oriented aerosols, such as scattering matrix, single scattering albedo (SSA), and asymmetry parameter (AP), are computed using the superposition T-matrix method. The comparisons of the single scattering properties of these specific types of clusters with different morphological and chemical factors such as fractal parameters, aspect ratio, monomer radius, mixture mode and refractive index, indicate that these different impact factors can respectively generate the significant influences on the single scattering properties of these aerosols. The results show that aspect ratio of circumscribed shape has relatively small effect on single scattering properties, for both differences of SSA and AP are less than 0.1. However, mixture modes of soot clusters with larger sulfate particles have remarkably important effects on the scattering and absorption properties of aggregated spheres, and SSA of those soot-containing mixtures are increased in proportion to the ratio of larger weakly absorbing attachments. Therefore, these complex aerosols come from man made pollution cannot be neglected in the aerosol retrievals. The study of the single scattering properties on these kinds of aggregated spheres is important and helpful in remote sensing observations and atmospheric radiation balance computations.

  1. Raman Lidar Measurements of Aerosol Extinction and Backscattering. Report 2; Derivation of Aerosol Real Refractive Index, Single-Scattering Albedo, and Humidification Factor using Raman Lidar and Aircraft Size Distribution

    Science.gov (United States)

    Ferrare, R. A.; Melfi, S. H.; Whiteman, D. N.; Evans, K. D.; Poellot, M.; Kaufman, Y. J.

    1998-01-01

    Aerosol backscattering and extinction profiles measured by the NASA Goddard Space Flight Center Scanning Raman Lidar (SRL) during the remote cloud sensing (RCS) intensive operations period (IOP) at the Department of Energy Atmospheric Radiation Measurement (ARM) southern Great Plains (SGP) site during two nights in April 1994 are discussed. These profiles are shown to be consistent with the simultaneous aerosol size distribution measurements made by a PCASP (Passive Cavity Aerosol Spectrometer Probe) optical particle counter flown on the University of North Dakota Citation aircraft. We describe a technique which uses both lidar and PCASP measurements to derive the dependence of particle size on relative humidity, the aerosol real refractive index n, and estimate the effective single-scattering albedo Omega(sub 0). Values of n ranged between 1.4-1.5 (dry) and 1.37-1.47 (wet); Omega(sub 0) varied between 0.7 and 1.0. The single-scattering albedo derived from this technique is sensitive to the manner in which absorbing particles are represented in the aerosol mixture; representing the absorbing particles as an internal mixture rather than the external mixture assumed here results in generally higher values of Omega(sub 0). The lidar measurements indicate that the change in particle size with relative humidity as measured by the PCASP can be represented in the form discussed by Hattel with the exponent gamma = 0.3 + or - 0.05. The variations in aerosol optical and physical characteristics captured in the lidar and aircraft size distribution measurements are discussed in the context of the meteorological conditions observed during the experiment.

  2. Snow particles extracted from X-ray computed microtomography imagery and their single-scattering properties

    Science.gov (United States)

    Ishimoto, Hiroshi; Adachi, Satoru; Yamaguchi, Satoru; Tanikawa, Tomonori; Aoki, Teruo; Masuda, Kazuhiko

    2018-04-01

    Sizes and shapes of snow particles were determined from X-ray computed microtomography (micro-CT) images, and their single-scattering properties were calculated at visible and near-infrared wavelengths using a Geometrical Optics Method (GOM). We analyzed seven snow samples including fresh and aged artificial snow and natural snow obtained from field samples. Individual snow particles were numerically extracted, and the shape of each snow particle was defined by applying a rendering method. The size distribution and specific surface area distribution were estimated from the geometrical properties of the snow particles, and an effective particle radius was derived for each snow sample. The GOM calculations at wavelengths of 0.532 and 1.242 μm revealed that the realistic snow particles had similar scattering phase functions as those of previously modeled irregular shaped particles. Furthermore, distinct dendritic particles had a characteristic scattering phase function and asymmetry factor. The single-scattering properties of particles of effective radius reff were compared with the size-averaged single-scattering properties. We found that the particles of reff could be used as representative particles for calculating the average single-scattering properties of the snow. Furthermore, the single-scattering properties of the micro-CT particles were compared to those of particle shape models using our current snow retrieval algorithm. For the single-scattering phase function, the results of the micro-CT particles were consistent with those of a conceptual two-shape model. However, the particle size dependence differed for the single-scattering albedo and asymmetry factor.

  3. Neutron Albedo

    CERN Document Server

    Ignatovich, V K

    2005-01-01

    A new, algebraic, method is applied to calculation of neutron albedo from substance to check the claim that use of ultradispersive fuel and moderator of an active core can help to gain in size and mass of the reactor. In a model of isotropic distribution of incident and reflected neutrons it is shown that coherent scattering on separate grains in the case of thermal neutrons increases transport cross section negligibly, however it decreases albedo from a wall of finite thickness because of decrease of substance density. A visible increase of albedo takes place only for neutrons with wave length of the order of the size of a single grain.

  4. SSA Disability Claim Data

    Data.gov (United States)

    Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...

  5. Highlights from 4STAR Sky-Scanning Retrievals of Aerosol Intensive Optical Properties from Multiple Field Campaigns with Detailed Comparisons of SSA Reported During SEAC4RS

    Science.gov (United States)

    Dunagan, Stephen E.

    2016-01-01

    The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET (Aerosol Robotic Network)-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyperspectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT). From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy's TCAP (Two-Column Aerosol Project) I & II campaigns, and NASA's SEAC4RS (Studies of Emissions, Atmospheric Composition, Clouds and Climate Coupling by Regional Surveys) and ARISE (Arctic Radiation - IceBridge Sea & Ice Experiment) campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2 (High Spectral Resolution Lidar), and from in situ measurements.

  6. 4STAR Sky-Scanning Retrievals of Aerosol Intensive Optical Properties from Multiple Field Campaigns with Detailed Comparisons of SSA Reported During SEAC4RS

    Science.gov (United States)

    Flynn, Connor; Dahlgren, R. P.; Dunagan, S.; Johnson, R.; Kacenelenbogen, M.; LeBlanc, S.; Livingston, J.; Redemann, J.; Schmid, B.; Segal Rozenhaimer, M.; hide

    2015-01-01

    The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyper spectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT).From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy TCAP I II campaigns, and NASAs SEAC4RS and ARISE campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2, and from in situ measurements.

  7. Estimates of the Spectral Aerosol Single Sea Scattering Albedo and Aerosol Radiative Effects during SAFARI 2000

    Science.gov (United States)

    Bergstrom, Robert W.; Pilewskie, Peter; Schmid, Beat; Russell, Philip B.

    2003-01-01

    Using measurements of the spectral solar radiative flux and optical depth for 2 days (24 August and 6 September 2000) during the SAFARI 2000 intensive field experiment and a detailed radiative transfer model, we estimate the spectral single scattering albedo of the aerosol layer. The single scattering albedo is similar on the 2 days even though the optical depth for the aerosol layer was quite different. The aerosol single scattering albedo was between 0.85 and 0.90 at 350 nm, decreasing to 0.6 in the near infrared. The magnitude and decrease with wavelength of the single scattering albedo are consistent with the absorption properties of small black carbon particles. We estimate the uncertainty in the single scattering albedo due to the uncertainty in the measured fractional absorption and optical depths. The uncertainty in the single scattering albedo is significantly less on the high-optical-depth day (6 September) than on the low-optical-depth day (24 August). On the high-optical-depth day, the uncertainty in the single scattering albedo is 0.02 in the midvisible whereas on the low-optical-depth day the uncertainty is 0.08 in the midvisible. On both days, the uncertainty becomes larger in the near infrared. We compute the radiative effect of the aerosol by comparing calculations with and without the aerosol. The effect at the top of the atmosphere (TOA) is to cool the atmosphere by 13 W/sq m on 24 August and 17 W/sq m on 6 September. The effect on the downward flux at the surface is a reduction of 57 W/sq m on 24 August and 200 W/sq m on 6 September. The aerosol effect on the downward flux at the surface is in good agreement with the results reported from the Indian Ocean Experiment (INDOEX).

  8. Optimal numerical methods for determining the orientation averages of single-scattering properties of atmospheric ice crystals

    International Nuclear Information System (INIS)

    Um, Junshik; McFarquhar, Greg M.

    2013-01-01

    The optimal orientation averaging scheme (regular lattice grid scheme or quasi Monte Carlo (QMC) method), the minimum number of orientations, and the corresponding computing time required to calculate the average single-scattering properties (i.e., asymmetry parameter (g), single-scattering albedo (ω o ), extinction efficiency (Q ext ), scattering efficiency (Q sca ), absorption efficiency (Q abs ), and scattering phase function at scattering angles of 90° (P 11 (90°)), and 180° (P 11 (180°))) within a predefined accuracy level (i.e., 1.0%) were determined for four different nonspherical atmospheric ice crystal models (Gaussian random sphere, droxtal, budding Bucky ball, and column) with maximum dimension D=10μm using the Amsterdam discrete dipole approximation at λ=0.55, 3.78, and 11.0μm. The QMC required fewer orientations and less computing time than the lattice grid. The calculations of P 11 (90°) and P 11 (180°) required more orientations than the calculations of integrated scattering properties (i.e., g, ω o , Q ext , Q sca , and Q abs ) regardless of the orientation average scheme. The fewest orientations were required for calculating g and ω o . The minimum number of orientations and the corresponding computing time for single-scattering calculations decreased with an increase of wavelength, whereas they increased with the surface-area ratio that defines particle nonsphericity. -- Highlights: •The number of orientations required to calculate the average single-scattering properties of nonspherical ice crystals is investigated. •Single-scattering properties of ice crystals are calculated using ADDA. •Quasi Monte Carlo method is more efficient than lattice grid method for scattering calculations. •Single-scattering properties of ice crystals depend on a newly defined parameter called surface area ratio

  9. Influence of stratospheric aerosol on albedo

    Energy Technology Data Exchange (ETDEWEB)

    Gormatyuk, Yu K; Kaufman, Yu G; Kolomeev, M P

    1985-06-01

    The influence of stratospheric aerosol (SA) on the transfer of solar radiation in the atmosphere is the principal factor determining the effect of SA on climate. The change in the radiation balance under the influence of SA is computed most precisely in radiative-convective models. However, the complex method used in these models cannot be used for other types of climate models. The objective of the study was to obtain a quantitative evaluation of the influence of SA on albedo without the use of simplifying assumptions. In the approximation of single scattering an expression is derived for change in albedo under the influence of stratospheric aerosol taking into account the dependence of albedo of the atmosphere-earth's surface system on solar zenith distance. The authors give the results of computations of the response of mean annual albedo to sulfuric acid aerosol for 10/sup 0/ latitude zones in the Northern Hemisphere. Specifically, computations of the optical characteristics of aerosol were made using the Mie theory for 10 spectral intervals taking in the range of wavelengths of solar radiation from 0.29 to 4.0 ..mu.. m. The refractive index of aerosol was stipulated in accordance with Palmer and Williams. The angular dependence of albedo for cloudless and cloudy atmospheres given by Harshvardhan was used. The values of undisturbed albedo were assumed to be identical for all wavelengths due to lack of climatological data on the spectral dependence of albedo of the atmosphere-earth's surface system. The angular distribution of the intensity of solar radiation for each of the latitude zones was computed by the method described by I.M. Alekseyev, et al.

  10. SSA State Agency Workload Data

    Data.gov (United States)

    Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...

  11. A Hierarchical Volumetric Shadow Algorithm for Single Scattering

    OpenAIRE

    Baran, Ilya; Chen, Jiawen; Ragan-Kelley, Jonathan Millar; Durand, Fredo; Lehtinen, Jaakko

    2010-01-01

    Volumetric effects such as beams of light through participating media are an important component in the appearance of the natural world. Many such effects can be faithfully modeled by a single scattering medium. In the presence of shadows, rendering these effects can be prohibitively expensive: current algorithms are based on ray marching, i.e., integrating the illumination scattered towards the camera along each view ray, modulated by visibility to the light source at each sample. Visibility...

  12. Estimation of snow albedo reduction by light absorbing impurities using Monte Carlo radiative transfer model

    Science.gov (United States)

    Sengupta, D.; Gao, L.; Wilcox, E. M.; Beres, N. D.; Moosmüller, H.; Khlystov, A.

    2017-12-01

    Radiative forcing and climate change greatly depends on earth's surface albedo and its temporal and spatial variation. The surface albedo varies greatly depending on the surface characteristics ranging from 5-10% for calm ocean waters to 80% for some snow-covered areas. Clean and fresh snow surfaces have the highest albedo and are most sensitive to contamination with light absorbing impurities that can greatly reduce surface albedo and change overall radiative forcing estimates. Accurate estimation of snow albedo as well as understanding of feedbacks on climate from changes in snow-covered areas is important for radiative forcing, snow energy balance, predicting seasonal snowmelt, and run off rates. Such information is essential to inform timely decision making of stakeholders and policy makers. Light absorbing particles deposited onto the snow surface can greatly alter snow albedo and have been identified as a major contributor to regional climate forcing if seasonal snow cover is involved. However, uncertainty associated with quantification of albedo reduction by these light absorbing particles is high. Here, we use Mie theory (under the assumption of spherical snow grains) to reconstruct the single scattering parameters of snow (i.e., single scattering albedo ῶ and asymmetry parameter g) from observation-based size distribution information and retrieved refractive index values. The single scattering parameters of impurities are extracted with the same approach from datasets obtained during laboratory combustion of biomass samples. Instead of using plane-parallel approximation methods to account for multiple scattering, we have used the simple "Monte Carlo ray/photon tracing approach" to calculate the snow albedo. This simple approach considers multiple scattering to be the "collection" of single scattering events. Using this approach, we vary the effective snow grain size and impurity concentrations to explore the evolution of snow albedo over a wide

  13. Observations of Surfzone Albedo

    Science.gov (United States)

    Sinnett, G.; Feddersen, F.

    2014-12-01

    The surfzone environment (where waves break) contains several unique and previously unconsidered processes that affect the heat budget. Entering short-wave radiation is a dominant term in both shelf and surfzone heat budgets. In contrast to the shelf, however, depth limited wave breaking in the surfzone generates spray, whitewater and suspended sediments, elevating the surface albedo (ratio of reflected to incident short-wave radiation). Elevated albedo reduces the level of solar short-wave radiation entering the water, potentially resulting in less heating. Additionally, surfzone water quality is often impacted by fecal bacteria contamination. As bacteria mortality is related to short-wave solar radiation, elevated surfzone albedo could reduce pathogen mortality, impacting human health. Albedo in the open ocean has been frequently studied and parameterizations often consider solar zenith angle, wind speed and ocean chlorophyll concentration, producing albedo values typically near 0.06. However, surfzone albedo observations have been extremely sparse, yet show depth limited wave breaking may increase the albedo by nearly a factor of 10 up to 0.5. Here, we present findings from a field study at the Scripps Institution of Oceanography pier to observe the affect of waves on surfzone albedo. Concurrent measurements were taken with a four-way radiometer (to measure both downwelling and upwelling short-wave and long wave radiation) mounted above the surfzone. A co-located GoPro camera was used to relate visual aspects of the surfzone to measured reflectance, and wave height and period were observed with a bottom mounted pressure sensor in 5 m water depth just outside the surfzone. Wind speed and direction were observed on the pier 10 m above the water surface. Here, we will examine the surfzone albedo dependence on surfzone parameters, such as wave height.

  14. Modeling single-scattering properties of small cirrus particles by use of a size-shape distribution of ice spheroids and cylinders

    International Nuclear Information System (INIS)

    Liu Li; Mishchenko, Michael I.; Cairns, Brian; Carlson, Barbara E.; Travis, Larry D.

    2006-01-01

    In this study, we model single-scattering properties of small cirrus crystals using mixtures of polydisperse, randomly oriented spheroids and cylinders with varying aspect ratios and with a refractive index representative of water ice at a wavelength of 1.88 μm. The Stokes scattering matrix elements averaged over wide shape distributions of spheroids and cylinders are compared with those computed for polydisperse surface-equivalent spheres. The shape-averaged phase function for a mixture of oblate and prolate spheroids is smooth, featureless, and nearly flat at side-scattering angles and closely resembles those typically measured for cirrus. Compared with the ensemble-averaged phase function for spheroids, that for a shape distribution of cylinders shows a relatively deeper minimum at side-scattering angles. This may indicate that light scattering from realistic cirrus crystals can be better represented by a shape mixture of ice spheroids. Interestingly, the single-scattering properties of shape-averaged oblate and prolate cylinders are very similar to those of compact cylinders with a diameter-to-length ratio of unity. The differences in the optical cross sections, single-scattering albedo, and asymmetry parameter between the spherical and the nonspherical particles studied appear to be relatively small. This may suggest that for a given optical thickness, the influence of particle shape on the radiative forcing caused by a cloud composed of small ice crystals can be negligible

  15. Single-scattering properties of ice particles in the microwave regime: Temperature effect on the ice refractive index with implications in remote sensing

    International Nuclear Information System (INIS)

    Ding, Jiachen; Bi, Lei; Yang, Ping; Kattawar, George W.; Weng, Fuzhong; Liu, Quanhua; Greenwald, Thomas

    2017-01-01

    An ice crystal single-scattering property database is developed in the microwave spectral region (1 to 874 GHz) to provide the scattering, absorption, and polarization properties of 12 ice crystal habits (10-plate aggregate, 5-plate aggregate, 8-column aggregate, solid hexagonal column, hollow hexagonal column, hexagonal plate, solid bullet rosette, hollow bullet rosette, droxtal, oblate spheroid, prolate spheroid, and sphere) with particle maximum dimensions from 2 µm to 10 mm. For each habit, four temperatures (160, 200, 230, and 270 K) are selected to account for temperature dependence of the ice refractive index. The microphysical and scattering properties include projected area, volume, extinction efficiency, single-scattering albedo, asymmetry factor, and six independent nonzero phase matrix elements (i.e. P_1_1, P_1_2, P_2_2, P_3_3, P_4_3 and P_4_4). The scattering properties are computed by the Invariant Imbedding T-Matrix (II-TM) method and the Improved Geometric Optics Method (IGOM). The computation results show that the temperature dependence of the ice single-scattering properties in the microwave region is significant, particularly at high frequencies. Potential active and passive remote sensing applications of the database are illustrated through radar reflectivity and radiative transfer calculations. For cloud radar applications, ignoring temperature dependence has little effect on ice water content measurements. For passive microwave remote sensing, ignoring temperature dependence may lead to brightness temperature biases up to 5 K in the case of a large ice water path. - Highlights: • Single-scattering properties of ice crystals are computed from 1 to 874 GHz. • Ice refractive index temperature dependence is considered at 160, 200, 230 and 270 K. • Potential applications of the database to microwave remote sensing are illustrated. • Ignoring temperature dependence of ice refractive index can lead to 5 K difference in IWP retrieval

  16. Test of Mie-based single-scattering properties of non-spherical dust aerosols in radiative flux calculations

    International Nuclear Information System (INIS)

    Fu, Q.; Thorsen, T.J.; Su, J.; Ge, J.M.; Huang, J.P.

    2009-01-01

    We simulate the single-scattering properties (SSPs) of dust aerosols with both spheroidal and spherical shapes at a wavelength of 0.55 μm for two refractive indices and four effective radii. Herein spheres are defined by preserving both projected area and volume of a non-spherical particle. It is shown that the relative errors of the spheres to approximate the spheroids are less than 1% in the extinction efficiency and single-scattering albedo, and less than 2% in the asymmetry factor. It is found that the scattering phase function of spheres agrees with spheroids better than the Henyey-Greenstein (HG) function for the scattering angle range of 0-90 o . In the range of ∼90-180 o , the HG function is systematically smaller than the spheroidal scattering phase function while the spherical scattering phase function is smaller from ∼90 o to 145 o but larger from ∼145 o to 180 o . We examine the errors in reflectivity and absorptivity due to the use of SSPs of equivalent spheres and HG functions for dust aerosols. The reference calculation is based on the delta-DISORT-256-stream scheme using the SSPs of the spheroids. It is found that the errors are mainly caused by the use of the HG function instead of the SSPs for spheres. By examining the errors associated with the delta-four- and delta-two-stream schemes using various approximate SSPs of dust aerosols, we find that the errors related to the HG function dominate in the delta-four-stream results, while the errors related to the radiative transfer scheme dominate in the delta-two-stream calculations. We show that the relative errors in the global reflectivity due to the use of sphere SSPs are always less than 5%. We conclude that Mie-based SSPs of non-spherical dust aerosols are well suited in radiative flux calculations.

  17. Characterizing Intimate Mixtures of Materials in Hyperspectral Imagery with Albedo-based and Kernel-based Approaches

    Science.gov (United States)

    2015-09-01

    Automated classification of built-up areas using neural networks and subpixel demixing methods on multispectral/hyperspectral data,” Proceedings of...scattering albedo (SSA) according to Hapke theory assuming bidirectional scattering at nadir look angles and uses a constrained linear model on the computed...following Hapke 9 (1993); and Mustard and Pieters 18 (1987)) assuming the reflectance spectra are bidirectional . SSA spectra were also generated

  18. The Case for GEO Hosted SSA Payloads

    Science.gov (United States)

    Welsch, C.; Armand, B.; Repp, M.; Robinson, A.

    2014-09-01

    Space situational awareness (SSA) in the geosynchronous earth orbit (GEO) belt presents unique challenges, and given the national importance and high value of GEO satellites, is increasingly critical as space becomes more congested and contested. Space situational awareness capabilities can serve as an effective deterrent against potential adversaries if they provide accurate, timely, and persistent information and are resilient to the threat environment. This paper will demonstrate how simple optical SSA payloads hosted on GEO commercial and government satellites can complement the SSA mission and data provided by Space-Based Space Surveillance (SBSS) and the Geosynchronous Space Situational Awareness Program (GSSAP). GSSAP is built by Orbital Sciences Corporation and launched on July 28, 2014. Analysis performed for this paper will show how GEO hosted SSA payloads, working in combination with SBSS and GSSAP, can increase persistence and timely coverage of high value assets in the GEO belt. The potential to further increase GEO object identification and tracking accuracy by integrating SSA data from multiple sources across different viewing angles including GEO hosted SSA sources will be addressed. Hosting SSA payloads on GEO platforms also increases SSA mission architecture resiliency as the sensors are by distributed across multiple platforms including commercial platforms. This distributed architecture presents a challenging target for an adversary to attempt to degrade or disable. We will present a viable concept of operations to show how data from hosted SSA sensors could be integrated with SBSS and GSSAP data to present a comprehensive and more accurate data set to users. Lastly, we will present an acquisition approach using commercial practices and building on lessons learned from the Commercially Hosted Infra Red Payload CHIRP to demonstrate the affordability of GEO hosted SSA payloads.

  19. BOREAS TE-01 SSA Soil Lab Data

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil horizon; dry...

  20. BOREAS TE-01 SSA Soil Lab Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil...

  1. Fire-induced albedo change and surface radiative forcing in sub-Saharan Africa savanna ecosystems: Implications for the energy balance

    Science.gov (United States)

    Dintwe, Kebonye; Okin, Gregory S.; Xue, Yongkang

    2017-06-01

    Surface albedo is a critical parameter that controls surface energy balance. In dryland ecosystems, fires play a significant role in decreasing surface albedo, resulting in positive radiative forcing. Here we investigate the long-term effect of fire on surface albedo. We devised a method to calculate short-, medium-, and long-term effect of fire-induced radiative forcing and their relative effects on energy balance. We used Moderate Resolution Imaging Spectroradiometer (MODIS) data in our analysis, covering different vegetation classes in sub-Saharan Africa (SSA). Our analysis indicated that mean short-term fire-induced albedo change in SSA was -0.022, -0.035, and -0.041 for savannas, shrubland, and grasslands, respectively. At regional scale, mean fire-induced albedo change in savannas was -0.018 and -0.024 for northern sub-Saharan of Africa and the southern hemisphere Africa, respectively. The short-term mean fire-induced radiative forcing in burned areas in sub-Saharan Africa (SSA) was 5.41 W m-2, which contributed continental and global radiative forcings of 0.25 and 0.058 W m-2, respectively. The impact of fire in surface albedo has long-lasting effects that varies with vegetation type. The long-term energetic effects of fire-induced albedo change and associated radiative forcing were, on average, more than 19 times greater across SSA than the short-term effects, suggesting that fires exerted far more radiative forcing than previously thought. Taking into account the actual duration of fire's effect on surface albedo, we conclude that the contribution of SSA fires, globally and throughout the year, is 0.12 W m-2. These findings provide crucial information on possible impact of fire on regional climate variability.

  2. Dicty_cDB: SSA423 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...FIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET

  3. Dicty_cDB: SSA581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  4. Delivering SSA Capabilities to the Warfighter

    Science.gov (United States)

    van Weezendonk, J.; Sherk, J.; Ryan, T.; McGuire, R.

    The Space Superiority Systems Wing at the Space and Missile Center (SMC/SY) equips US forces with Offensive Counterspace (OCS), Defensive Counterspace (DCS), and Space Situation Awareness (SSA) systems that further enhance space superiority. The Technology Division (SYT) mission is to identify, develop, and transition cutting-edge technologies to the warfighter. SYT invests in the most relevant technologies for SSA, DCS and OCS that enhance SMC/SY's portfolio. This presentation will provide an overview of the SMC/SY SSA Technology being worked and highlights several key programs. The presentation will also highlight how the SMC/SY SSA efforts fit into to a Space Superiority Architecture. SYT executes its own Space Control Technology program line and leverages technologies from various DoD and national laboratories, Federally Funded Research and Development Companies, national agencies, industry and academia to accomplish their mission. The portions of the SY FY06 SSA portfolio that will be discussed are: Precision Metrics, Star Sensor Studies, Multi-mission Deployable Optical System, Intelligent Agent Data Fusion efforts, ESSA ACTD and the GReAT tech demo.

  5. The colour potentials of SSA-containing mortar

    DEFF Research Database (Denmark)

    Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie

    2015-01-01

    This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a......This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA...

  6. Evolution of ESA's SSA Conjunction Prediction Service

    Science.gov (United States)

    Escobar, D.; Sancho, A. Tirado, J.; Agueda, A.; Martin, L.; Luque, F.; Fletcher, E.; Navarro, V.

    2013-08-01

    This paper presents the recent evolution of ESA's SSA Conjunction Prediction Service (CPS) as a result of an on-going activity in the Space Surveillance and Tracking (SST) Segment of ESA's Space Situational Awareness (SSA) Programme. The CPS is one of a number of precursor services being developed as part of the SST segment. It has been implemented as a service to provide external users with web-based access to conjunction information and designed with a service-oriented architecture. The paper encompasses the following topics: service functionality enhancements, integration with a live objects catalogue, all vs. all analyses supporting an operational concept based on low and high fidelity screenings, and finally conjunction detection and probability algorithms.

  7. Thermoluminescence albedo-neutron dosimetry

    International Nuclear Information System (INIS)

    Strand, T.; Storruste, A.

    1986-10-01

    The report discusses neutron detection with respect to dosimetry and compares different thermoluminescent dosimetry materials for neutron dosimetry. Construction and calibration of a thermoluminescence albedo neutron dosemeter, developed by the authors, is described

  8. Dicty_cDB: SSA564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...NNTLKPKQTTKGFNIGGQPGNPTN*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c

  9. Absorption line profiles in a moving atmosphere - A single scattering linear perturbation theory

    Science.gov (United States)

    Hays, P. B.; Abreu, V. J.

    1989-01-01

    An integral equation is derived which linearly relates Doppler perturbations in the spectrum of atmospheric absorption features to the wind system which creates them. The perturbation theory is developed using a single scattering model, which is validated against a multiple scattering calculation. The nature and basic properties of the kernels in the integral equation are examined. It is concluded that the kernels are well behaved and that wind velocity profiles can be recovered using standard inversion techniques.

  10. Microwave single-scattering properties of randomly oriented soft-ice hydrometeors

    Directory of Open Access Journals (Sweden)

    D. Casella

    2008-11-01

    Full Text Available Large ice hydrometeors are usually present in intense convective clouds and may significantly affect the upwelling radiances that are measured by satellite-borne microwave radiometers – especially, at millimeter-wavelength frequencies. Thus, interpretation of these measurements (e.g., for precipitation retrieval requires knowledge of the single scattering properties of ice particles. On the other hand, shape and internal structure of these particles (especially, the larger ones is very complex and variable, and therefore it is necessary to resort to simplifying assumptions in order to compute their single-scattering parameters.

    In this study, we use the discrete dipole approximation (DDA to compute the absorption and scattering efficiencies and the asymmetry factor of two kinds of quasi-spherical and non-homogeneous soft-ice particles in the frequency range 50–183 GHz. Particles of the first kind are modeled as quasi-spherical ice particles having randomly distributed spherical air inclusions. Particles of the second kind are modeled as random aggregates of ice spheres having random radii. In both cases, particle densities and dimensions are coherent with the snow hydrometeor category that is utilized by the University of Wisconsin – Non-hydrostatic Modeling System (UW-NMS cloud-mesoscale model. Then, we compare our single-scattering results for randomly-oriented soft-ice hydrometeors with corresponding ones that make use of: a effective-medium equivalent spheres, b solid-ice equivalent spheres, and c randomly-oriented aggregates of ice cylinders. Finally, we extend to our particles the scattering formulas that have been developed by other authors for randomly-oriented aggregates of ice cylinders.

  11. The Aesthetical quality of SSA-containing mortar and concrete

    DEFF Research Database (Denmark)

    Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.

    2014-01-01

    that gives a characteristic red colour. The process of grinding SSA has shown to improve the compressive strength of SSA- containing mortar (Donatello et al. 2010). Thus, in this study SSA was grinded in 6 different intervals ranging from 0 – 10 min, and then added to the mortar mix replacing 20% of cement....... The experiment revealed that the colour of the SSA-containing mortar intensified as the time interval of the grinding process increased. Each of the 6 steps within the time interval provided an additional colour tone and generated a colour scale consisting of mortar samples ranging from greyish to a more...

  12. OMI/Aura Near UV Aerosol Optical Depth and Single Scattering Albedo Daily L3 Global 1x1 deg Lat/Lon Grid V003

    Data.gov (United States)

    National Aeronautics and Space Administration — The OMI-Aura level-3 daily global gridded (1x1 deg) near-UV Aerosol data product OMAERUVd based on the enhanced algorithm is available from the NASA Goddard Earth...

  13. OMI/Aura Near UV Aerosol Optical Depth and Single Scattering Albedo 1-orbit L2 Swath 13x24 km V003

    Data.gov (United States)

    National Aeronautics and Space Administration — The OMI/Aura level-2 near UV Aerosol data product 'OMAERUV', recently re-processed using an enhanced algorithm, is now released (April 2012) to the public. The data...

  14. OMI/Aura Multi-wavelength Aerosol Optical Depth and Single Scattering Albedo 1-orbit L2 Swath 13x24 km V003

    Data.gov (United States)

    National Aeronautics and Space Administration — The improved Level-2 OMI Aerosol Product 'OMAERO' is now available (http://disc.gsfc.nasa.gov/Aura/OMI/omaero_v003.shtml ) from NASA GSFC Earth Sciences (GES) Data...

  15. OMI/Aura Near UV Aerosol Optical Depth and Single Scattering Albedo 1-orbit L2 Swath 13x24 km V003 NRT

    Data.gov (United States)

    National Aeronautics and Space Administration — The OMI/Aura level-2 near UV Aerosol data product 'OMAERUV', recently re-processed using an enhanced algorithm, is now released (April 2012) to the public. The data...

  16. Strong spectral variation of biomass smoke light absorption and single scattering albedo observed with a novel dual-wavelength photoacoustic instrument

    Science.gov (United States)

    Kristin Lewis; William P. Arnott; Hans Moosmuller; Cyle E. Wold

    2008-01-01

    A dual-wavelength photoacoustic instrument operating at 405 and 870 nm was used during the 2006 Fire Lab at Missoula Experiment to measure light scattering and absorption by smoke from the combustion of a variety of biomass fuels. Simultaneous measurements of aerosol light scattering by reciprocal nephelometry within the instrument's acoustic resonator accompany...

  17. SAI/EPRI Albedo Information Library

    International Nuclear Information System (INIS)

    Simmons, G.L.

    1979-03-01

    The SAI/EPRI Albedo Information Library (SAIL) is described. This description included the techniques used to develop the data and comparisons with albedo data. Albedo data are presented for Type 04 Concrete and Low Carbon Steel, the most common materials encountered in radiation streaming analysis. Applications of the SAIL data are presented and compared with experimental results

  18. 76 FR 41685 - Electronic Substitutions for Form SSA-538

    Science.gov (United States)

    2011-07-15

    ... visit our Internet site, Social Security Online, at http://www.socialsecurity.gov . SUPPLEMENTARY... SOCIAL SECURITY ADMINISTRATION 20 CFR Part 416 [Docket No. SSA-2009-0027] RIN 0960-AH02 Electronic Substitutions for Form SSA-538 AGENCY: Social Security Administration. ACTION: Final rule with request for...

  19. Albedo matters: Understanding runaway albedo variations on Pluto

    Science.gov (United States)

    Earle, Alissa M.; Binzel, Richard P.; Young, Leslie A.; Stern, S. A.; Ennico, K.; Grundy, W.; Olkin, C. B.; Weaver, H. A.; New Horizons Surface Composition Theme

    2018-03-01

    The data returned from NASA's New Horizons reconnaissance of the Pluto system show striking albedo variations from polar to equatorial latitudes as well as sharp longitudinal boundaries. Pluto has a high obliquity (currently 119°) that varies by 23° over a period of less than 3 million years. This variation, combined with its regressing longitude of perihelion (360° over 3.7 million years), creates epochs of "Super Seasons" where one pole is pointed at the Sun at perihelion, thereby experiencing a short, relatively warm summer followed by its longest possible period of winter darkness. In contrast, the other pole experiences a much longer, less intense summer and a short winter season. We use a simple volatile sublimation and deposition model to explore the relationship between albedo variations, latitude, and volatile sublimation and deposition for the current epoch as well as historical epochs during which Pluto experienced these "Super Seasons." Our investigation quantitatively shows that Pluto's geometry creates the potential for runaway albedo and volatile variations, particularly in the equatorial region, which can sustain stark longitudinal contrasts like the ones we see between Tombaugh Regio and the informally named Cthulhu Regio.

  20. 77 FR 38880 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (SSA...

    Science.gov (United States)

    2012-06-29

    ... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0002] Privacy Act of 1974, as Amended...

  1. A database of microwave and sub-millimetre ice particle single scattering properties

    Science.gov (United States)

    Ekelund, Robin; Eriksson, Patrick

    2016-04-01

    Ice crystal particles are today a large contributing factor as to why cold-type clouds such as cirrus remain a large uncertainty in global climate models and measurements. The reason for this is the complex and varied morphology in which ice particles appear, as compared to liquid droplets with an in general spheroidal shape, thus making the description of electromagnetic properties of ice particles more complicated. Single scattering properties of frozen hydrometers have traditionally been approximated by representing the particles as spheres using Mie theory. While such practices may work well in radio applications, where the size parameter of the particles is generally low, comparisons with measurements and simulations show that this assumption is insufficient when observing tropospheric cloud ice in the microwave or sub-millimetre regions. In order to assist the radiative transfer and remote sensing communities, a database of single scattering properties of semi-realistic particles is being produced. The data is being produced using DDA (Discrete Dipole Approximation) code which can treat arbitrarily shaped particles, and Tmatrix code for simpler shapes when found sufficiently accurate. The aim has been to mainly cover frequencies used by the upcoming ICI (Ice Cloud Imager) mission with launch in 2022. Examples of particles to be included are columns, plates, bullet rosettes, sector snowflakes and aggregates. The idea is to treat particles with good average optical properties with respect to the multitude of particles and aggregate types appearing in nature. The database will initially only cover macroscopically isotropic orientation, but will eventually also include horizontally aligned particles. Databases of DDA particles do already exist with varying accessibility. The goal of this database is to complement existing data. Regarding the distribution of the data, the plan is that the database shall be available in conjunction with the ARTS (Atmospheric

  2. Neutron albedo effects of underground nuclear explosion

    International Nuclear Information System (INIS)

    Yang Bo; Ying Yangjun; Li Jinhong; Bai Yun

    2013-01-01

    The neutron field distribution is affected by the surrounding medium in the underground nuclear explosion. It will influence the radiation chemical diagnosis. By Monte Carlo simulation, the fuel burnup induced by device and neutron albedo was calculated. The analysis method of albedo effect on radiation chemical diagnosis result under special environment was proposed. Neutron albedo should be considered when capture reaction burnup fraction is used, and then correct analysis can be carried out on the nuclear device.The neutron field distribution is affected by the surrounding medium in the underground nuclear explosion. It will influence the radiation chemical diagnosis. By Monte Carlo simulation, the fuel burnup induced by device and neutron albedo was calculated. The analysis method of albedo effect on radiation chemical diagnosis result under special environment was proposed. Neutron albedo should be considered when capture reaction burnup fraction is used, and then correct analysis can be carried out on the nuclear device. (authors)

  3. The Ultraviolet Albedo of Ganymede

    Science.gov (United States)

    McGrath, Melissa; Hendrix, A.

    2013-10-01

    A large set of ultraviolet images of Ganymede have been acquired with the Hubble Space Telescope over the last 15 years. These images have been used almost exclusively to study Ganymede’s stunning auroral emissions (Feldman et al. 2000; Eviatar et al. 2001; McGrath et al. 2004; Saur et al. 2011; McGrath et al. 2013), and even the most basic information about Ganymede’s UV albedo has yet to be gleaned from these data. We will present a first-cut analysis of both disk-averaged and spatially-resolved UV albedos of Ganymede, with focus on the spatially-resolved Lyman-alpha albedo, which has never been considered previously for this satellite. Ganymede's visibly bright regions are known to be rich in water ice, while the visibly dark regions seem to be more carbonaceous (Carlson et al., 1996). At Lyman-alpha, these two species should also have very different albedo values. References Carlson, R. and 39 co-authors, Near-infrared spectroscopy and spectral mapping of Jupiter and the Galilean satellites: Results from Galileo’s initial orbit, Science, 274, 385-388, 1996. Eviatar, A., D. F. Strobel, B. C. Wolven, P. D. Feldman, M. A. McGrath, and D. J. Williams, Excitation of the Ganymede ultraviolet aurora, Astrophys. J, 555, 1013-1019, 2001. Feldman, P. D., M. A. McGrath, D. F. Strobel, H. W. Moos, K. D. Retherford, and B. C. Wolven, HST/STIS imaging of ultraviolet aurora on Ganymede, Astrophys. J, 535, 1085-1090, 2000. McGrath M. A., Lellouch E., Strobel D. F., Feldman P. D., Johnson R. E., Satellite Atmospheres, Chapter 19 in Jupiter: The Planet, Satellites and Magnetosphere, ed. F. Bagenal, T. Dowling, W. McKinnon, Cambridge University Press, 2004. McGrath M. A., Jia, Xianzhe; Retherford, Kurt; Feldman, Paul D.; Strobel, Darrell F.; Saur, Joachim, Aurora on Ganymede, J. Geophys. Res., doi: 10.1002/jgra.50122, 2013. Saur, J., S. Duling, S., L. Roth, P. D. Feldman, D. F. Strobel, K. D. Retherford, M. A. McGrath, A. Wennmacher, American Geophysical Union, Fall Meeting

  4. BOREAS TF-01 SSA-OA Soil Characteristics Data

    Data.gov (United States)

    National Aeronautics and Space Administration — Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil respiration,...

  5. TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame

    Index Scriptorium Estoniae

    Saame, Koidu

    2010-01-01

    Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen

  6. BOREAS TF-01 SSA-OA Soil Characteristics Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil...

  7. CARP: a computer code and albedo data library for use by BREESE, the MORSE albedo package

    International Nuclear Information System (INIS)

    Emmett, M.B.; Rhoades, W.A.

    1978-10-01

    The CARP computer code was written to allow processing of DOT angular flux tapes to produce albedo data for use in the MORSE computer code. An albedo data library was produced containing several materials. 3 tables

  8. Modeling the radiation transfer of discontinuous canopies: results for gap probability and single-scattering contribution

    Science.gov (United States)

    Zhao, Feng; Zou, Kai; Shang, Hong; Ji, Zheng; Zhao, Huijie; Huang, Wenjiang; Li, Cunjun

    2010-10-01

    In this paper we present an analytical model for the computation of radiation transfer of discontinuous vegetation canopies. Some initial results of gap probability and bidirectional gap probability of discontinuous vegetation canopies, which are important parameters determining the radiative environment of the canopies, are given and compared with a 3- D computer simulation model. In the model, negative exponential attenuation of light within individual plant canopies is assumed. Then the computation of gap probability is resolved by determining the entry points and exiting points of the ray with the individual plants via their equations in space. For the bidirectional gap probability, which determines the single-scattering contribution of the canopy, a gap statistical analysis based model was adopted to correct the dependence of gap probabilities for both solar and viewing directions. The model incorporates the structural characteristics, such as plant sizes, leaf size, row spacing, foliage density, planting density, leaf inclination distribution. Available experimental data are inadequate for a complete validation of the model. So it was evaluated with a three dimensional computer simulation model for 3D vegetative scenes, which shows good agreement between these two models' results. This model should be useful to the quantification of light interception and the modeling of bidirectional reflectance distributions of discontinuous canopies.

  9. Radiation pressure in galactic disks: stability, turbulence, and winds in the single-scattering limit

    Science.gov (United States)

    Wibking, Benjamin D.; Thompson, Todd A.; Krumholz, Mark R.

    2018-04-01

    The radiation force on dust grains may be dynamically important in driving turbulence and outflows in rapidly star-forming galaxies. Recent studies focus on the highly optically-thick limit relevant to the densest ultra-luminous galaxies and super star clusters, where reprocessed infrared photons provide the dominant source of electromagnetic momentum. However, even among starburst galaxies, the great majority instead lie in the so-called "single-scattering" limit, where the system is optically-thick to the incident starlight, but optically-thin to the re-radiated infrared. In this paper we present a stability analysis and multidimensional radiation-hydrodynamic simulations exploring the stability and dynamics of isothermal dusty gas columns in this regime. We describe our algorithm for full angle-dependent radiation transport based on the discontinuous Galerkin finite element method. For a range of near-Eddington fluxes, we show that the medium is unstable, producing convective-like motions in a turbulent atmosphere with a scale height significantly inflated compared to the gas pressure scale height and mass-weighted turbulent energy densities of ˜0.01 - 0.1 of the midplane radiation energy density, corresponding to mass-weighted velocity dispersions of Mach number ˜0.5 - 2. Extrapolation of our results to optical depths of 103 implies maximum turbulent Mach numbers of ˜20. Comparing our results to galaxy-averaged observations, and subject to the approximations of our calculations, we find that radiation pressure does not contribute significantly to the effective supersonic pressure support in star-forming disks, which in general are substantially sub-Eddington. We further examine the time-averaged vertical density profiles in dynamical equilibrium and comment on implications for radiation-pressure-driven galactic winds.

  10. Clinical and Pathological Roles of Ro/SSA Autoantibody System

    Directory of Open Access Journals (Sweden)

    Ryusuke Yoshimi

    2012-01-01

    Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.

  11. COSMIC MICROWAVE BACKGROUND INDUCED POLARIZATION FROM SINGLE SCATTERING BY CLUSTERS OF GALAXIES AND FILAMENTS

    Energy Technology Data Exchange (ETDEWEB)

    Ramos, Elsa P. R. G.; Da Silva, Antonio J. C. [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Liu, Guo-Chin, E-mail: eramos@astro.up.pt [Department of Physics, Tamkang University, Tamsui District, New Taipei City 251, Taiwan (China)

    2012-09-20

    We present light-cone-integrated simulations of the cosmic microwave background (CMB) polarization signal induced by a single scattering in the direction of clusters of galaxies and filaments. We characterize the statistical properties of the induced polarization signals from the presence of the CMB quadrupole component (pqiCMB) and as the result of the transverse motion of ionized gas clouds with respect to the CMB rest frame (p{beta}{sup 2}{sub t}SZ). From adiabatic N-body/hydrodynamic simulations, we generated 28 random sky patches integrated along the light cone, each with about 0.86 deg{sup 2} and angular resolution of 6''. Our simulation method involves a box-stacking scheme that allows to reconstruct the CMB quadrupole component and the gas physical properties along the line of sight. We find that the linear polarization degree in the logarithmic scale of both effects follows approximately a Gaussian distribution and the mean total signal is about 10{sup -8} and 10{sup -10} for the pqiCMB and p{beta}{sup 2}{sub t}SZ effects, respectively. The polarization angle is consistent with a flat distribution in both cases. From the mean distributions of the polarization degree with redshift, the highest peak is found at z {approx_equal} 1 for the induced CMB quadrupole and at z {approx_equal} 0.5 for the kinematic component. Our results suggest that most of the contribution for the total polarization signal arises from z {approx}< 4 for the pqiCMB and z {approx}< 3 for p{beta}{sup 2}{sub t}SZ. The spectral dependency of both integrated signals is strong, increasing with the frequency, especially in the case of the p{beta}{sup 2}{sub t}SZ signal, which increases by a factor of 100 from 30 GHz to 675 GHz. The maxima values found at the highest frequency are about 3 {mu}K and 13 {mu}K for the pqiCMB and p{beta}{sup 2}{sub t}SZ, respectively. The angular power spectra of these effects peak at large multipoles l > 10{sup 4}, being of the order of 10{sup -5} {mu

  12. Preliminary approach of the MELiSSA loop energy balance

    Science.gov (United States)

    Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean

    Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering

  13. Arctic Region Space Weather Customers and SSA Services

    DEFF Research Database (Denmark)

    Høeg, Per; Kauristi, Kirsti; Wintoft, Peter

    Arctic inhabitants, authorities, and companies rely strongly on precise localization information and communication covering vast areas with low infrastructure and population density. Thus modern technology is crucial for establishing knowledge that can lead to growth in the region. At the same time...... and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...

  14. Theoretical White Dwarf Spectra on Demand: TheoSSA

    Science.gov (United States)

    Ringat, E.; Rauch, T.

    2010-11-01

    In the last decades, a lot of progress was made in spectral analysis. The quality (e.g. resolution, S/N ratio) of observed spectra has improved much and several model-atmosphere codes were developed. One of these is the ``Tübingen NLTE Model-Atmosphere Package'' (TMAP), that is a highly developed program for the calculation of model atmospheres of hot, compact objects. In the framework of the German Astrophysical Virtual Observatory (GAVO), theoretical spectral energy distributions (SEDs) can be downloaded via TheoSSA. In a pilot phase, TheoSSA is based on TMAP model atmospheres. We present the current state of this VO service.

  15. UV/visible albedos from airborne measurements

    Science.gov (United States)

    Webb, A.; Kylling, A.; Stromberg, I.

    2003-04-01

    During the INSPECTRO campaign effective surface albedo was measured at UV and visible wavelengths from two airborne platforms, a Cessna light aircraft and a hot air balloon. On board the Cessna was a scanning spectroradiometer measuring from 300 - 500nm at 10nm intervals. The NILU cube, with 6 faces and two UV channels at 312 and 340nm, was suspended beneath the hot air balloon. Flights took place over East Anglia during September, 2002. Balloon flights were made below cloud layers, while the Cessna flew both above and below cloud. The Cessna also flew over Barton Bendish, where surface albedos have been measured for ground truthing of satellite data, and measured the effective albedo at four visible wave- lengths in the centres of the satellite bandpass functions. Results of measurements from the different platforms are compared, and model simulations used to deduce the surface albedo from the effective albedo at altitude, giving, for example, an albedo of 0.02 ± 0.01 at 340nm.

  16. Evaluating Options for Civil Space Situational Awareness (SSA)

    Science.gov (United States)

    Lal, B.; Carioscia, S. A.

    In recent years, the number of active satellites and human-made orbital space debris has increased dramatically. An expansion of activities in space, as is currently being proposed by many commercial and international entities, is expected to further exacerbate this challenge. The 18th Space Control Squadron under the Department of Defense (DOD) United States Strategic Command provides space situational awareness (SSA) services to users outside the national security community at no cost. International and commercial users demand better SSA service than is currently feasible, and the demand comes at a time when DOD is under pressure to better prepare for and respond to growing space-based threats to national security. Concerned about the possibility of overextending across conflicting missions in a fiscally constrained environment, some DOD officials have publicly noted a desire to move SSA services not related to national security out of DOD purview. Responding to a request from the Federal Aviation Administration (FAA) Office of Commercial Space Transportation (AST), researchers at the Science and Technology Policy Institute (STPI) identified and evaluated potential approaches for providing SSA services for civil and commercial operations in space. In this paper, we summarize the report [1] and present the pros and cons of four approaches to the provision of civil SSA services in the United States: (1) maintaining status quo through continued provision by DOD; (2) provision by a civil government entity; (3) industry self-provision; and (4) provision by an international organization. Within the second approach, assuming the provision of SSA by a civil agency, STPI further identified and discussed four options: (1) civil agency service capability embedded within DOD; (2) independent civil service capability, using DOD software and systems; (3) independent civil service capability, using commercial software and systems; and (4) the government certifies non

  17. Sessile serrated adenoma (SSA) vs. traditional serrated adenoma (TSA).

    Science.gov (United States)

    Torlakovic, Emina Emilia; Gomez, Jose D; Driman, David K; Parfitt, Jeremy R; Wang, Chang; Benerjee, Tama; Snover, Dale C

    2008-01-01

    The morphologic distinction between various serrated polyps of the colorectum may be challenging. The distinction between sessile serrated adenoma (SSA) and traditional serrated adenoma (TSA) may be difficult using currently available criteria mostly based on cytologic characteristics. We have evaluated 66 serrated polyps including 29 SSA, 18 TSA, and 19 hyperplastic polyps for overall shape of the polyps, architectural features of individual crypts, the presence of eosinophilic cytoplasm, size and distribution of the proliferation and maturation zones, as well as Ki-67 and CK20 expression. The extent of the expression of CK20 and Ki-67 could not distinguish between the 3 types of serrated polyps, but the distribution of their expression was very helpful and differences were statistically significant. The distribution of Ki-67+ cells was the single most helpful distinguishing feature of the serrated polyp type (PTSA had low Ki-67 expression, which was limited to "ectopic crypts" and admixed tubular adenomalike areas. In serrated polyps, ectopic crypt formation (ECF) defined by the presence of ectopic crypts with their bases not seated adjacent to the muscularis mucosae was nearly exclusive to TSA and was found in all cases, while the presence of cytologic atypia and eosinophilia of the cytoplasm were characteristic, but not limited to TSA. No evidence of ECF, but nevertheless abnormal distribution of proliferation zone was characteristic of SSA, whereas HP had neither. The presence of the ECF defines TSA in a more rigorous fashion than previous diagnostic criteria and also explains the biologic basis of exuberant protuberant growth associated with TSA and the lack of such growth in SSA. Recognition of this phenomenon may also help in exploring the genetic and molecular basis for differences between SSA and TSA, because these architectural abnormalities may well be a reflection of abnormalities in genetically programmed mucosal development.

  18. Non-traditional Sensor Tasking for SSA: A Case Study

    Science.gov (United States)

    Herz, A.; Herz, E.; Center, K.; Martinez, I.; Favero, N.; Clark, C.; Therien, W.; Jeffries, M.

    Industry has recognized that maintaining SSA of the orbital environment going forward is too challenging for the government alone. Consequently there are a significant number of commercial activities in various stages of development standing-up novel sensors and sensor networks to assist in SSA gathering and dissemination. Use of these systems will allow government and military operators to focus on the most sensitive space control issues while allocating routine or lower priority data gathering responsibility to the commercial side. The fact that there will be multiple (perhaps many) commercial sensor capabilities available in this new operational model begets a common access solution. Absent a central access point to assert data needs, optimized use of all commercial sensor resources is not possible and the opportunity for coordinated collections satisfying overarching SSA-elevating objectives is lost. Orbit Logic is maturing its Heimdall Web system - an architecture facilitating “data requestor” perspectives (allowing government operations centers to assert SSA data gathering objectives) and “sensor operator” perspectives (through which multiple sensors of varying phenomenology and capability are integrated via machine -machine interfaces). When requestors submit their needs, Heimdall’s planning engine determines tasking schedules across all sensors, optimizing their use via an SSA-specific figure-of-merit. ExoAnalytic was a key partner in refining the sensor operator interfaces, working with Orbit Logic through specific details of sensor tasking schedule delivery and the return of observation data. Scant preparation on both sides preceded several integration exercises (walk-then-run style), which culminated in successful demonstration of the ability to supply optimized schedules for routine public catalog data collection – then adapt sensor tasking schedules in real-time upon receipt of urgent data collection requests. This paper will provide a

  19. Arctic sea ice albedo from AVHRR

    Science.gov (United States)

    Lindsay, R. W.; Rothrock, D. A.

    1994-01-01

    The seasonal cycle of surface albedo of sea ice in the Arctic is estimated from measurements made with the Advanced Very High Resolution Radiometer (AVHRR) on the polar-orbiting satellites NOAA-10 and NOAA-11. The albedos of 145 200-km-square cells are analyzed. The cells are from March through September 1989 and include only those for which the sun is more than 10 deg above the horizon. Cloud masking is performed manually. Corrections are applied for instrument calibration, nonisotropic reflection, atmospheric interference, narrowband to broadband conversion, and normalization to a common solar zenith angle. The estimated albedos are relative, with the instrument gain set to give an albedo of 0.80 for ice floes in March and April. The mean values for the cloud-free portions of individual cells range from 0.18 to 0.91. Monthly averages of cells in the central Arctic range from 0.76 in April to 0.47 in August. The monthly averages of the within-cell standard deviations in the central Arctic are 0.04 in April and 0.06 in September. The surface albedo and surface temperature are correlated most strongly in March (R = -0.77) with little correlation in the summer. The monthly average lead fraction is determined from the mean potential open water, a scaled representation of the temperature or albedo between 0.0 (for ice) and 1.0 (for water); in the central Arctic it rises from an average 0.025 in the spring to 0.06 in September. Sparse data on aerosols, ozone, and water vapor in the atmospheric column contribute uncertainties to instantaneous, area-average albedos of 0.13, 0.04, and 0.08. Uncertainties in monthly average albedos are not this large. Contemporaneous estimation of these variables could reduce the uncertainty in the estimated albedo considerably. The poor calibration of AVHRR channels 1 and 2 is another large impediment to making accurate albedo estimates.

  20. SURFACE ALBEDO AND SPECTRAL VARIABILITY OF CERES

    Energy Technology Data Exchange (ETDEWEB)

    Li, Jian-Yang; Reddy, Vishnu; Corre, Lucille Le; Sykes, Mark V.; Prettyman, Thomas H. [Planetary Science Institute, 1700 E. Ft. Lowell Road, Suite 106, Tucson, AZ 85719 (United States); Nathues, Andreas; Hoffmann, Martin; Schaefer, Michael [Max Planck Institute for Solar System Research, Göttingen (Germany); Izawa, Matthew R. M.; Cloutis, Edward A. [University of Winnipeg, Winnipeg, Manitoba (Canada); Carsenty, Uri; Jaumann, Ralf; Krohn, Katrin; Mottola, Stefano; Schröder, Stefan E. [German Aerospace Center (DLR), Institute of Planetary Research, Berlin (Germany); Castillo-Rogez, Julie C. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Schenk, Paul [Lunar and Planetary Institute, Houston, TX 77058 (United States); Williams, David A. [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States); Smith, David E. [Solar System Exploration Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Zuber, Maria T. [Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); and others

    2016-02-01

    Previous observations suggested that Ceres has active, but possibly sporadic, water outgassing as well as possibly varying spectral characteristics over a timescale of months. We used all available data of Ceres collected in the past three decades from the ground and the Hubble Space Telescope, as well as the newly acquired images by the Dawn  Framing Camera, to search for spectral and albedo variability on Ceres, on both a global scale and in local regions, particularly the bright spots inside the Occator crater, over timescales of a few months to decades. Our analysis has placed an upper limit on the possible temporal albedo variation on Ceres. Sporadic water vapor venting, or any possibly ongoing activity on Ceres, is not significant enough to change the albedo or the area of the bright features in the Occator crater by >15%, or the global albedo by >3% over the various timescales that we searched. Recently reported spectral slope variations can be explained by changing Sun–Ceres–Earth geometry. The active area on Ceres is less than 1 km{sup 2}, too small to cause global albedo and spectral variations detectable in our data. Impact ejecta due to impacting projectiles of tens of meters in size like those known to cause observable changes to the surface albedo on Asteroid Scheila cannot cause detectable albedo change on Ceres due to its relatively large size and strong gravity. The water vapor activity on Ceres is independent of Ceres’ heliocentric distance, ruling out the possibility of the comet-like sublimation process as a possible mechanism driving the activity.

  1. Sea ice-albedo climate feedback mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Schramm, J.L.; Curry, J.A. [Univ. of Colorado, Boulder, CO (United States); Ebert, E.E. [Bureau of Meterology Research Center, Melbourne (Australia)

    1995-02-01

    The sea ice-albedo feedback mechanism over the Arctic Ocean multiyear sea ice is investigated by conducting a series of experiments using several one-dimensional models of the coupled sea ice-atmosphere system. In its simplest form, ice-albedo feedback is thought to be associated with a decrease in the areal cover of snow and ice and a corresponding increase in the surface temperature, further decreasing the area cover of snow and ice. It is shown that the sea ice-albedo feedback can operate even in multiyear pack ice, without the disappearance of this ice, associated with internal processes occurring within the multiyear ice pack (e.g., duration of the snow cover, ice thickness, ice distribution, lead fraction, and melt pond characteristics). The strength of the ice-albedo feedback mechanism is compared for several different thermodynamic sea ice models: a new model that includes ice thickness distribution., the Ebert and Curry model, the Mayjut and Untersteiner model, and the Semtner level-3 and level-0 models. The climate forcing is chosen to be a perturbation of the surface heat flux, and cloud and water vapor feedbacks are inoperative so that the effects of the sea ice-albedo feedback mechanism can be isolated. The inclusion of melt ponds significantly strengthens the ice-albedo feedback, while the ice thickness distribution decreases the strength of the modeled sea ice-albedo feedback. It is emphasized that accurately modeling present-day sea ice thickness is not adequate for a sea ice parameterization; the correct physical processes must be included so that the sea ice parameterization yields correct sensitivities to external forcing. 22 refs., 6 figs., 1 tab.

  2. Effect of the single-scattering phase function on light transmission through disordered media with large inhomogeneities

    International Nuclear Information System (INIS)

    Marinyuk, V V; Sheberstov, S V

    2017-01-01

    We calculate the total transmission coefficient (transmittance) of a disordered medium with large (compared to the light wavelength) inhomogeneities. To model highly forward scattering in the medium we take advantage of the Gegenbauer kernel phase function. In a subdiffusion thickness range, the transmittance is shown to be sensitive to the specific form of the single-scattering phase function. The effect reveals itself at grazing angles of incidence and originates from small-angle multiple scattering of light. Our results are in a good agreement with numerical solutions to the radiative transfer equation. (paper)

  3. Thermal neutron albedo measurements for multilithic reflectors

    International Nuclear Information System (INIS)

    Mehboob, Khurram; Ahmed, Raheel; Ali, Majid; Tabassam, Uzma

    2013-01-01

    Highlights: • Measurement of thermal neuron albedo for multilithic reflectors. • Modeling of experiments in MATLAB. • Comparison of numerical calculated and experimental values. • Study of thermal neutron albedo in different multilayered shielding. - Abstract: An experimental measurement of the thermal neutron (0.025 eV) albedo (αth) has been carried out for multilithic shielding by using Am–Be neutron source and BF 3 detector. The measured saturation value for the thermal albedo of paraffin wax has been found to be 0.734 ± 0.020, which is in close agreement to the corresponding value 0.83 quoted in the literature. The thermal neutron albedo has been measured for the multilayered shielding in copper–wood, copper–aluminum, wood–paraffin and paraffin–iron combinations in horizontal geometric configurations. Modeling and numerical simulation have been carried out by developing a MATLAB code which solves the diffusion equation in order to calculate the experimental results. Good agreement has been found between the numerical calculated and experimental results. The uncertainties in the measurements have also been calculated based on error propagation of the underlying Poisson distribution

  4. A hybrid intermediate language between SSA and CPS

    DEFF Research Database (Denmark)

    Torrens, Paulo; Vasconcellos, Cristiano; Gonçalves, Ju

    2017-01-01

    passing style (CPS) lambda calculus has been used as intermediate language for functional language compilers, they are (almost) equivalent and it is possible to draw syntactic translations between them. This short paper aims to present an untyped intermediate language which may be interpreted as both SSA...... and CPS, in order to provide a common language for both imperative and functional compilers, as well to take advantage of optimizations designed for either one of the approaches. Finally, potential variants and research opportunities are discussed....

  5. Intercomparison measurements with albedo neutron dosimeters

    International Nuclear Information System (INIS)

    Alberts, W.G.; Kluge, H.

    1994-01-01

    Since the introduction of the albedo dosimeter as the official personal neutron dosimeter the dosimetry services concerned have participated in intercomparison measurements at the PTB. Their albedo dosimeters were irradiated in reference fields produced by unmoderated and D 2 O-moderated 252 Cf neutron sources in the standard irradiation facility of the PTB. Six fields with fluences different in energy and angle distribution could be realised in order to determine the response of the albedo dosimeter. The dose equivalent values evaluated by the services were compared with the reference values of the PTB for the directional dose equivalent H'(10). The results turned out to be essentially dependent on the evaluation method and the choice of the calibration factors. (orig.) [de

  6. Systematic Sustainability Assessment (SSA) Tool for Hydroelectric Project in Malaysia

    Science.gov (United States)

    Turan, Faiz Mohd; Johan, Kartina

    2017-08-01

    Sustainably developed and managed hydropower has enormous potential to contribute to global sustainability goals. It is known that hydroelectricity contributing small amounts to greenhouse gas emissions and other atmospheric pollutants. However, developing the remaining hydroelectric potential offers many challenges, and public pressure and expectations on the environmental and social performance of hydroelectric tend to increase over time. This paper aims to develop Systematic Sustainability Assessment (SSA) Tool that promotes and guides more sustainable hydroelectric projects in the context of Malaysia. The proposed SSA tool which not only provide a quality and quantitative report of sustainability performance but also act as Self-Assessment Report (SAR) to provide roadmap to achieve greater level of sustainability in project management for continuous improvement. It is expected to provide a common language that allow government, civil society, financial institutions and the hydroelectric sector to talk about and evaluate sustainability issues. The advantage of SSA tool is it can be used at any stage of hydroelectric development, from the earliest planning stages right through to operation.

  7. Accurate single-scattering simulation of ice cloud using the invariant-imbedding T-matrix method and the physical-geometric optics method

    Science.gov (United States)

    Sun, B.; Yang, P.; Kattawar, G. W.; Zhang, X.

    2017-12-01

    The ice cloud single-scattering properties can be accurately simulated using the invariant-imbedding T-matrix method (IITM) and the physical-geometric optics method (PGOM). The IITM has been parallelized using the Message Passing Interface (MPI) method to remove the memory limitation so that the IITM can be used to obtain the single-scattering properties of ice clouds for sizes in the geometric optics regime. Furthermore, the results associated with random orientations can be analytically achieved once the T-matrix is given. The PGOM is also parallelized in conjunction with random orientations. The single-scattering properties of a hexagonal prism with height 400 (in units of lambda/2*pi, where lambda is the incident wavelength) and an aspect ratio of 1 (defined as the height over two times of bottom side length) are given by using the parallelized IITM and compared to the counterparts using the parallelized PGOM. The two results are in close agreement. Furthermore, the integrated single-scattering properties, including the asymmetry factor, the extinction cross-section, and the scattering cross-section, are given in a completed size range. The present results show a smooth transition from the exact IITM solution to the approximate PGOM result. Because the calculation of the IITM method has reached the geometric regime, the IITM and the PGOM can be efficiently employed to accurately compute the single-scattering properties of ice cloud in a wide spectral range.

  8. Albedos of Jovian Trojans, Hildas and Centaurs

    Science.gov (United States)

    Romanishin, William; Tegler, Stephen C.

    2017-10-01

    We present distributions of optical V band albedos for samples of outer solar system minor bodies including Centaurs, Jovian Trojans and Hildas. Diameters come almost entirely from the NEOWISE catalog (Mainzer etal 2016- Planetary Data System). Optical photometry (H values) for about 2/3 of the approximately 2700 objects studied are from PanStarrrs (Veres et al 2015 Icarus 261, 34). The PanStarrs optical photometry is supplemented by H values from JPL Horizons (corrected to be on the same photometric system as the PanStarrs data) for the objects in the NEOWISE catalog that are not in the PanStarrs catalog. We compare the albedo distributions of various pairs of subsamples using the nonparametric Wilcoxon rank sum test. Examples of potentially interesting comparisons include: (1) The Hildas are 15-25% darker than the Trojans at a very high level of statistical significance. If the Hildas and Trojans started out with similar surfaces, the Hildas may have darkened due to the effects of gardening as they pass through zone III of the asteroid belt. (2) The median albedo of the gray Centaurs lies between that of the L4 and L5 Trojan groups (3) The median L5 Trojan cloud albedo is about 10% darker than that of the L4 cloud at a high level of significance. However, the modes of the L4 and L5 albedo distributions are very similar, perhaps indicating the presence of a distinct brighter component in the L4 cloud that is not found in the L5 cloud.

  9. Factors affecting polyamide prototypes design of Albedo dosemeters

    International Nuclear Information System (INIS)

    Martins, M.M.; Mauricio, C.L.P.; Fonseca, E.S.

    1996-01-01

    This work studies the most important factors which affect the response of albedo neutron dosemeters containing LiF TLDs with the aim to improve their sensitivity. It includes tests of thickness and shape of the polyamide moderator body prototypes, albedo window diameter and TLD position inside the moderator. Analyzing the results, an albedo neutron dosemeter prototype, B 4 C covered, was developed. The prototype has a response three times higher than the albedo dosemeter now in use in Brazil. (author)

  10. Albedo distribution in Lutzow-Holm Bay and its neighborhood

    Directory of Open Access Journals (Sweden)

    Kiyotaka Nakagawa

    1997-03-01

    Full Text Available A method has been developed for estimating the filtered narrow band surface albedo with NOAA/AVHRR data, and has been applied to analysis of the surface albedo distribution in Lutzow-Holm Bay and its neighborhood, Antarctica, in 1990. As a result, 16 maps of the surface albedo distribution have been drawn. From a comparison of the albedos inferred from satellite data with those actually observed in Ongul Strait, it is clear that the satellite-inferred, filtered narrow band albedos agree well with the daily means of ground-observed, unfiltered broad band albedo, despite systematic errors of about -4%. It is also clear that there is a characteristic pattern of surface albedo distribution in this area; the open sea has very low albedo of less than 5%, whereas most of the compact pack ice and fast ice has a high albedo of more than 60%. The albedo is lower in the eastern part of Lutzow-Holm Bay than in the western part; especially off the Soya Coast it is less than 40%. The ice sheet of Antarctica has a remarkably high albedo of more than 80%.

  11. Estimation of daily albedo on Tottori sand surface

    International Nuclear Information System (INIS)

    Gu, S.; Otsuki, K.; Kamichika, M.

    2001-01-01

    Daily albedos of a bare sand surface were measured with a solarimeter (Eko MS-62) between 23 August and 30 November in 1997 at Tottori sand dune, Japan. These quickly decreased on rainy days, and recovered during dry spells (days between rainfalls). A strong exponential relationship was found between daily albedos and the number of dry days. The daily albedos on dry days also showed a direct relationship with daily transmissivities in the range less than 0.55. Two simple models were developed to estimate daily albedos for dry spell days on bare Tottori sand surface using routine meteorological data. Daily albedos were calculated using these two models, and compared with the measured daily albedos. For Model #1, the daily albedos were successfully predicted only using the number of dry spell days; the correlation coefficient between the estimated and measured albedo was 0.73, and the standard error was 1.2%. For Model #2, the number of dry spell days and transmissivity were considered in order to calculate the daily albedo on dry spell days; the correlation coefficient was 0.85, and the standard error was 0.9%. Estimated albedos were in good agreement with measured albedos. (author)

  12. Modeling Earth Albedo for Satellites in Earth Orbit

    DEFF Research Database (Denmark)

    Bhanderi, Dan; Bak, Thomas

    2005-01-01

    Many satellite are influences by the Earthøs albedo, though very few model schemes exist.in order to predict this phenomenon. Earth albedo is often treated as noise, or ignored completely. When applying solar cells in the attitude hardware, Earth albedo can cause the attitude estimate to deviate...... with as much as 20 deg. Digital Sun sensors with Earth albedo correction in hardware exist, but are expensive. In addition, albedo estimates are necessary in thermal calculations and power budgets. We present a modeling scheme base4d on Eartht reflectance, measured by NASA's Total Ozone Mapping Spectrometer......, in which the Earth Probe Satellite has recorded reflectivity data daily since mid 1996. The mean of these data can be used to calculate the Earth albedo given the positions of the satellite and the Sun. Our results show that the albedo varies highly with the solar angle to the satellite's field of view...

  13. Generalized Calibration of the Polarimetric Albedo Scale of Asteroids

    Science.gov (United States)

    Lupishko, D. F.

    2018-03-01

    Six different calibrations of the polarimetric albedo scale of asteroids have been published so far. Each of them contains its particular random and systematic errors and yields its values of geometric albedo. On the one hand, this complicates their analysis and comparison; on the other hand, it becomes more and more difficult to decide which of the proposed calibrations should be used. Moreover, in recent years, new databases on the albedo of asteroids obtained from the radiometric surveys of the sky with the orbital space facilities (the InfraRed Astronomical Satellite (IRAS), the Japanese astronomical satellite AKARI (which means "light"), the Wide-field Infrared Survey Explorer (WISE), and the Near-Earth Object Wide-field Survey Explorer (NEOWISE)) have appeared; and the database on the diameters and albedos of asteroids obtained from their occultations of stars has substantially increased. Here, we critically review the currently available calibrations and propose a new generalized calibration derived from the interrelations between the slope h and the albedo and between P min and the albedo. This calibration is based on all of the available series of the asteroid albedos and the most complete data on the polarization parameters of asteroids. The generalized calibration yields the values of the polarimetric albedo of asteroids in the system unified with the radiometric albedos and the albedos obtained from occultations of stars by asteroids. This, in turn, removes the difficulties in their comparison, joint analysis, etc.

  14. Plane-dependent ML scatter scaling: 3D extension of the 2D simulated single scatter (SSS) estimate

    Science.gov (United States)

    Rezaei, Ahmadreza; Salvo, Koen; Vahle, Thomas; Panin, Vladimir; Casey, Michael; Boada, Fernando; Defrise, Michel; Nuyts, Johan

    2017-08-01

    Scatter correction is typically done using a simulation of the single scatter, which is then scaled to account for multiple scatters and other possible model mismatches. This scaling factor is determined by fitting the simulated scatter sinogram to the measured sinogram, using only counts measured along LORs that do not intersect the patient body, i.e. ‘scatter-tails’. Extending previous work, we propose to scale the scatter with a plane dependent factor, which is determined as an additional unknown in the maximum likelihood (ML) reconstructions, using counts in the entire sinogram rather than only the ‘scatter-tails’. The ML-scaled scatter estimates are validated using a Monte-Carlo simulation of a NEMA-like phantom, a phantom scan with typical contrast ratios of a 68Ga-PSMA scan, and 23 whole-body 18F-FDG patient scans. On average, we observe a 12.2% change in the total amount of tracer activity of the MLEM reconstructions of our whole-body patient database when the proposed ML scatter scales are used. Furthermore, reconstructions using the ML-scaled scatter estimates are found to eliminate the typical ‘halo’ artifacts that are often observed in the vicinity of high focal uptake regions.

  15. Human Decision Processes: Implications for SSA Support Tools

    Science.gov (United States)

    Picciano, P.

    2013-09-01

    Despite significant advances in computing power and artificial intelligence (AI), few critical decisions are made without a human decision maker in the loop. Space Situational Awareness (SSA) missions are both critical and complex, typically adhering to the human-in-the-loop (HITL) model. The collection of human operators injects a needed diversity of expert knowledge, experience, and authority required to successfully fulfill SSA tasking. A wealth of literature on human decision making exists citing myriad empirical studies and offering a varied set of prescriptive and descriptive models of judgment and decision making (Hastie & Dawes, 2001; Baron, 2000). Many findings have been proven sufficiently robust to allow information architects or system/interface designers to take action to improve decision processes. For the purpose of discussion, these concepts are bifurcated in two groups: 1) vulnerabilities to mitigate, and 2) capabilities to augment. These vulnerabilities and capabilities refer specifically to the decision process and should not be confused with a shortcoming or skill of a specific human operator. Thus the framing of questions and orders, the automated tools with which to collaborate, priming and contextual data, and the delivery of information all play a critical role in human judgment and choice. Evaluating the merits of any decision can be elusive; in order to constrain this discussion, ‘rational choice' will tend toward the economic model characteristics such as maximizing utility and selection consistency (e.g., if A preferred to B, and B preferred to C, than A should be preferred to C). Simple decision models often encourage one to list the pros and cons of a decision, perhaps use a weighting schema, but one way or another weigh the future benefit (or harm) of making a selection. The result (sought by the rationalist models) should drive toward higher utility. Despite notable differences in researchers' theses (to be discussed in the full

  16. MELiSSA Food Characterization general approach and current status

    Science.gov (United States)

    Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe

    Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities

  17. 77 FR 43639 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-07-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0090] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  18. 77 FR 54943 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-09-06

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0016] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...

  19. The organic fraction of bubble-generated, accumulation mode Sea Spray Aerosol (SSA

    Directory of Open Access Journals (Sweden)

    R. L. Modini

    2010-03-01

    Full Text Available Recent studies have detected a dominant accumulation mode (~100 nm in the Sea Spray Aerosol (SSA number distribution. There is evidence to suggest that particles in this mode are composed primarily of organics. To investigate this hypothesis we conducted experiments on NaCl, artificial SSA and natural SSA particles with a Volatility-Hygroscopicity-Tandem-Differential-Mobility-Analyser (VH-TDMA. NaCl particles were atomiser generated and a bubble generator was constructed to produce artificial and natural SSA particles. Natural seawater samples for use in the bubble generator were collected from biologically active, terrestrially-affected coastal water in Moreton Bay, Australia. Differences in the VH-TDMA-measured volatility curves of artificial and natural SSA particles were used to investigate and quantify the organic fraction of natural SSA particles. Hygroscopic Growth Factor (HGF data, also obtained by the VH-TDMA, were used to confirm the conclusions drawn from the volatility data. Both datasets indicated that the organic fraction of our natural SSA particles evaporated in the VH-TDMA over the temperature range 170–200 °C. The organic volume fraction for 71–77 nm natural SSA particles was 8±6%. Organic volume fraction did not vary significantly with varying water residence time (40 s to 24 h in the bubble generator or SSA particle diameter in the range 38–173 nm. At room temperature we measured shape- and Kelvin-corrected HGF at 90% RH of 2.46±0.02 for NaCl, 2.35±0.02 for artifical SSA and 2.26±0.02 for natural SSA particles. Overall, these results suggest that the natural accumulation mode SSA particles produced in these experiments contained only a minor organic fraction, which had little effect on hygroscopic growth. Our measurement of 8±6% is an order of magnitude below two previous measurements of the organic fraction in SSA particles of comparable sizes. We stress that our results were obtained using coastal seawater and

  20. Albedo and transmittance of inhomogeneous stratus clouds

    Energy Technology Data Exchange (ETDEWEB)

    Zuev, V.E.; Kasyanov, E.I.; Titov, G.A. [Institute of Atmospheric Optics, Tomsk (Russian Federation)] [and others

    1996-04-01

    A highly important topic is the study of the relationship between the statistical parameters of optical and radiative charactertistics of inhomogeneous stratus clouds. This is important because the radiation codes of general circulation models need improvement, and it is important for geophysical information. A cascade model has been developed at the Goddard Space Flight Center to treat stratocumulus clouds with the simplest geometry and horizontal fluctuations of the liquid water path (optical thickness). The model evaluates the strength with which the stochastic geometry of clouds influences the statistical characteristics of albedo and the trnasmittance of solar radiation.

  1. Impact of Atmospheric Albedo on Amazon Evapotranspiration

    Science.gov (United States)

    Lopes, A. V.; Thompson, S. E.; Dracup, J. A.

    2013-12-01

    The vulnerability of the Amazon region to climate and anthropogenic driven disturbances has been the subject of extensive research efforts, given its importance in the global and regional climate and ecologic systems. The evaluation of such vulnerabilities requires the proper understanding of physical mechanisms controlling water and energy balances and how the disturbances change them. Among those mechanisms, the effects of atmospheric albedo on evapotranspiration have not been fully explored yet and are explored in this study. Evapotranspiration in the Amazon is sustained at high levels across all seasons and represents a large fraction of water and energy surface budgets. In this study, statistical analysis of data from four flux towers installed at Amazon primary forest sites was employed to quantify the impact of atmospheric albedo, mostly resulted from cloudiness, on evapotranspiration and to compare it to the effect of water limitation. Firstly, the difference in eddy-flux derived evapotranspiration at the flux towers under rainy and non-rainy antecedent conditions was tested for significance. Secondly, the same statistical comparison was performed under cloudy and clear sky conditions at hourly and daily time scales, using the reduction in incoming solar radiation as an indicator of cloudiness. Finally, the sensitivity of seasonal evapotranspiration totals to atmospheric albedo resulted from rainfall patterns is evaluated. That was done by sampling daily evapotranspiration estimates from empirical probability distribution functions conditioned to rainfall occurrence and then varying the number of dry days in each season. It was found that light limitation is much more important than water limitation in the Amazon, resulting in up to 43% reduction in daily evapotranspiration. Also, this effect varies by location and by season, the largest impact being in wet season, from December do January. Moreover, seasonal evapotranspiration totals were found to be

  2. Albedo of the ice-covered Weddell and Bellingshausen Sea

    OpenAIRE

    A. I. Weiss; J. C. King; T. A. Lachlan-Cope; R. S. Ladkin

    2011-01-01

    This study investigates the surface albedo of the sea ice areas adjacent to the Antarctic Peninsula during the austral summer. Aircraft measurements of the surface albedo which were conducted in the sea ice areas of the Weddell and Bellingshausen Sea show significant differences between these two regions. The averaged surface albedo varied between 0.13 and 0.81. The ice cover of the Bellingshausen Sea consisted mainly of first year ice and the sea surface showed an averaged sea ice albed...

  3. Summer Arctic sea ice albedo in CMIP5 models

    OpenAIRE

    Koenigk, T.; Devasthale, A.; Karlsson, K.-G.

    2014-01-01

    Spatial and temporal variations of summer sea ice albedo over the Arctic are analyzed using an ensemble of historical CMIP5 model simulations. The results are compared to the CLARA-SAL product that is based on long-term satellite observations. The summer sea ice albedo varies substantially among CMIP5 models, and many models show large biases compared to the CLARA-SAL product. Single summer months show an extreme spread of ice albedo among models; July values vary between 0....

  4. Preliminary study of the space adaptation of the MELiSSA life support system

    Science.gov (United States)

    Mas-Albaigès, Joan L.; Duatis, Jordi; Podhajsky, Sandra; Guirado, Víctor; Poughon, Laurent

    MELiSSA (Micro-Ecological Life Support System Alternative) is an European Space Agency (ESA) project focused on the development of a closed regenerative life support system to aid the development of technologies for future life support systems for long term manned planetary missions, e.g. a lunar base or missions to Mars. In order to understand the potential evolution of the MELiSSA concept towards its future use in the referred manned planetary mission context the MELiSSA Space Adaptation (MSA) activity has been undertaken. MSA's main objective is to model the different MELiSSA compartments using EcosimPro R , a specialized simulation tool for life support applications, in order to define a preliminary MELiSSA implementation for service in a man-tended lunar base scenario, with a four-member crew rotating in six-month increments, and performing the basic LSS functions of air revitalization, food production, and waste and water recycling. The MELiSSA EcosimPro R Model features a dedicated library for the different MELiSSA elements (bioreactors, greenhouse, crew, interconnecting elements, etc.). It is used to dimension the MELiSSA system in terms of major parameters like mass, volume and energy needs, evaluate the accuracy of the results and define the strategy for a progressive loop closure from the initial required performance (approx.100 The MELiSSA configuration(s) obtained through the EcosimPro R simulation are further analysed using the Advanced Life Support System Evaluation (ALISSE) metric, relying on mass, energy, efficiency, human risk, system reliability and crew time, for trade-off and optimization of results. The outcome of the MSA activity is, thus, a potential Life Support System architecture description, based on combined MELiSSA and other physico-chemical technologies, defining its expected performance, associated operational conditions and logistic needs.

  5. Albedo of the ice covered Weddell and Bellingshausen Seas

    OpenAIRE

    A. I. Weiss; J. C. King; T. A. Lachlan-Cope; R. S. Ladkin

    2012-01-01

    This study investigates the surface albedo of the sea ice areas adjacent to the Antarctic Peninsula during the austral summer. Aircraft measurements of the surface albedo, which were conducted in the sea ice areas of the Weddell and Bellingshausen Seas show significant differences between these two regions. The averaged surface albedo varied between 0.13 and 0.81. The ice cover of the Bellingshausen Sea consisted mainly of first year ice and the sea surface showed an averaged sea ice albedo o...

  6. Short-wave albedo of a pine forest

    Energy Technology Data Exchange (ETDEWEB)

    Kessler, A.

    1985-06-01

    In this paper nine years of continuous records of the short-wave albedo above a Scotch pine forest in middle Europe were analysed. Special emphasis was given to the dependencies of the albedo on its diurnal variation, its annual variation, the solar altitude, the structure of the stand, the cloud cover, the soil moisture and the spectral reflectance. A long-termed trend of the albedo could not be found, e.g. caused by the stand growth. Finally the annual variation of the albedo of the Scotch pine forest was compared with measurements above different surface types in middle Europe.

  7. Relationship between cloud radiative forcing, cloud fraction and cloud albedo, and new surface-based approach for determining cloud albedo

    OpenAIRE

    Y. Liu; W. Wu; M. P. Jensen; T. Toto

    2011-01-01

    This paper focuses on three interconnected topics: (1) quantitative relationship between surface shortwave cloud radiative forcing, cloud fraction, and cloud albedo; (2) surfaced-based approach for measuring cloud albedo; (3) multiscale (diurnal, annual and inter-annual) variations and covariations of surface shortwave cloud radiative forcing, cloud fraction, and cloud albedo. An analytical expression is first derived to quantify the relationship between cloud radiative forcing, cloud fractio...

  8. OMI/Aura Multi-wavelength Aerosol Optical Depth and Single Scattering Albedo Daily L2 Global 0.25x0.25 deg Lat/Lon Grid V003

    Data.gov (United States)

    National Aeronautics and Space Administration — The second release of Collection 3 OMI/Aura level-2G daily global gridded (0.25x0.25 deg) Aerosol data product OMAEROG (Version 003 has been made available to the...

  9. OMI/Aura Near UV Aerosol Optical Depth and Single Scattering Albedo Daily L2 Global 0.25x0.25 deg Lat/Lon Grid V003

    Data.gov (United States)

    National Aeronautics and Space Administration — The OMI-Aura level-2G daily global gridded (0.25x0.25 deg) near-UV Aerosol data product OMAERUVG based on the enhanced algorithm is available from the NASA Goddard...

  10. Cloud albedo increase from carbonaceous aerosol

    Directory of Open Access Journals (Sweden)

    W. R. Leaitch

    2010-08-01

    Full Text Available Airborne measurements from two consecutive days, analysed with the aid of an aerosol-adiabatic cloud parcel model, are used to study the effect of carbonaceous aerosol particles on the reflectivity of sunlight by water clouds. The measurements, including aerosol chemistry, aerosol microphysics, cloud microphysics, cloud gust velocities and cloud light extinction, were made below, in and above stratocumulus over the northwest Atlantic Ocean. On the first day, the history of the below-cloud fine particle aerosol was marine and the fine particle sulphate and organic carbon mass concentrations measured at cloud base were 2.4 μg m−3 and 0.9 μg m−3 respectively. On the second day, the below-cloud aerosol was continentally influenced and the fine particle sulphate and organic carbon mass concentrations were 2.3 μg m−3 and 2.6 μg m−3 respectively. Over the range 0.06–0.8 μm diameter, the shapes of the below-cloud size distributions were similar on both days and the number concentrations were approximately a factor of two higher on the second day. The cloud droplet number concentrations (CDNC on the second day were approximately three times higher than the CDNC measured on the first day. Using the parcel model to separate the influence of the differences in gust velocities, we estimate from the vertically integrated cloud light scattering measurements a 6% increase in the cloud albedo principally due to the increase in the carbonaceous components on the second day. Assuming no additional absorption by this aerosol, a 6% albedo increase translates to a local daytime radiative cooling of ∼12 W m−2. This result provides observational evidence that the role of anthropogenic carbonaceous components in the cloud albedo effect can be much larger than that of anthropogenic sulphate, as some global simulations have indicated.

  11. Anthropogenic desertification by high-albedo pollution Observations and modeling

    Science.gov (United States)

    Otterman, J.; Rosenberg, N. W.; Rosenberg, E.

    1974-01-01

    ERTS-1 MSS albedo data of Western Negev, Sinai and the Gaza strip are presented. A sharp contrast in albedo exists across the Negev-Sinai and Negev-Gaza strip borders. Anthropogenic desertification has occurred on the Arab side due to overgrazing and Bedouin agriculture, whereas natural vegetation grows much more abundantly on the Israeli side.

  12. Inversion of the Earth spherical albedo from radiation-pressure

    Science.gov (United States)

    Wilkman, Olli; Herranen, Joonas; Näränen, Jyri; Virtanen, Jenni; Koivula, Hannu; Poutanen, Markku; Penttilä, Antti; Gritsevich, Maria; Muinonen, Karri

    2017-04-01

    We are studying the retrieval of the spherical albedo and net radiation of the Earth from the perturbations caused by the planet's radiation on the dynamics of its satellites. The spherical or Bond albedo gives the ratio of the fluxes incident on and scattered by the planet. The net radiation represents the net heat input into the planet's climate system and drives changes in its atmospheric, surface, and ocean temperatures. The ultimate aim of the study is inverting the problem and estimating the Earth albedo based on observations of satellites, simultaneously improving the space-geodetic positioning accuracy. Here we investigate the effect of the spherical albedo on satellite orbits with the help of a simplified model. We simulate the propagation of satellite orbits using a new simulation software. The simulation contains the main perturbing forces on medium and high Earth orbits, used by, e.g., navigation satellites, including the radiation pressure of reflected sunlight from the Earth. An arbitrary satellite shape model can be used, and the rotation of the satellite is modeled. In this first study, we use a box-wing satellite model with a simple surface BRDF. We also assume a diffusely reflecting Earth with a single global albedo value. We vary the Earth albedo and search for systematic effects on different orbits. Thereafter, we estimate the dependence of the albedo accuracy on the satellite positioning and timing data available. We show that the inversion of the spherical albedo with reasonable accuracy is feasible from the current space-geodetic measurements.

  13. Albedo decline on Greenland's Mittivakkat Gletscher in a warming climate

    DEFF Research Database (Denmark)

    Mernild, Sebastian H; Malmros, Jeppe K.; Yde, Jacob Clement

    2015-01-01

    Albedo is one of the parameters that govern energy availability for snow and ice surface ablation, and subsequently the surface mass balance conditions of temperate glaciers and ice caps (GIC). Here, we document snow and ice albedo changes for Mittivakkat Gletscher (MG) in Southeast Greenland (20...

  14. LLL development of a combined etch track: albedo dosimeter

    International Nuclear Information System (INIS)

    Griffith, R.V.; Fisher, J.C.; Harder, C.A.

    1977-01-01

    The addition of polycarbonate sheet to albedo detectors for electrochemical etching provides a simple, inexpensive way to reduce the spectral sensitivity of the personnel dosimeter without losing the albedo features of sensitivity and ease of automation. The ECEP technique also provides the dosimetrist with the potential for identifying conditions of body orientation that might otherwise lead to significant error in dosimeter evaluation

  15. Spectral and diurnal variations in clear sky planetary albedo

    Science.gov (United States)

    Briegleb, B.; Ramanathan, V.

    1982-01-01

    Spectral and diurnal variations in the clear sky planetary albedo of the earth are calculated using a radiative transfer model to obtain January and July values for a 5 deg x 5 deg global grid. The model employs observed climatological values of temperatures, humidities, snow and sea-ice cover. The diurnal cycle of clear sky albedo is calculated in the following intervals: 0.2-0.5, 0.5-0.7, and 0.7-4 microns. Observed ozone distribution is specified as a function of latitude and season. The 0.2-0.5 micron spectral albedo is 10-20% higher than the total albedo for all latitudes because of Rayleigh scattering; the 0.5-0.7 micron albedo differs from the total albedo by 1-2% for most latitudes, while the 0.7-4 micron albedo is 5-10% lower than the total because of strong atmospheric absorption. Planetary albedo decreases from morning to local noon, with diurnal variations being particularly strong over water.

  16. NEOWISE REACTIVATION MISSION YEAR TWO: ASTEROID DIAMETERS AND ALBEDOS

    Energy Technology Data Exchange (ETDEWEB)

    Nugent, C. R.; Cutri, R. M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Mainzer, A.; Bauer, J.; Kramer, E. A.; Masiero, J.; Sonnett, S. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Grav, T. [Planetary Science Institute, Tucson, AZ (United States); Wright, E. L., E-mail: cnugent@ipac.caltech.edu [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States)

    2016-09-01

    The Near-Earth Object Wide-Field Infrared Survey Explorer (NEOWISE) mission continues to detect, track, and characterize minor planets. We present diameters and albedos calculated from observations taken during the second year since the spacecraft was reactivated in late 2013. These include 207 near-Earth asteroids (NEAs) and 8885 other asteroids. Of the NEAs, 84% NEAs did not have previously measured diameters and albedos by the NEOWISE mission. Comparison of sizes and albedos calculated from NEOWISE measurements with those measured by occultations, spacecraft, and radar-derived shapes shows accuracy consistent with previous NEOWISE publications. Diameters and albedos fall within ±∼20% and ±∼40%, 1-sigma, respectively, of those measured by these alternate techniques. NEOWISE continues to preferentially discover near-Earth objects which are large (>100 m), and have low albedos.

  17. Use of wrist albedo neutron dosimeters

    International Nuclear Information System (INIS)

    Hankins, D.E.

    1983-01-01

    We are developing a wrist dosimeter that can be used to measure the exposure at the wrist to x-rays, gamma rays, beta-particles, thermal neutrons and fast neutrons. It consists of a modified Hankins Type albedo neutron dosimeter and also contains three pieces of CR-39 plastic. ABS plastic in the form of an elongated hemisphere provides the beta and low energy x-ray shielding necessary to meet the requirement of depth dose measurements at 1 cm. The dosimeter has a beta window located in the side of the hemisphere oriented towards an object being held in the hands. A TLD 600 is positioned under the 1 cm thick ABS plastic and is used to measure the thermal neutron dose. At present we are using Velcro straps to hold the dosimeter on the inside of the wrist. 9 figures

  18. Generating multi-scale albedo look-up maps using MODIS BRDF/Albedo products and landsat imagery

    Science.gov (United States)

    Surface albedo determines radiative forcing and is a key parameter for driving Earth’s climate. Better characterization of surface albedo for individual land cover types can reduce the uncertainty in estimating changes to Earth’s radiation balance due to land cover change. This paper presents a mult...

  19. VBA SSA Acc To Fed Rec Online (SAFRO) - Also known as Veterans Benefit Administration Query (VBAQ).

    Data.gov (United States)

    Social Security Administration — The purpose of this query is to provide SSA field office personnel with real-time access to military discharge data from the VA BIRLS database. This information is...

  20. Shock Hazard Prevention through Self-Healing Insulative Coating on SSA Metallic Bearings, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The space suit assembly (SSA) contains metallic bearings at the wrist, neck, and waist, which are exposed to space environment, and pose a potential shock hazard....

  1. BOREAS TF-06 SSA-YA Surface Energy Flux and Meteorological Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Contains meteorology data collected at the SSA-YA tower flux site by the TF6 group. These data were reported at 10 minute intervals. The flux and ancillary...

  2. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains...

  3. BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data

    Data.gov (United States)

    National Aeronautics and Space Administration — The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains meteorological...

  4. A New Trend-Following Indicator: Using SSA to Design Trading Rules

    Science.gov (United States)

    Leles, Michel Carlo Rodrigues; Mozelli, Leonardo Amaral; Guimarães, Homero Nogueira

    Singular Spectrum Analysis (SSA) is a non-parametric approach that can be used to decompose a time-series as trends, oscillations and noise. Trend-following strategies rely on the principle that financial markets move in trends for an extended period of time. Moving Averages (MAs) are the standard indicator to design such strategies. In this study, SSA is used as an alternative method to enhance trend resolution in comparison with the traditional MA. New trading rules using SSA as indicator are proposed. This paper shows that for the Down Jones Industrial Average (DJIA) and Shangai Securities Composite Index (SSCI) time-series the SSA trading rules provided, in general, better results in comparison to MA trading rules.

  5. Possible role of anti-SSA/Ro antibodies in the pathogenesis of pulmonary hypertension

    Directory of Open Access Journals (Sweden)

    Kelsey Guerreso

    2016-01-01

    Conclusion: It is known that pulmonary hypertension has association with autoimmune diseases, however no clear markers yet exist. Anti-SSA/Ro antibodies have been rarely described in cases of pulmonary disease, and less so in pulmonary hypertension. This case describes a unique association between isolated pulmonary hypertension and anti-SSA/Ro antibody, thereby illustrating the need to investigate this autoantibody and others in the pathogenesis of autoimmune pulmonary hypertension.

  6. Simulations of tropical rainforest albedo: is canopy wetness important?

    Directory of Open Access Journals (Sweden)

    Silvia N.M. Yanagi

    Full Text Available Accurate information on surface albedo is essential for climate modelling, especially for regions such as Amazonia, where the response of the regional atmospheric circulation to the changes on surface albedo is strong. Previous studies have indicated that models are still unable to correctly reproduce details of the seasonal variation of surface albedo. Therefore, it was investigated the role of canopy wetness on the simulated albedo of a tropical rainforest by modifying the IBIS canopy radiation transfer code to incorporate the effects of canopy wetness on the vegetation reflectance. In this study, simulations were run using three versions of the land surface/ecosystem model IBIS: the standard version, the same version recalibrated to fit the data of albedo on tropical rainforests and a modified version that incorporates the effects of canopy wetness on surface albedo, for three sites in the Amazon forest at hourly and monthly scales. The results demonstrated that, at the hourly time scale, the incorporation of canopy wetness on the calculations of radiative transfer substantially improves the simulations results, whereas at the monthly scale these changes do not substantially modify the simulated albedo.

  7. Measurement of TLD Albedo response on various calibration phantoms

    International Nuclear Information System (INIS)

    Momose, T.; Tsujimura, N.; Shinohara, K.; Ishiguro, H.; Nakamura, T.

    1996-01-01

    The International Commission on Radiation Units and Measurements (ICRU) has recommended that individual dosemeter should be calibrated on a suitable phantom and has pointed out that the calibration factor of a neutron dosemeter is strongly influenced by the the exact size and shape of the body and the phantom to which the dosemeter is attached. As the principle of an albedo type thermoluminescent personal dosemeter (albedo TLD) is essentially based on a detection of scattered and moderated neutron from a human body, the sensitivity of albedo TLD is strongly influenced by the incident neutron energy and the calibration phantom. (1) Therefore for albedo type thermoluminescent personal dosemeter (albedo TLD), the information of neutron albedo response on the calibration phantom is important for appropriate dose estimation. In order to investigate the effect of phantom type on the reading of the albedo TLD, measurement of the TLD energy response and angular response on some typical calibration phantoms was performed using dynamitron accelerator and 252 Cf neutron source. (author)

  8. Surface albedo measurements in Mexico City metropolitan area

    Energy Technology Data Exchange (ETDEWEB)

    Castro, T; Mar, B; Longoria, R; Ruiz Suarez, L. G [Centro de Ciencias de la Atmosfera, UNAM, Mexico, D.F. (Mexico); Morales, L [Instituto de Geografia, UNAM, Mexico, D.F. (Mexico)

    2001-04-01

    Optical and thermal properties of soils are important input data for the meteorological and photochemical modules of air quality models. As development of these models increase on spatial resolution good albedo data become more important. In this paper measurements of surface albedo of UV (295-385 nm) and visible (450-550 nm) radiation are reported for different urban and rural surfaces in the vicinity of Mexico City. It was found for the downtown zone and average albedo value of 0.05 which is in very good agreement with reported values for urban surfaces. Our albedo values measured in UV region for grey cement and green grass are of 0.10 and 0.009, respectively, and quite similar to those found at the literature of 0.11 and 0.008 for those type of surfaces. [Spanish] Las propiedades opticas y termicas de suelos son datos importantes para los modulos meteorologicos y fotoquimicos de los modelos de calidad del aire. Conforme aumenta la resolucion espacial del modelo se vuelve mas importante contar con buenos datos de albedo. En este articulo se presentan mediciones de albedo superficial de radiacion Ultravioleta (295-385 nm) y visible (450-550 nm) para diferentes superficies urbanas. Los valores medidos de albedo en la region UV para cemento gris y pasto verde son de 0.10 y 0.009, respectivamente, y son muy similares a los reportados en la literatura, 0.11 y 0.008 para este tipo de superficies.

  9. Hydraulic and mechanical behavior of landfill clay liner containing SSA in contact with leachate.

    Science.gov (United States)

    Zhang, Qian; Lu, Haijun; Liu, Junzhu; Wang, Weiwei; Zhang, Xiong

    2018-05-01

    Sewage sludge ash (SSA) produced by municipal sludge can be used as a modified additive for clay liner, and improves the working performance of landfill clay liner in contact with leachate. Under the action of landfill leachate, the permeability, shear strength, phase composition, and pore structure of the modified clay are investigated through the flexible wall permeability test, triaxial shear test, thermal gravimetric and differential thermal analysis, and low-temperature nitrogen adsorption test, respectively. The hydraulic conductivity of the modified clay containing 0-5% SSA is in the range of 3.94 × 10 -8 -1.16 × 10 -7  cm/s, and the pollutant concentration of the sample without SSA was higher than others. The shear strength of the modified clay is more than that of the traditional clay liner, the cohesion rate of modified clay increases from 32.5 to 199.91 kPa, and the internal friction angle decreases from 32.5° to 15.6°. Furthermore, the weight loss rates of the samples are 15.69%, 17.92%, 18.06%, and 20.68%, respectively, when the SSA content increases from 0% to 5%. The total pore volume and average pore diameter of the modified clay decrease with the increase in the SSA content, respectively. However, the specific area of the modified clay increases with the increase in the SSA content.

  10. GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R

    Directory of Open Access Journals (Sweden)

    Mario Pineda-Krch

    2008-02-01

    Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.

  11. Albedo's determination by the method of neutron impulse

    International Nuclear Information System (INIS)

    Flores Calderon, J.E.

    1982-01-01

    Experiments with non-stationary neutron transport in large cavity moderators (l>>Σsub(tr) -1 ) (where l is the characteristic cavity length and Σsub(tr) -1 the macroscopic transport section of the moderator) led to the method reported in this study which, based on neutron impulses for determining albedo of thermal neutrons, gave a precision greater by an order of magnitude over previous methods. A sufficient time interval after introduction of the neutron flux into the moderator chamber decreased exponentially the decay constant L, which was itself related to albedo by a function called f. Numerical calculations of albedo were assisted. (author)

  12. Automatic Satellite Telemetry Analysis for SSA using Artificial Intelligence Techniques

    Science.gov (United States)

    Stottler, R.; Mao, J.

    In April 2016, General Hyten, commander of Air Force Space Command, announced the Space Enterprise Vision (SEV) (http://www.af.mil/News/Article-Display/Article/719941/hyten-announces-space-enterprise-vision/). The SEV addresses increasing threats to space-related systems. The vision includes an integrated approach across all mission areas (communications, positioning, navigation and timing, missile warning, and weather data) and emphasizes improved access to data across the entire enterprise and the ability to protect space-related assets and capabilities. "The future space enterprise will maintain our nation's ability to deliver critical space effects throughout all phases of conflict," Hyten said. Satellite telemetry is going to become available to a new audience. While that telemetry information should be valuable for achieving Space Situational Awareness (SSA), these new satellite telemetry data consumers will not know how to utilize it. We were tasked with applying AI techniques to build an infrastructure to process satellite telemetry into higher abstraction level symbolic space situational awareness and to initially populate that infrastructure with useful data analysis methods. We are working with two organizations, Montana State University (MSU) and the Air Force Academy, both of whom control satellites and therefore currently analyze satellite telemetry to assess the health and circumstances of their satellites. The design which has resulted from our knowledge elicitation and cognitive task analysis is a hybrid approach which combines symbolic processing techniques of Case-Based Reasoning (CBR) and Behavior Transition Networks (BTNs) with current Machine Learning approaches. BTNs are used to represent the process and associated formulas to check telemetry values against anticipated problems and issues. CBR is used to represent and retrieve BTNs that represent an investigative process that should be applied to the telemetry in certain circumstances

  13. PROVE Surface albedo of Jornada Experimental Range, New Mexico, 1997

    Data.gov (United States)

    National Aeronautics and Space Administration — The objective of this study was to determine the spatial variations in field measurements of broadband albedo as related to the ground cover and under a range of...

  14. Albedo neutron dosimetry in Germany: regulations and performance

    International Nuclear Information System (INIS)

    Luszik-Bhadra, M.; Zimbal, A.; Busch, F.; Jordan, M.; Eichelberger, A.; Engelhardt, J.; Martini, E.; Figel, M.; Haninger, T.; Frasch, G.; Guenther, K.; Seifert, R.; Rimpler, A.

    2014-01-01

    Personal neutron dosimetry has been performed in Germany using albedo dosemeters for >20 y. This paper describes the main principles, the national standards, regulations and recommendations, the quality management and the overall performance, giving some examples. (authors)

  15. ALBEDO PATTERN RECOGNITION AND TIME-SERIES ANALYSES IN MALAYSIA

    Directory of Open Access Journals (Sweden)

    S. A. Salleh

    2012-07-01

    Full Text Available Pattern recognition and time-series analyses will enable one to evaluate and generate predictions of specific phenomena. The albedo pattern and time-series analyses are very much useful especially in relation to climate condition monitoring. This study is conducted to seek for Malaysia albedo pattern changes. The pattern recognition and changes will be useful for variety of environmental and climate monitoring researches such as carbon budgeting and aerosol mapping. The 10 years (2000–2009 MODIS satellite images were used for the analyses and interpretation. These images were being processed using ERDAS Imagine remote sensing software, ArcGIS 9.3, the 6S code for atmospherical calibration and several MODIS tools (MRT, HDF2GIS, Albedo tools. There are several methods for time-series analyses were explored, this paper demonstrates trends and seasonal time-series analyses using converted HDF format MODIS MCD43A3 albedo land product. The results revealed significance changes of albedo percentages over the past 10 years and the pattern with regards to Malaysia's nebulosity index (NI and aerosol optical depth (AOD. There is noticeable trend can be identified with regards to its maximum and minimum value of the albedo. The rise and fall of the line graph show a similar trend with regards to its daily observation. The different can be identified in term of the value or percentage of rises and falls of albedo. Thus, it can be concludes that the temporal behavior of land surface albedo in Malaysia have a uniform behaviours and effects with regards to the local monsoons. However, although the average albedo shows linear trend with nebulosity index, the pattern changes of albedo with respects to the nebulosity index indicates that there are external factors that implicates the albedo values, as the sky conditions and its diffusion plotted does not have uniform trend over the years, especially when the trend of 5 years interval is examined, 2000 shows high

  16. IAU nomenclature for albedo features on the planet Mercury

    Science.gov (United States)

    Dollfus, A.; Chapman, C. R.; Davies, M. E.; Gingerich, O.; Goldstein, R.; Guest, J.; Morrison, D.; Smith, B. A.

    1978-01-01

    The International Astronomical Union has endorsed a nomenclature for the albedo features on Mercury. Designations are based upon the mythological names related to the god Hermes; they are expressed in Latin form. The dark-hued albedo features are associated with the generic term Solitudo. The light-hued areas are designated by a single name without generic term. The 32 names adopted are allocated on the Mercury map.

  17. Evaluation of coarse scale land surface remote sensing albedo product over rugged terrain

    Science.gov (United States)

    Wen, J.; Xinwen, L.; You, D.; Dou, B.

    2017-12-01

    Satellite derived Land surface albedo is an essential climate variable which controls the earth energy budget and it can be used in applications such as climate change, hydrology, and numerical weather prediction. The accuracy and uncertainty of surface albedo products should be evaluated with a reliable reference truth data prior to applications. And more literatures investigated the validation methods about the albedo validation in a flat or homogenous surface. However, the albedo performance over rugged terrain is still unknow due to the validation method limited. A multi-validation strategy is implemented to give a comprehensive albedo validation, which will involve the high resolution albedo processing, high resolution albedo validation based on in situ albedo, and the method to upscale the high resolution albedo to a coarse scale albedo. Among them, the high resolution albedo generation and the upscale method is the core step for the coarse scale albedo validation. In this paper, the high resolution albedo is generated by Angular Bin algorithm. And a albedo upscale method over rugged terrain is developed to obtain the coarse scale albedo truth. The in situ albedo located 40 sites in mountain area are selected globally to validate the high resolution albedo, and then upscaled to the coarse scale albedo by the upscale method. This paper takes MODIS and GLASS albedo product as a example, and the prelimarily results show the RMSE of MODIS and GLASS albedo product over rugged terrain are 0.047 and 0.057, respectively under the RMSE with 0.036 of high resolution albedo.

  18. Quantifying the ice-albedo feedback through decoupling

    Science.gov (United States)

    Kravitz, B.; Rasch, P. J.

    2017-12-01

    The ice-albedo feedback involves numerous individual components, whereby warming induces sea ice melt, inducing reduced surface albedo, inducing increased surface shortwave absorption, causing further warming. Here we attempt to quantify the sea ice albedo feedback using an analogue of the "partial radiative perturbation" method, but where the governing mechanisms are directly decoupled in a climate model. As an example, we can isolate the insulating effects of sea ice on surface energy and moisture fluxes by allowing sea ice thickness to change but fixing Arctic surface albedo, or vice versa. Here we present results from such idealized simulations using the Community Earth System Model in which individual components are successively fixed, effectively decoupling the ice-albedo feedback loop. We isolate the different components of this feedback, including temperature change, sea ice extent/thickness, and air-sea exchange of heat and moisture. We explore the interactions between these different components, as well as the strengths of the total feedback in the decoupled feedback loop, to quantify contributions from individual pieces. We also quantify the non-additivity of the effects of the components as a means of investigating the dominant sources of nonlinearity in the ice-albedo feedback.

  19. Study on the Single Scattering of Elastic Waves by a Cylindrical Fiber with a Partially Imperfect Bonding Using the Collocation Point Method

    Directory of Open Access Journals (Sweden)

    Jun Zhang

    2018-01-01

    Full Text Available The single scattering of P- and SV-waves by a cylindrical fiber with a partially imperfect bonding to the surrounding matrix is investigated, which benefits the characterization of the behavior of elastic waves in composite materials. The imperfect interface is modelled by the spring model. To solve the corresponding single scattering problem, a collocation point (CP method is introduced. Based on this method, influence of various aspects of the imperfect interface on the scattering of P- and SV-waves is studied. Results indicate that (i the total scattering cross section (SCS is almost symmetric about the axis α=π/2 with respect to the location (α of the imperfect interface, (ii imperfect interfaces located at α=0 and α=π highly reduce the total SCS under a P-wave incidence and imperfect interfaces located at α=π/2 reduce the total SCS most significantly under SV-incidence, and (iii under a P-wave incidence the SCS has a high sensitivity to the bonding level of imperfect interfaces when α is small, while it becomes more sensitive to the bonding level when α is larger under SV-wave incidence.

  20. Model-Atmosphere Spectra of Central Stars of Planetary Nebulae - Access via the Virtual Observatory Service TheoSSA

    Science.gov (United States)

    Rauch, T.; Reindl, N.

    2014-04-01

    In the framework of the Virtual Observatory (VO), the German Astrophysical Virtual Observatory GAVO project provides easy access to theoretical spectral energy distributions (SEDs) within the registered GAVO service TheoSSA (http://dc.g-vo.org/theossa). TheoSSA is based on the well established Tübingen NLTE Model-Atmosphere Package (TMAP) for hot, compact stars. This includes central stars of planetary nebulae. We show examples of TheoSSA in operation.

  1. Synthesis and crystal structures of a novel layered silicate SSA-1 and its microporous derivatives by topotactic transformation.

    Science.gov (United States)

    Takahashi, S; Kurita, Y; Ikeda, T; Miyamoto, M; Uemiya, S; Oumi, Y

    2016-10-18

    The synthesis of a novel layered silicate SSA-1 (SSA: silicate synthesized with a quaternary amine) was achieved in the SiO 2 -H 2 O-TEAOH (TEAOH: tetraethylammonium hydroxide - as an organic structural directing agent) system. The crystal structure of SSA-1 involved two silicate layers composed of bre [10T]-type CBU (Composite Building Unit) and TEAOH in interlayers. The topotactic transformation of SSA-1 by calcination was examined, resulting in a porous material (PML-1: porous material transformed from a layered silicate) with a 108 m 2 g -1 BET surface area and 0.035 cm 3 g -1 pore volume. PML-1 is a siliceous microporous material with silanols in the framework and possesses unique properties, such as hydrophilicity, in spite of all its silica composition. The most reasonable crystal structure of PML-1 was successfully determined on the basis of the crystal structure of SSA-1 by a combination of manual modelling, PXRD pattern simulation, DFT optimization and Rietveld analysis. Additionally, an interlayer expanded siliceous zeolite SSA-1 (IEZ-SSA-1) was also successfully prepared by silylation using trichloro(methyl)silane under acidic conditions. IEZ-SSA-1 showed hydrophilicity or hydrophobicity properties by changing the functional group of the pillar part in the interlayer. Additionally, IEZ-SSA-1 showed a large gas adsorption property (537 m 2 g -1 and 0.21 cm 3 g -1 ).

  2. Global Cooling: Effect of Urban Albedo on Global Temperature

    Energy Technology Data Exchange (ETDEWEB)

    Akbari, Hashem; Menon, Surabi; Rosenfeld, Arthur

    2007-05-22

    In many urban areas, pavements and roofs constitute over 60% of urban surfaces (roof 20-25%, pavements about 40%). The roof and the pavement albedo can be increased by about 0.25 and 0.10, respectively, resulting in a net albedo increase for urban areas of about 0.1. Many studies have demonstrated building cooling-energy savings in excess of 20% upon raising roof reflectivity from an existing 10-20% to about 60%. We estimate U.S. potential savings in excess of $1 billion (B) per year in net annual energy bills. Increasing albedo of urban surfaces can reduce the summertime urban temperature and improve the urban air quality. Increasing the urban albedo has the added benefit of reflecting more of the incoming global solar radiation and countering the effect of global warming. We estimate that increasing albedo of urban areas by 0.1 results in an increase of 3 x 10{sup -4} in Earth albedo. Using a simple global model, the change in air temperature in lowest 1.8 km of the atmosphere is estimated at 0.01K. Modelers predict a warming of about 3K in the next 60 years (0.05K/year). Change of 0.1 in urban albedo will result in 0.01K global cooling, a delay of {approx}0.2 years in global warming. This 0.2 years delay in global warming is equivalent to 10 Gt reduction in CO2 emissions.

  3. MELiSSA celebrates 25 years of research into life support

    International Nuclear Information System (INIS)

    2015-01-01

    MELiSSA (Micro-Ecological Life Support System Alternative) is a collaborative project with the European Space Agency ESA and various other scientific partners. The objective of MELiSSA is to develop a system that is able to provide manned space missions with food, drinking water and oxygen autonomously in space. Drinkable water and oxygen are currently being made in the international space station ISS by filtering waste water and by electrolysing water. However, such physiochemical technologies do not offer a solution for food. The MELiSSA project intends to reuse waste products, which include CO2, water, stools and urine from the astronauts, and even the perspiration moisture in the cabin and to transfer these into food through the use of micro-organisms.

  4. A Continental United States High Resolution NLCD Land Cover – MODIS Albedo Database to Examine Albedo and Land Cover Change Relationships

    Science.gov (United States)

    Surface albedo influences climate by affecting the amount of solar radiation that is reflected at the Earth’s surface, and surface albedo is, in turn, affected by land cover. General Circulation Models typically use modeled or prescribed albedo to assess the influence of land co...

  5. Do the Asian Drivers undermine the export-oriented industrialisation in SSA?

    OpenAIRE

    Kaplinsky, Raphael; Morris, Mike

    2008-01-01

    An increase in outward orientation in general, and in export-oriented manufacturing in particular is widely indicated as a suitable developmental path for SSA. The logic for this is drawn both from the demonstration effect of China and the earlier generation of Asian NICs, and from theory. However, the entry of China (and to a lesser extent India) into the global economy as a significant exporter of manufactures poses severe problems for export-oriented growth in SSA. This can be seen from SS...

  6. Spectral Analysis within the Virtual Observatory: The GAVO Service TheoSSA

    Science.gov (United States)

    Ringat, E.

    2012-03-01

    In the last decade, numerous Virtual Observatory organizations were established. One of these is the German Astrophysical Virtual Observatory (GAVO) that e.g. provides access to spectral energy distributions via the service TheoSSA. In a pilot phase, these are based on the Tübingen NLTE Model-Atmosphere Package (TMAP) and suitable for hot, compact stars. We demonstrate the power of TheoSSA in an application to the sdOB primary of AA Doradus by comparison with a “classical” spectral analysis.

  7. Relating black carbon content to reduction of snow albedo

    Science.gov (United States)

    Brandt, R. E.; Warren, S. G.; Clarke, A. D.

    2011-12-01

    In remote snow of the Northern Hemisphere, the levels of soot pollution are in the parts-per-billion (ppb) range, where the effect on albedo is at the level of a few percent. A reduction of albedo by 1-2% is significant for climate but is difficult to detect experimentally, because snow albedo depends on several other variables. In our work to quantify the climatic effect of black carbon (BC) in snow, we therefore do not directly measure the albedo reduction. Instead, we use a two-step procedure: (1) We collect snow samples, melt and filter them, and analyze the filters spectrophotometrically for BC concentration. (2) We use the BC amount from the filter measurement, together with snow grain size, in a radiative transfer model to compute the albedo reduction. Our radiative transfer model uses the discrete ordinates algorithm DISORT 2.0. We have chosen a representative BC size distribution and optical constants, and have incorporated those of mineral dust as well. While a given mass of BC causes over an order of magnitude more snow albedo reduction compared to dust, a snowpack containing dust mutes the albedo-reducing effect of BC. Because the computed reduction of snow albedo is model-based, it requires experimental verification. We doubt that direct measurement of albedo-reduction will be feasible in nature, because of the vertical variation of both snow grain size and soot content, and because the natural soot content is small. We conclude that what is needed is an artificial snowpack, with uniform grain size and large uniform soot content (ppm not ppb), to produce a large signal on albedo. We have chosen to pursue this experiment outdoors rather than in the laboratory, for the following reasons: (1) The snowpack in the field of view is uniformly illuminated if the source of radiation is the Sun. (2) Visible radiation penetrates into the snow, so photons emerge horizontally distant from where they entered. In the limited width of a laboratory snowpack, radiation

  8. Higher albedos and size distribution of large transneptunian objects

    Science.gov (United States)

    Lykawka, Patryk Sofia; Mukai, Tadashi

    2005-11-01

    Transneptunian objects (TNOs) orbit beyond Neptune and do offer important clues about the formation of our solar system. Although observations have been increasing the number of discovered TNOs and improving their orbital elements, very little is known about elementary physical properties such as sizes, albedos and compositions. Due to TNOs large distances (>40 AU) and observational limitations, reliable physical information can be obtained only from brighter objects (supposedly larger bodies). According to size and albedo measurements available, it is evident the traditionally assumed albedo p=0.04 cannot hold for all TNOs, especially those with approximately absolute magnitudes H⩽5.5. That is, the largest TNOs possess higher albedos (generally >0.04) that strongly appear to increase as a function of size. Using a compilation of published data, we derived empirical relations which can provide estimations of diameters and albedos as a function of absolute magnitude. Calculations result in more accurate size/albedo estimations for TNOs with H⩽5.5 than just assuming p=0.04. Nevertheless, considering low statistics, the value p=0.04 sounds still convenient for H>5.5 non-binary TNOs as a group. We also discuss about physical processes (e.g., collisions, intrinsic activity and the presence of tenuous atmospheres) responsible for the increase of albedo among large bodies. Currently, all big TNOs (>700 km) would be capable to sustain thin atmospheres or icy frosts composed of CH 4, CO or N 2 even for body bulk densities as low as 0.5 g cm -3. A size-dependent albedo has important consequences for the TNOs size distribution, cumulative luminosity function and total mass estimations. According to our analysis, the latter can be reduced up to 50% if higher albedos are common among large bodies. Lastly, by analyzing orbital properties of classical TNOs ( 42AUbodies. For both populations, distinct absolute magnitude distributions are maximized for an inclination threshold

  9. Size and Albedo of Irregular Saturnian Satellites from Spitzer Observations

    Science.gov (United States)

    Mueller, Michael; Grav, T.; Trilling, D.; Stansberry, J.; Sykes, M.

    2008-09-01

    Using MIPS onboard the Spitzer Space Telescope, we observed the thermal emission (24 and, for some targets, 70 um) of eight irregular satellites of Saturn: Albiorix, Siarnaq, Paaliaq, Kiviuq, Ijiraq, Tarvos, Erriapus, and Ymir. We determined the size and albedo of all targets. An analysis of archived MIPS observations of Phoebe reproduces Cassini results very accurately, thereby validating our method. For all targets, the geometric albedo is found to be low, probably below 10% and clearly below 15%. Irregular satellites are much darker than the large regular satellites. Their albedo is, however, quite similar to that of small bodies in the outer Solar System (such as cometary nuclei, Jupiter Trojans, or TNOs). This is consistent with color measurements as well as dynamical considerations which suggest a common origin of the said populations. There appear to be significant object-to-object albedo differences. Similar albedos found for some members of dynamical clusters support the idea that they may have originated in the breakup of a parent body. For three satellites, thermal data at two wavelengths are available, enabling us to constrain their thermal properties. Sub-solar temperatures are similar to that found from Cassini's Phoebe fly-by. This suggests a rather low thermal inertia, as expected for regolith-covered objects. This work is based on observations made with the Spitzer Space Telescope, which is operated by JPL under a contract with NASA. Support for this work was provided by NASA.

  10. Clear-sky narrowband albedos derived from VIRS and MODIS

    Science.gov (United States)

    Sun-Mack, Sunny; Minnis, Patrick; Chen, Yan; Arduini, Robert F.

    2004-02-01

    The Clouds and Earth"s Radiant Energy System (CERES) project is using multispectral imagers, the Visible Infrared Scanner (VIRS) on the tropical Rainfall Measuring Mission (TRMM) satellite and the Moderate Resolution Imaging Spectroradiometer (MODIS) on Terra, operating since spring 2000, and Aqua, operating since summer 2002, to provide cloud and clear-sky properties at various wavelengths. This paper presents the preliminary results of an analysis of the CERES clear-sky reflectances to derive a set top-of-atmosphere clear sky albedo for 0.65, 0.86, 1.6, 2.13 μm, for all major surface types using the combined MODIS and VIRS datasets. The variability of snow albedo with surface type is examined using MODIS data. Snow albedo was found to depend on the vertical structure of the vegetation. At visible wavelengths, it is least for forested areas and greatest for smooth desert and tundra surfaces. At 1.6 and 2.1-μm, the snow albedos are relatively insensitive to the underlying surface because snow decreases the reflectance. Additional analyses using all of the MODIS results will provide albedo models that should be valuable for many remote sensing, simulation and radiation budget studies.

  11. Tundra vegetation effects on pan-Arctic albedo

    International Nuclear Information System (INIS)

    Loranty, Michael M; Goetz, Scott J; Beck, Pieter S A

    2011-01-01

    Recent field experiments in tundra ecosystems describe how increased shrub cover reduces winter albedo, and how subsequent changes in surface net radiation lead to altered rates of snowmelt. These findings imply that tundra vegetation change will alter regional energy budgets, but to date the effects have not been documented at regional or greater scales. Using satellite observations and a pan-Arctic vegetation map, we examined the effects of shrub vegetation on albedo across the terrestrial Arctic. We included vegetation classes dominated by low shrubs, dwarf shrubs, tussock-dominated graminoid tundra, and non-tussock graminoid tundra. Each class was further stratified by bioclimate subzones. Low-shrub tundra had higher normalized difference vegetation index values and earlier albedo decline in spring than dwarf-shrub tundra, but for tussock tundra, spring albedo declined earlier than for low-shrub tundra. Our results illustrate how relatively small changes in vegetation properties result in differences in albedo dynamics, regardless of shrub growth, that may lead to differences in net radiation upwards of 50 W m -2 at weekly time scales. Further, our findings imply that changes to the terrestrial Arctic energy budget during this important seasonal transition are under way regardless of whether recent satellite observed productivity trends are the result of shrub expansion. We conclude that a better understanding of changes in vegetation productivity and distribution in Arctic tundra is essential for accurately quantifying and predicting carbon and energy fluxes and associated climate feedbacks.

  12. Matrix albedo for discrete ordinates infinite-medium boundary condition

    International Nuclear Information System (INIS)

    Mathews, K.; Dishaw, J.

    2007-01-01

    Discrete ordinates problems with an infinite exterior medium (reflector) can be more efficiently computed by eliminating grid cells in the exterior medium and applying a matrix albedo boundary condition. The albedo matrix is a discretized bidirectional reflection distribution function (BRDF) that accounts for the angular quadrature set, spatial quadrature method, and spatial grid that would have been used to model a portion of the exterior medium. The method is exact in slab geometry, and could be used as an approximation in multiple dimensions or curvilinear coordinates. We present an adequate method for computing albedo matrices and demonstrate their use in verifying a discrete ordinates code in slab geometry by comparison with Ganapol's infinite medium semi-analytic TIEL benchmark. With sufficient resolution in the spatial and angular grids and iteration tolerance to yield solutions converged to 6 digits, the conventional (scalar) albedo boundary condition yielded 2-digit accuracy at the boundary, but the matrix albedo solution reproduced the benchmark scalar flux at the boundary to all 6 digits. (authors)

  13. MORSE/STORM: A generalized albedo option for Monte Carlo calculations

    International Nuclear Information System (INIS)

    Gomes, I.C.; Stevens, P.N.

    1991-09-01

    The advisability of using the albedo procedure for the Monte Carlo solution of deep penetration shielding problems that have ducts and other penetrations has been investigated. The use of albedo data can dramatically improve the computational efficiency of certain Monte Carlo calculations. However, the accuracy of these results may be unacceptable because of lost information during the albedo event and serious errors in the available differential albedo data. This study was done to evaluate and appropriately modify the MORSE/BREESE package, to develop new methods for generating the required albedo data, and to extend the adjoint capability to the albedo-modified calculations. Major modifications to MORSE/BREESE include an option to save for further use information that would be lost at the albedo event, an option to displace the point of emergence during an albedo event, and an option to use spatially dependent albedo data for both forward and adjoint calculations, which includes the point of emergence as a new random variable to be selected during an albedo event. The theoretical basis for using TORT-generated forward albedo information to produce adjuncton albedos was derived. The MORSE/STORM package was developed to perform both forward and adjoint modes of analysis using spatially dependent albedo data. Results obtained with MORSE/STORM for both forward and adjoint modes were compared with benchmark solutions. Excellent agreement and improved computational efficiency were achieved, demonstrating the full utilization of the albedo option in the MORSE code. 7 refs., 17 figs., 15 tabs

  14. Brazilian two-component TLD albedo neutron individual monitoring system

    Energy Technology Data Exchange (ETDEWEB)

    Martins, M.M., E-mail: marcelo@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD), Av. Salvador Allende, s/n, CEP: 22780-160, Rio de Janeiro, RJ (Brazil); Mauricio, C.L.P., E-mail: claudia@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD), Av. Salvador Allende, s/n, CEP: 22780-160, Rio de Janeiro, RJ (Brazil); Fonseca, E.S. da, E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD), Av. Salvador Allende, s/n, CEP: 22780-160, Rio de Janeiro, RJ (Brazil); Silva, A.X. da, E-mail: ademir@con.ufrj.b [Coordenacao dos Programas de Pos-Graduacao em Engenharia, COPPE/PEN Caixa Postal 68509, CEP: 21941-972, Rio de Janeiro, RJ (Brazil)

    2010-12-15

    Since 1983, Instituto de Radioprotecao e Dosimetria, Brazil, uses a TLD one-component albedo neutron monitor, which has a single different calibration factor specifically for each installation type. In order to improve its energy response, a two-component albedo monitor was developed, which measure the thermal neutron component besides the albedo one. The two-component monitor has been calibrated in reference neutron fields: thermal, five accelerator-produced monoenergetic beams (70, 144, 565, 1200 and 5000 keV) and five radionuclide sources ({sup 252}Cf, {sup 252}Cf(D{sub 2}O), {sup 241}Am-Be, {sup 241}Am-B and {sup 238}Pu-Be) at several distances. Since January 2008, mainly Brazilian workers who handle neutron sources at different distances and moderation, such as in well logging and calibration facilities are using it routinely.

  15. A Multisensor Approach to Global Retrievals of Land Surface Albedo

    Directory of Open Access Journals (Sweden)

    Aku Riihelä

    2018-05-01

    Full Text Available Satellite-based retrievals offer the most cost-effective way to comprehensively map the surface albedo of the Earth, a key variable for understanding the dynamics of radiative energy interactions in the atmosphere-surface system. Surface albedo retrievals have commonly been designed separately for each different spaceborne optical imager. Here, we introduce a novel type of processing framework that combines the data from two polar-orbiting optical imager families, the Advanced Very High-Resolution Radiometer (AVHRR and Moderate Resolution Imaging Spectroradiometer (MODIS. The goal of the paper is to demonstrate that multisensor albedo retrievals can provide a significant reduction in the sampling time required for a robust and comprehensive surface albedo retrieval, without a major degradation in retrieval accuracy, as compared to state-of-the-art single-sensor retrievals. We evaluated the multisensor retrievals against reference in situ albedo measurements and compare them with existing datasets. The results show that global land surface albedo retrievals with a sampling period of 10 days can offer near-complete spatial coverage, with a retrieval bias mostly comparable to existing single sensor datasets, except for bright surfaces (deserts and snow where the retrieval framework shows degraded performance because of atmospheric correction design compromises. A level difference is found between the single sensor datasets and the demonstrator developed here, pointing towards a need for further work in the atmospheric correction, particularly over bright surfaces, and inter-sensor radiance homogenization. The introduced framework is expandable to include other sensors in the future.

  16. Diurnal variations in the UV albedo of arctic snow

    Directory of Open Access Journals (Sweden)

    O. Meinander

    2008-11-01

    Full Text Available The relevance of snow for climate studies is based on its physical properties, such as high surface reflectivity. Surface ultraviolet (UV albedo is an essential parameter for various applications based on radiative transfer modeling. Here, new continuous measurements of the local UV albedo of natural Arctic snow were made at Sodankylä (67°22'N, 26°39'E, 179 m a.s.l. during the spring of 2007. The data were logged at 1-min intervals. The accumulation of snow was up to 68 cm. The surface layer thickness varied from 0.5 to 35 cm with the snow grain size between 0.2 and 2.5 mm. The midday erythemally weighted UV albedo ranged from 0.6 to 0.8 in the accumulation period, and from 0.5 to 0.7 during melting. During the snow melt period, under cases of an almost clear sky and variable cloudiness, an unexpected diurnal decrease of 0.05 in albedo soon after midday, and recovery thereafter, was detected. This diurnal decrease in albedo was found to be asymmetric with respect to solar midday, thus indicating a change in the properties of the snow. Independent UV albedo results with two different types of instruments confirm these findings. The measured temperature of the snow surface was below 0°C on the following mornings. Hence, the reversible diurnal change, evident for ~1–2 h, could be explained by the daily metamorphosis of the surface of the snowpack, in which the temperature of the surface increases, melting some of the snow to liquid water, after which the surface freezes again.

  17. 75 FR 62623 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-10-12

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0015] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match Number 1016 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  18. 77 FR 33547 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare and Medicaid...

    Science.gov (United States)

    2012-06-06

    ...: Social Security Administration (SSA). ACTION: Notice of a new computer matching program that will expire... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0015] Privacy Act of 1974, as Amended...

  19. 77 FR 24757 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2012-04-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0083] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1015 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...

  20. 77 FR 27108 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support...

    Science.gov (United States)

    2012-05-08

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0010] Privacy Act of 1974, as Amended...

  1. 20 CFR 411.597 - Will SSA periodically review the outcome payment system and the outcome-milestone payment system...

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Will SSA periodically review the outcome payment system and the outcome-milestone payment system for possible modifications? 411.597 Section 411... Employment Network Payment Systems § 411.597 Will SSA periodically review the outcome payment system and the...

  2. Lupus systémique et atteinte rénale: Apport des anticorps anti-SSA ...

    African Journals Online (AJOL)

    -SSA dans 12 cas (40%).Cinq patients (62.5%) ayant une atteinte rénale avaient des anticorps anti DNA négatifs. Parmi ces patients avec atteinte rénale, 37.5% avaient des anticorps anti SSA sans anticorps anti DNA. La moitié des patients ...

  3. The relationship of the lipoprotein SsaB, manganese and superoxide dismutase in Streptococcus sanguinis virulence for endocarditis.

    Science.gov (United States)

    Crump, Katie E; Bainbridge, Brian; Brusko, Sarah; Turner, Lauren S; Ge, Xiuchun; Stone, Victoria; Xu, Ping; Kitten, Todd

    2014-06-01

    Streptococcus sanguinis colonizes teeth and is an important cause of infective endocarditis. Our prior work showed that the lipoprotein SsaB is critical for S. sanguinis virulence for endocarditis and belongs to the LraI family of conserved metal transporters. In this study, we demonstrated that an ssaB mutant accumulates less manganese and iron than its parent. A mutant lacking the manganese-dependent superoxide dismutase, SodA, was significantly less virulent than wild-type in a rabbit model of endocarditis, but significantly more virulent than the ssaB mutant. Neither the ssaB nor the sodA mutation affected sensitivity to phagocytic killing or efficiency of heart valve colonization. Animal virulence results for all strains could be reproduced by growing bacteria in serum under physiological levels of O(2). SodA activity was reduced, but not eliminated in the ssaB mutant in serum and in rabbits. Growth of the ssaB mutant in serum was restored upon addition of Mn(2+) or removal of O(2). Antioxidant supplementation experiments suggested that superoxide and hydroxyl radicals were together responsible for the ssaB mutant's growth defect. We conclude that manganese accumulation mediated by the SsaB transport system imparts virulence by enabling cell growth in oxygen through SodA-dependent and independent mechanisms. © 2014 John Wiley & Sons Ltd.

  4. 76 FR 55690 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration To Improve the Disability...

    Science.gov (United States)

    2011-09-08

    ...; Comment Request; The SSA-NIH Collaboration To Improve the Disability Determination Process: Validation of... Collection: Title: The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information Collection Request: NEW. Need and Use of Information Collection...

  5. 76 FR 77238 - Submission for OMB Review; Comment Request; The SSA-NIH Collaboration to Improve the Disability...

    Science.gov (United States)

    2011-12-12

    ... Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information...; Comment Request; The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of... being developed to assist in the SSA disability determination process. The utilization of CAT technology...

  6. 76 FR 12398 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0034] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1304 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  7. 75 FR 9012 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/U.S. Department of Health and...

    Science.gov (United States)

    2010-02-26

    ... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503), amended... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ U.S. Department of Health and Human Services (HHS), Administration for...

  8. 77 FR 32709 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Homeland Security...

    Science.gov (United States)

    2012-06-01

    ...; Computer Matching Program (SSA/ Department of Homeland Security (DHS))--Match Number 1010 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... amended by the Computer Matching and Privacy Protection Act of 1988, as amended, and the regulations and...

  9. 78 FR 12128 - Privacy Act of 1974; Computer Matching Program (SSA/Department of the Treasury, Internal Revenue...

    Science.gov (United States)

    2013-02-21

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0067] Privacy Act of 1974; Computer Matching... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  10. 78 FR 12127 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-02-21

    ... 1310 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0007] Privacy Act of 1974, as Amended...

  11. 75 FR 51154 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2010-08-18

    ... 1310 AGENCY: Social Security Administration (SSA) ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0035] Privacy Act of 1974, as Amended...

  12. 77 FR 6620 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/the States); Match 6000 and 6003

    Science.gov (United States)

    2012-02-08

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0102] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ the States); Match 6000 and 6003 AGENCY: Social Security Administration..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  13. 77 FR 49849 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Child Support...

    Science.gov (United States)

    2012-08-17

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer-matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0021] Privacy Act of 1974, as Amended...

  14. 78 FR 51264 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of the Treasury...

    Science.gov (United States)

    2013-08-20

    ... 1016 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0022] Privacy Act of 1974, as Amended...

  15. 75 FR 68396 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2010-11-05

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...

  16. 78 FR 69926 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid...

    Science.gov (United States)

    2013-11-21

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L 100-503), amended the... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0059] Privacy Act of 1974, as Amended...

  17. 75 FR 18251 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Internal Revenue Service (IRS...

    Science.gov (United States)

    2010-04-09

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0066] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match 1305 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  18. 75 FR 7648 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Veterans Affairs...

    Science.gov (United States)

    2010-02-22

    ... Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503), amended the Privacy... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0006] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Veterans Affairs/Veterans Benefits Administration (VA/ VBA...

  19. 78 FR 16564 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2013-03-15

    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0073] Privacy Act of 1974, as Amended...

  20. 75 FR 32833 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2010-06-09

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0077] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Office of Personnel Management (OPM))--Match 1307 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...

  1. 75 FR 59780 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Railroad Retirement Board (RRB...

    Science.gov (United States)

    2010-09-28

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0040] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Railroad Retirement Board (RRB))--Match Number 1006 AGENCY: Social Security...: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L.) 100-503), amended the...

  2. 77 FR 24756 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Department of Labor (DOL))-Match...

    Science.gov (United States)

    2012-04-25

    ... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0084] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988...

  3. 20 CFR 403.100 - When can an SSA employee testify or produce information or records in legal proceedings?

    Science.gov (United States)

    2010-04-01

    ... information or records in legal proceedings? 403.100 Section 403.100 Employees' Benefits SOCIAL SECURITY ADMINISTRATION TESTIMONY BY EMPLOYEES AND THE PRODUCTION OF RECORDS AND INFORMATION IN LEGAL PROCEEDINGS § 403.100 When can an SSA employee testify or produce information or records in legal proceedings? An SSA...

  4. 77 FR 74913 - Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA...

    Science.gov (United States)

    2012-12-18

    ...; Computer Matching Program (Social Security Administration (SSA)/Office of Personnel Management (OPM.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  5. Improved streaming analysis technique: spherical harmonics expansion of albedo data

    International Nuclear Information System (INIS)

    Albert, T.E.; Simmons, G.L.

    1979-01-01

    An improved albedo scattering technique was implemented with a three-dimensional Monte Carlo transport code for use in analyzing radiation streaming problems. The improvement was based on a shifted spherical Harmonics expansion of the doubly differential albedo data base. The result of the improvement was a factor of 3 to 10 reduction in data storage requirements and approximately a factor of 3 to 6 increase in computational speed. Comparisons of results obtained using the technique with measurements are shown for neutron streaming in one- and two-legged square concrete ducts

  6. The high albedo of the hot Jupiter Kepler-7b

    DEFF Research Database (Denmark)

    Demory, B.-O.; Seager, S.; Madhusudhan, N.

    2011-01-01

    Hot Jupiters are expected to be dark from both observations (albedo upper limits) and theory (alkali metals and/or TiO and VO absorption). However, only a handful of hot Jupiters have been observed with high enough photometric precision at visible wavelengths to investigate these expectations....... The NASA Kepler mission provides a means to widen the sample and to assess the extent to which hot Jupiter albedos are low. We present a global analysis of Kepler-7 b based on Q0-Q4 data, published radial velocities, and asteroseismology constraints. We measure an occultation depth in the Kepler bandpass...

  7. Validation of response simulation methodology of Albedo dosemeter

    International Nuclear Information System (INIS)

    Freitas, B.M.; Silva, A.X. da

    2016-01-01

    The Instituto de Radioprotecao e Dosimetria developed and runs a neutron TLD albedo individual monitoring service. To optimize the dose calculation algorithm and to infer new calibration factors, the response of this dosemeter was simulated. In order to validate this employed methodology, it was applied in the simulation of the problem of the QUADOS (Quality Assurance of Computational Tools for Dosimetry) intercomparison, aimed to evaluate dosimetric problems, one being to calculate the response of a generic albedo dosemeter. The obtained results were compared with those of other modeling and the reference one, with good agreements. (author)

  8. NEOWISE REACTIVATION MISSION YEAR ONE: PRELIMINARY ASTEROID DIAMETERS AND ALBEDOS

    Energy Technology Data Exchange (ETDEWEB)

    Nugent, C. R.; Cutri, R. M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Mainzer, A.; Masiero, J.; Bauer, J.; Kramer, E.; Sonnett, S.; Stevenson, R. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Grav, T. [Planetary Science Institute, Tucson, AZ (United States); Wright, E. L., E-mail: cnugent@ipac.caltech.edu [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States)

    2015-12-01

    We present preliminary diameters and albedos for 7956 asteroids detected in the first year of the NEOWISE Reactivation mission. Of those, 201 are near-Earth asteroids and 7755 are Main Belt or Mars-crossing asteroids. 17% of these objects have not been previously characterized using the Near-Earth Object Wide-field Infrared Survey Explorer, or “NEOWISE” thermal measurements. Diameters are determined to an accuracy of ∼20% or better. If good-quality H magnitudes are available, albedos can be determined to within ∼40% or better.

  9. Ceres Photometry and Albedo from Dawn Framing Camera Images

    Science.gov (United States)

    Schröder, S. E.; Mottola, S.; Keller, H. U.; Li, J.-Y.; Matz, K.-D.; Otto, K.; Roatsch, T.; Stephan, K.; Raymond, C. A.; Russell, C. T.

    2015-10-01

    The Dawn spacecraft is in orbit around dwarf planet Ceres. The onboard Framing Camera (FC) [1] is mapping the surface through a clear filter and 7 narrow-band filters at various observational geometries. Generally, Ceres' appearance in these images is affected by shadows and shading, effects which become stronger for larger solar phase angles, obscuring the intrinsic reflective properties of the surface. By means of photometric modeling we attempt to remove these effects and reconstruct the surface albedo over the full visible wavelength range. Knowledge of the albedo distribution will contribute to our understanding of the physical nature and composition of the surface.

  10. Validation of response simulation methodology of Albedo dosemeter; Validacao da metodologia de simulacao de resposta de dosimetro de Albedo

    Energy Technology Data Exchange (ETDEWEB)

    Freitas, B.M.; Silva, A.X. da, E-mail: bfreitas@nuclear.ufrj.br [Coordenacao do Programas de Pos-Graduacao em Engenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Mauricio, C.L.P. [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2016-07-01

    The Instituto de Radioprotecao e Dosimetria developed and runs a neutron TLD albedo individual monitoring service. To optimize the dose calculation algorithm and to infer new calibration factors, the response of this dosemeter was simulated. In order to validate this employed methodology, it was applied in the simulation of the problem of the QUADOS (Quality Assurance of Computational Tools for Dosimetry) intercomparison, aimed to evaluate dosimetric problems, one being to calculate the response of a generic albedo dosemeter. The obtained results were compared with those of other modeling and the reference one, with good agreements. (author)

  11. The retrieval of land surface albedo in rugged terrain

    NARCIS (Netherlands)

    Gao, B.; Jia, L.; Menenti, M.

    2012-01-01

    Land surface albedo may be derived from the satellite data through the estimation of a bidirectional reflectance distribution function (BRDF) model and angular integration. However many BRDF models do not consider explicitly the topography. In rugged terrain, the topography influences the observed

  12. Size and Albedo of Irregular Saturnian Satellites from Spitzer Observations

    NARCIS (Netherlands)

    Mueller, Michael; Grav, T.; Trilling, D.; Stansberry, J.; Sykes, M.

    2008-01-01

    Using MIPS onboard the Spitzer Space Telescope, we observed the thermal emission (24 and, for some targets, 70 um) of eight irregular satellites of Saturn: Albiorix, Siarnaq, Paaliaq, Kiviuq, Ijiraq, Tarvos, Erriapus, and Ymir. We determined the size and albedo of all targets. An analysis of

  13. Forests, nitrogen and albedo, a very interesting trio indeed

    Directory of Open Access Journals (Sweden)

    Borghetti M

    2009-01-01

    Full Text Available A short comment is made on a recent paper (Ollinger et al. 2008 which shows that forest ecosystem carbon uptake in temperate and boreal forests is directly related to canopy nitrogen concentration and that both carbon uptake capacity and canopy nitrogen concentration are positively correlated with shortwave surface albedo measured with broad-band satellite sensors.

  14. Field measurement of albedo for limited extent test surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Sailor, David J. [Portland State University, Department of Mechanical and Materials Engineering, P.O. Box 751-ME, Portland, OR 97207 (United States); Resh, Kyle; Segura, Del [Tulane University, Department of Mechanical Engineering, 400 Lindy Boggs Center, New Orleans, LA 70118 (United States)

    2006-05-15

    A new method is introduced for field measurement of surface albedo. This method consists of the use of a cylindrical shade ring made of opaque fabric with a known (low) albedo placed over a test surface. The albedo measurement is accomplished using two small pyranometers situated so that the downward-facing pyranometer receives radiation only from the test surface and the shade ring. The upward-facing pyranometer simultaneously records the incoming solar radiation. The radiation received by the downward-facing pyramometer is a combination of reflected radiation from shaded and unshaded portions of these two surfaces, requiring detailed accounting of the resulting view factor geometries. The method presented here improves upon past approaches by allowing for smaller sample sizes, minimizing errors associated with reflective properties of the surroundings, and allowing for accurate measurements even under partially cloudy skies. In addition to these methodological improvements we introduce an approach for estimating the uncertainty in the resulting albedo measurements. Results from field measurements are presented to validate the measurement protocol, and to compare its accuracy with the accuracy of a published standard. (author)

  15. Surface albedo following biochar application in durum wheat

    International Nuclear Information System (INIS)

    Genesio, L; Miglietta, F; Lugato, E; Baronti, S; Pieri, M; Vaccari, F P

    2012-01-01

    The agronomic use of charcoal from biomass pyrolysis (biochar) represents an interesting option for increasing soil fertility and sequestering atmospheric CO 2 . However, before moving toward large-scale biochar applications, additional research must evaluate all possible land–atmosphere feedbacks. Despite the increasing number of studies investigating the effect of biochar on soil physical, chemical and biological properties, only a few have been done on surface albedo variations on agricultural lands. The present work had the aim of characterizing the annual albedo cycle for a durum wheat crop in Central Italy, by means of a spectroradiometer measurement campaign. Plots treated with biochar, at a rate of 30–60 t ha −1 , showed a surface albedo decrease of up to 80% (after the application) with respect to the control in bare soil conditions, while this difference tended to decrease during the crop growing season, because of the prevailing effect of canopy development on the radiometer response. After the post-harvesting tillage, the soil treated with biochar again showed a lower surface albedo value (<20–26% than the control), while the measurements taken in the second year after application suggested a clear decrease of biochar influence on soil color. The modeling of the surface energy balance highlighted changes in the partitioning of heat fluxes and in particular a substantial increase of ground heat fluxes on an annual basis. (letter)

  16. Mimicking biochar-albedo feedback in complex Mediterranean agricultural landscapes

    International Nuclear Information System (INIS)

    Bozzi, E; Genesio, L; Miglietta, F; Toscano, P; Pieri, M

    2015-01-01

    Incorporation of charcoal produced by biomass pyrolysis (biochar) in agricultural soils is a potentially sustainable strategy for climate change mitigation. However, some side effects of large-scale biochar application need to be investigated. In particular a massive use of a low-reflecting material on large cropland areas may impact the climate via changes in surface albedo. Twelve years of MODIS-derived albedo data were analysed for three pairs of selected agricultural sites in central Italy. In each pair bright and dark coloured soil were identified, mimicking the effect of biochar application on the land surface albedo of complex agricultural landscapes. Over this period vegetation canopies never completely masked differences in background soil colour. This soil signal, expressed as an albedo difference, induced a local instantaneous radiative forcing of up to 4.7 W m −2 during periods of high solar irradiance. Biochar mitigation potential might therefore be reduced up to ∼30%. This study proves the importance of accounting for crop phenology and crop management when assessing biochar mitigation potential and provides more insights into the analysis of its environmental feedback. (letter)

  17. The effect of surface albedo and grain size distribution on ...

    African Journals Online (AJOL)

    Sand dams are very useful in arid and semi arid lands (ASALs) as facilities for water storage and conservation. Soils in ASALs are mainly sandy and major water loss is by evaporation and infiltration. This study investigated the effect of sand media characteristics, specifically surface albedo, grain size and stratification on ...

  18. Clear-Sky Narrowband Albedo Datasets Derived from Modis Data

    Science.gov (United States)

    Chen, Y.; Minnis, P.; Sun-Mack, S.; Arduini, R. F.; Hong, G.

    2013-12-01

    Satellite remote sensing of clouds requires an accurate estimate of the clear-sky radiances for a given scene to detect clouds and aerosols and to retrieve their microphysical properties. Knowing the spatial and angular variability of clear-sky albedo is essential for predicting the clear-sky radiance at solar wavelengths. The Clouds and the Earth's Radiant Energy System (CERES) Project uses the near-infrared (NIR; 1.24, 1.6 or 2.13 μm) and visible (VIS; 0.63 μm) channels available on the Terra and Aqua Moderate Resolution Imaging Spectroradiometers (MODIS) to help identify clouds and retrieve their properties. Generally, clear-sky albedo for a given surface type is determined for conditions when the vegetation is either thriving or dormant and free of snow. The clear-sky albedos are derived using a radiative transfer parameterization of the impact of the atmosphere, including aerosols, on the observed reflectances. This paper presents the method of generating monthly clear-sky overhead albedo maps for both snow-free and snow-covered surfaces of these channels using one year of MODIS (Moderate Resolution Imaging Spectroradiometer) CERES products. Maps of 1.24 and 1.6 μm are being used as the background to help retrieve cloud properties (e.g., effective particle size, optical depth) in CERES cloud retrievals in both snow-free and snow-covered conditions.

  19. Multidecadal analysis of forest growth and albedo in boreal Finland

    Czech Academy of Sciences Publication Activity Database

    Lukeš, Petr; Stenberg, P.; Mottus, M.; Manninen, T.; Rautiainen, M.

    2016-01-01

    Roč. 52, OCT (2016), s. 296-305 ISSN 0303-2434 R&D Projects: GA MŠk(CZ) LM2010007; GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : Albedo * fAPAR * LAI * NDVI * Time series * Seasonal trends * Forest structure Subject RIV: EH - Ecology, Behaviour Impact factor: 3.930, year: 2016

  20. Albedo and color maps of the Saturnian satellites

    International Nuclear Information System (INIS)

    Buratti, B.J.; Mosher, J.A.; Johnson, T.V.

    1990-01-01

    The paper discusses the production of maps of the albedos and colors of Mimas, Enceladus, Tethys, Dione, and Rhea over the full range of their imaged surfaces. Voyager images were used to prepare maps of the normal reflectances and color ratios (0.58/0.41 micron) of these satelites. 67 refs

  1. Spacecraft Attitude Determination with Earth Albedo Corrected Sun Sensor Measurements

    DEFF Research Database (Denmark)

    Bhanderi, Dan

    -Method, Extended Kalman Filter, and Unscented Kalman Filter algorithms are presented and the results are compared. Combining the Unscented Kalman Filter with Earth albedo and enhanced Sun sensor modeling allows for three-axis attitude determination from Sun sensor only, which previously has been perceived...

  2. Using BRDFs for accurate albedo calculations and adjacency effect corrections

    Energy Technology Data Exchange (ETDEWEB)

    Borel, C.C.; Gerstl, S.A.W.

    1996-09-01

    In this paper the authors discuss two uses of BRDFs in remote sensing: (1) in determining the clear sky top of the atmosphere (TOA) albedo, (2) in quantifying the effect of the BRDF on the adjacency point-spread function and on atmospheric corrections. The TOA spectral albedo is an important parameter retrieved by the Multi-angle Imaging Spectro-Radiometer (MISR). Its accuracy depends mainly on how well one can model the surface BRDF for many different situations. The authors present results from an algorithm which matches several semi-empirical functions to the nine MISR measured BRFs that are then numerically integrated to yield the clear sky TOA spectral albedo in four spectral channels. They show that absolute accuracies in the albedo of better than 1% are possible for the visible and better than 2% in the near infrared channels. Using a simplified extensive radiosity model, the authors show that the shape of the adjacency point-spread function (PSF) depends on the underlying surface BRDFs. The adjacency point-spread function at a given offset (x,y) from the center pixel is given by the integral of transmission-weighted products of BRDF and scattering phase function along the line of sight.

  3. The influence of inter-annually varying albedo on regional climate and drought

    KAUST Repository

    Meng, Xianhong; Evans, Jason P.; McCabe, Matthew

    2013-01-01

    Albedo plays an important role in land-atmosphere interactions and local climate. This study presents the impact on simulating regional climate, and the evolution of a drought, when using the default climatological albedo as is usually done

  4. NLCD - MODIS land cover- albedo dataset for the continental United States

    Data.gov (United States)

    U.S. Environmental Protection Agency — The NLCD-MODIS land cover-albedo database integrates high-quality MODIS albedo observations with areas of homogeneous land cover from NLCD. The spatial resolution...

  5. Albedo of a hybrid poplar plantation in central Alberta, Canada

    Science.gov (United States)

    Price, D. T.; Bernier, P. Y.; Orchansky, A.; Thomas, B.

    2012-04-01

    Canada's boreal forest resources are coming under increasing pressure from competing land-uses, including establishment of protected areas, and losses of harvestable forest to mining and oil and gas exploration. In the prairie region, concerns about lack of wood supply for pulpmills and potential opportunities for bioenergy production and carbon sequestration for climate change mitigation, have spurred interest in afforestation of marginal agricultural land, notably with fast-growing hybrid poplars (HP). However, global modelling studies suggest that a shift from grassland or crops to forest cover in temperate and boreal regions could result in reduced surface albedo, particularly in winter, causing an increase in radiative forcing and reducing any climate mitigation benefits due to net GHG removal. We report on seven growing seasons of measurements of short-wave canopy albedo using tower-mounted instruments, along with eddy covariance measurements of carbon, water and energy balance, at a site in central Alberta planted with HP cuttings in spring 2005. The data show little systematic change in average albedo as vegetation has changed from bare ground to a plantation of 6 m trees. Reasons for this include very wide (3 m) spacing between the trees, and snow cover which often persists for 4-5 months and is highly visible below the bare canopies during winter. While measurements should continue as the trees grow larger, we postulate that extensive afforestation with HP is unlikely to have major effects on regional-scale surface albedo compared to the agricultural systems they replace. Normal rotation lengths are 15-20 years, hence even if older plantations have significantly lower winter albedo, their contribution to the regional average would be relatively small because they will cover only a small fraction of the landscape (e.g., compared to forests of boreal conifers or temperate broadleaved species).

  6. Continuous versus discontinuous albedo representations in a simple diffusive climate model

    Science.gov (United States)

    Simmons, P. A.; Griffel, D. H.

    1988-07-01

    A one-dimensional annually and zonally averaged energy-balance model, with diffusive meridional heat transport and including icealbedo feedback, is considered. This type of model is found to be very sensitive to the form of albedo used. The solutions for a discontinuous step-function albedo are compared to those for a more realistic smoothly varying albedo. The smooth albedo gives a closer fit to present conditions, but the discontinuous form gives a better representation of climates in earlier epochs.

  7. Understanding Large-scale Structure in the SSA22 Protocluster Region Using Cosmological Simulations

    Science.gov (United States)

    Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.; Naoz, Smadar; Primack, Joel R.

    2018-01-01

    We investigate the nature and evolution of large-scale structure within the SSA22 protocluster region at z = 3.09 using cosmological simulations. A redshift histogram constructed from current spectroscopic observations of the SSA22 protocluster reveals two separate peaks at z = 3.065 (blue) and z = 3.095 (red). Based on these data, we report updated overdensity and mass calculations for the SSA22 protocluster. We find {δ }b,{gal}=4.8+/- 1.8 and {δ }r,{gal}=9.5+/- 2.0 for the blue and red peaks, respectively, and {δ }t,{gal}=7.6+/- 1.4 for the entire region. These overdensities correspond to masses of {M}b=(0.76+/- 0.17)× {10}15{h}-1 {M}ȯ , {M}r=(2.15+/- 0.32)× {10}15{h}-1 {M}ȯ , and {M}t=(3.19+/- 0.40)× {10}15{h}-1 {M}ȯ for the red, blue, and total peaks, respectively. We use the Small MultiDark Planck (SMDPL) simulation to identify comparably massive z∼ 3 protoclusters, and uncover the underlying structure and ultimate fate of the SSA22 protocluster. For this analysis, we construct mock redshift histograms for each simulated z∼ 3 protocluster, quantitatively comparing them with the observed SSA22 data. We find that the observed double-peaked structure in the SSA22 redshift histogram corresponds not to a single coalescing cluster, but rather the proximity of a ∼ {10}15{h}-1 {M}ȯ protocluster and at least one > {10}14{h}-1 {M}ȯ cluster progenitor. Such associations in the SMDPL simulation are easily understood within the framework of hierarchical clustering of dark matter halos. We finally find that the opportunity to observe such a phenomenon is incredibly rare, with an occurrence rate of 7.4{h}3 {{{Gpc}}}-3. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.

  8. Remote Ultra-low Light Imaging (RULLI) For Space Situational Awareness (SSA): Modeling And Simulation Results For Passive And Active SSA

    International Nuclear Information System (INIS)

    Thompson, David C.; Shirey, Robert L.; Roggemann, Michael C; Gudimetla, Rao

    2008-01-01

    Remote Ultra-Low Light Imaging detectors are photon limited detectors developed at Los Alamos National Laboratories. RULLI detectors provide a very high degree of temporal resolution for the arrival times of detected photoevents, but saturate at a photo-detection rate of about 10 6 photo-events per second. Rather than recording a conventional image, such as output by a charged coupled device (CCD) camera, the RULLI detector outputs a data stream consisting of the two-dimensional location, and time of arrival of each detected photo-electron. Hence, there is no need to select a specific exposure time to accumulate photo-events prior to the data collection with a RULLI detector this quantity can be optimized in post processing. RULLI detectors have lower peak quantum efficiency (from as low as 5% to perhaps as much as 40% with modern photocathode technology) than back-illuminated CCD's (80% or higher). As a result of these factors, and the associated analyses of signal and noise, we have found that RULLI detectors can play two key new roles in SSA: passive imaging of exceedingly dim objects, and three-dimensional imaging of objects illuminated with an appropriate pulsed laser. In this paper we describe the RULLI detection model, compare it to a conventional CCD detection model, and present analytic and simulation results to show the limits of performance of RULLI detectors used for SSA applications at AMOS field site

  9. Vector Topographic Map Data over the BOREAS NSA and SSA in SIF Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set contains vector contours and other features of individual topographic map sheets from the National Topographic Series (NTS). The map sheet files were received in Standard Interchange Format (SIF) and cover the BOReal Ecosystem-Atmosphere Study (BOREAS) Northern Study Area (NSA) and Southern Study Area (SSA) at scales of 1:50,000 and 1:250,000. The individual files are stored in compressed Unix tar archives.

  10. Surviving space flight: case study on MELiSSA's CIII nitrifying compartment

    Science.gov (United States)

    Ilgrande, Chiara; Lasseur, Christophe; Mastroleo, Felice; Paille, Christel; Leys, Natalie; Morozova, Julia; Ilyin, Vyacheslav; Clauwaert, Peter; Christiaens, Marlies E. R.; Lindeboom, Ralph E. F.; Vlaeminck, Siegfried; Prat, Delphine; Arroyo, Jose M. C.; Conincx, Ilse; Van Hoey, Olivier; Roume, Hugo; Udert, Kai; Sas, Benedikt

    2016-07-01

    Space synthetic biology offers key opportunities for long-term space missions. Planets mining, terraformation, space medicine and Life Support technologies would all benefit from an integrative biological approach. However, space is a harsh environment for life: microgravity, temperature, UV and cosmic radiation can affect the health and functionality of microorganisms and plants, possibly preventing the optimal performance of the systems. The European Space Agency's Life Support System (MELiSSA) has been developed as a model for future long term Space missions and Space habitation. MELiSSA is a 5 compartment artificial ecosystem with microorganisms and higher, that aims at completely recycling gas, liquid and solid waste. In this study, the survival and functional activity after Lower Earth Orbit conditions of microbial nitrogen conversions, relevant for MELiSSA's CIII compartment, was tested. Synthetic communities containing Nitrosomonas europeae, Nitrosomonas ureae, Nitrobacter winogradskyi, Nitrospira moscoviensis and Cupriavidus pinatubonensis were exposed to the Lower Earth Orbit conditions of the International Space Station (ISS) for 7 days. Nitrosomonas europeae, Nitrobacter winogradskyi, Cupriavidus pinatubonensis, and three mixed communities (a urine nitrification sludge, a sludge containing aerobic ammonia oxidizing bacteria and anammox bacteria (OLAND), and an aquaculture sludge containing ammonia oxidizing archaea) were exposed to Lower Earth Orbit conditions for 44 days. Survival after both space flights was demonstrated because nitritation, nitratation, denitrification and anammox activity could be restored at a rate comparable to ground storage conditions. Our results validate the potential survival feasibility and suggest future space applications for N-related microorganisms.

  11. Sewage sludge ash (SSA in high performance concrete: characterization and application

    Directory of Open Access Journals (Sweden)

    C. M. A. Fontes

    Full Text Available ABSTRACT Sewage sludge originated from the process of treatment of wastewater has become an environmental issue for three main reasons: contains pathogens, heavy metals and organic compounds that are harmful to the environmental and human health; high volumes are daily generated; and shortage of landfill sites for proper disposal. This research deals with the viability study of sewage sludge utilization, after calcination process, as mineral admixture in the production of concrete. High-performance concretes were produced with replacement content of 5% and 10% by weight of Portland cement with sewage sludge ash (SSA. The influence of this ash was analyzed through physical and mechanical tests. Analysis showed that the mixtures containing SSA have lower values of compressive strength than the reference. The results of absorptivity, porosity and accelerated penetration of chloride ions, presents that mixtures containing ash showed reductions compared to the reference. This indicates that SSA provided refinement of the pore structure, which was confirmed by mercury intrusion porosimetry test.

  12. Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA

    Directory of Open Access Journals (Sweden)

    DANA, ED

    2010-01-01

    Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files

  13. Streaming experiment of gamma-ray obliquely incident on concrete shield wall with straight cylindrical ducts and verification of single scattering code

    International Nuclear Information System (INIS)

    Yamaji, Akio; Saito, Tetsuo.

    1988-01-01

    To investigate a proximity effect of ducts on shield performance against γ radiation, an experiment was performed at JRR-4 by entering the γ-ray beam into a concrete shield wall of 100 cm-thickness with 3 or 5 straight cylindrical ducts of radius of 4.45 cm placed in a straight line or crosswise at interval of 8.9 cm. The dose rates were measured using digital dosimeters on a horizontal line 20 cm apart from the rear of the wall with 0, 1, 3 and 5 ducts, and with the incident angles of 0deg, 7deg, 14deg and 20deg, respectively. The dose rate distributions depended on the number of ducts and the incident angle, and the dose rate ratios of with-three-ducts to no-duct distributed within 3.6∼12, 1.3∼5.0 and 1.1∼4.3, for the incident angles of 7deg, 14deg and 20deg, while those of with-single-duct to no-duct within 1.2∼7.1, 1.1∼2.7 and 1.0∼1.9, respectively. The experiment was analyzed using a multigroup single scattering code G33YSN able to deal with the geometry of the ducts exactly. For each incident angle, the calculation agreed with the experiment within a factor of 2. (author)

  14. Long-term record of top-of-atmosphere albedo generated from AVHRR data

    Science.gov (United States)

    Song, Z.

    2017-12-01

    Top-of-Atmosphere (TOA) albedo is a fundamental component of Earth's energy budget. Previously, long-term accurate TOA albedo products did not exist due to the lack of stable broadband observations. With a new albedo estimation methodology based on multispectral observations, TOA albedo since 1981 has been retrieved using data from the Advanced Very High Resolution Radiometer (AVHRR), which provides the longest record of satellite observations across the globe. To develop the long-term TOA albedo record, the instantaneous TOA albedo was calculated by the direct estimation method, which was built on training data pairs from coincident AVHRR TOA reflectance and Moderate Resolution Imaging Spectroradiometer (MODIS) TOA albedo. The instantaneous TOA albedo was then converted to daily mean and monthly mean albedo based on the diurnal curves from geostationary satellites. The TOA albedo results (AVHRR-TAL) were compared with Clouds and the Earth's Radiant Energy System (CERES) flux products for 2007. The monthly mean AVHRR-TAL agreed well with the CERES products, with a root mean square difference (RMSD) of 0.032 and a bias of 0.013. In addition, AVHRR-TAL showed similar seasonal variations to those seen in the CERES products. Further analysis on long-term time series showed good consistency between the two datasets (R2 > 0.95 and relative RMSD < 4%) from 2000 to 2015. Although some calibration issues remain to be solved, our datasets show the potential ability to observe the global TOA albedo from 1981 to the present.

  15. Measuring the influence of aerosols and albedo on sky polarization.

    Science.gov (United States)

    Kreuter, A; Emde, C; Blumthaler, M

    2010-11-01

    All-sky distributions of the polarized radiance are measured using an automated fish-eye camera system with a rotating polarizer. For a large range of aerosol and surface albedo situations, the influence on the degree of polarization and sky radiance is investigated. The range of aerosol optical depth and albedo is 0.05-0.5 and 0.1-0.75, respectively. For this range of parameters, a reduction of the degree of polarization from about 0.7 to 0.4 was observed. The analysis is done for 90° scattering angle in the principal plane under clear sky conditions for a broadband channel of 450 ± 25 nm and solar zenith angles between 55° and 60°. Radiative transfer calculations considering three different aerosol mixtures are performed and and agree with the measurements within the statistical error.

  16. Cosmic ray induced charged particle albedos in the upper atmosphere

    International Nuclear Information System (INIS)

    Bhatnagar, S.P.; Verma, S.D.

    1982-01-01

    There are several observations made in balloon and satellite experiments of relativistic albedo electrons in 50 to 10,000 MeV energy region. The spectrum of these electrons is a power law with negative exponent. At lower energies, 1 to 50 MeV region theoretical evaluations indicate that their energy spectrum will have a similar shape, thus the flux at low energies will be much higher. The only spectrum measurements available below 20 MeV were taken at Ft. Churchill by Hovestadt and Meyer (1969). The flux and energy spectrum of the Re-entrant albedos electrons have been calculated in the energy range 3-50 MeV for Ft. Churchill, Canada, Palestein, Texas and Hyderabad, India, and are presented. The angular distribution of re-entrant electrons in the upper atmosphere is not yet observed, however Kurnosova et. al. (1979) have measured the Vertical and Horizontal integral flux at Hyderabad, India

  17. Albedo decreasing trend. White cars proposal and new urban scenarios

    Directory of Open Access Journals (Sweden)

    Niccolò Casiddu

    2014-05-01

    Full Text Available Global warming caused the decrease of the albedo. Emission reduction is the most widely proposed response to this problem. However simple ideas such as cool roofs and cool pavements seem successful remedies to counter the threat. However in Italy another strategy appears more effective. By changing from dark to pastel bright automotive colours a considerable increase of the albedo can be hypothesized: the effect should be from 32% to 50% of the results obtained with an extensive application of the “cool roofs” strategy. Such a proposal involves the creation of new, unexpected cityscapes. The city is a place where the perception of space changes. The car, by definition is an object in motion, but still present, sometimes redundant in the urban landscape. What will be the perceived relationship with buildings, streets, squares where the cars are all white or pastel colour?

  18. Calculating the albedo characteristics by the method of transmission probabilities

    International Nuclear Information System (INIS)

    Lukhvich, A.A.; Rakhno, I.L.; Rubin, I.E.

    1983-01-01

    The possibility to use the method of transmission probabilities for calculating the albedo characteristics of homogeneous and heterogeneous zones is studied. The transmission probabilities method is a numerical method for solving the transport equation in the integrated form. All calculations have been conducted as a one-group approximation for the planes and rods with different optical thicknesses and capture-to-scattering ratios. Above calculations for plane and cylindrical geometries have shown the possibility to use the numerical method of transmission probabilities for calculating the albedo characteristics of homogeneous and heterogeneous zones with high accuracy. In this case the computer time consumptions are minimum even with the cylindrical geometry, if the interpolation calculation of characteristics is used for the neutrons of the first path

  19. SSA DISABILITY. SGA Levels Appear to Affect the Work Behavior of Relatively Few Beneficiaries, but More Data Needed

    National Research Council Canada - National Science Library

    Baucus, Max

    2002-01-01

    ... physical or mental impairment has earnings that exceed the Substantial Gainful Activity (SGA) level, which represents SSA's principal standard for determining whether a disabled individual is able to work...

  20. Colour, albedo and nucleus size of Halley's comet

    Science.gov (United States)

    Cruikshank, D. P.; Tholen, D. J.; Hartmann, W. K.

    1985-01-01

    Photometry of Halley's comet in the B, J, V, and K broadband filters during a time when the coma was very weak and presumed to contribute negligibly to the broadband photometry is reported. The V-J and J-K colors suggest that the color of the nucleus of Halley's comet is similar to that of the D-type asteroids, which in turn suggests that the surface of the nucleus has an albedo less than 0.1.

  1. PENGAMBILAN PEKTIN DARI ALBEDO SEMANGKA DENGAN PROSES EKSTRAKSI ASAM

    Directory of Open Access Journals (Sweden)

    Melisa Triandini Maulani

    2014-04-01

    Full Text Available Watermelon is a plant that is resistant to dry climate so it can be grown in tropical and semi-desert. Watermelon albedo is a potential source of pectin because it contains pectin compounds. To decompose the pectin in the watermelon albedo can be done by acid extraction process because it will lesser the possibility of damage pectin, whereas alcohol is use to precipitate pectin. In this research watermelon albedo as basic ingredients would be extracted to produce pectin to identified the differences in the influence of temperature variation and the type of solvent extraction of the pectin content of the albedo watermelon and determined variations in maximum temperature and type of solvent extraction to produce pectin. The study was conducted with a 90-minute extraction time and extraction temperature 60, 70, and 80 °C and 500 mL the solvent HCl and CH3COOH with 2.6 pH. The results were obtained taking the maximum conditions of pectin using solvent extraction HCl at a temperature of 80 °C and obtained pectin levels of 11.2635%. Solvent which is a strong acid HCl is easier to untie protopektin pectin so pectin levels has generated a high level. The higher the operating temperature, the bigger pectin levels that are obtained until the temperature limit of 80 °C. This caused by the movement of the H+ ions more reactive, the more contact between the substances dissolved in the sample with solvent and obtained more pectin.

  2. Multidecadal Variability in Surface Albedo Feedback Across CMIP5 Models

    Science.gov (United States)

    Schneider, Adam; Flanner, Mark; Perket, Justin

    2018-02-01

    Previous studies quantify surface albedo feedback (SAF) in climate change, but few assess its variability on decadal time scales. Using the Coupled Model Intercomparison Project Version 5 (CMIP5) multimodel ensemble data set, we calculate time evolving SAF in multiple decades from surface albedo and temperature linear regressions. Results are meaningful when temperature change exceeds 0.5 K. Decadal-scale SAF is strongly correlated with century-scale SAF during the 21st century. Throughout the 21st century, multimodel ensemble mean SAF increases from 0.37 to 0.42 W m-2 K-1. These results suggest that models' mean decadal-scale SAFs are good estimates of their century-scale SAFs if there is at least 0.5 K temperature change. Persistent SAF into the late 21st century indicates ongoing capacity for Arctic albedo decline despite there being less sea ice. If the CMIP5 multimodel ensemble results are representative of the Earth, we cannot expect decreasing Arctic sea ice extent to suppress SAF in the 21st century.

  3. The East Asian Development Experience: Policy Lessons, Implications, and Recommendations for Sub-Saharan Africa (SSA) Global Competitiveness

    OpenAIRE

    Ashford C. Chea

    2012-01-01

    The paper looks at the development experience of East Asia and draws lessons for Sub-Saharan Africa in building global competitiveness. It starts with a historical perspective of both regions’ developmental trajectories. This is followed by an analysis of the causes of East Asia’s superior economic performance and development and SSA underdevelopment. The article also draws policy lessons from East Asia development strategies for SSA global competitiveness. The paper ends with a presentation ...

  4. Distinguishing the albedo of exoplanets from stellar activity

    Science.gov (United States)

    Serrano, L. M.; Barros, S. C. C.; Oshagh, M.; Santos, N. C.; Faria, J. P.; Demangeon, O.; Sousa, S. G.; Lendl, M.

    2018-03-01

    Context. Light curves show the flux variation from the target star and its orbiting planets as a function of time. In addition to the transit features created by the planets, the flux also includes the reflected light component of each planet, which depends on the planetary albedo. This signal is typically referred to as phase curve and could be easily identified if there were no additional noise. As well as instrumental noise, stellar activity, such as spots, can create a modulation in the data, which may be very difficult to distinguish from the planetary signal. Aims: We analyze the limitations imposed by the stellar activity on the detection of the planetary albedo, considering the limitations imposed by the predicted level of instrumental noise and the short duration of the obervations planned in the context of the CHEOPS mission. Methods: As initial condition, we have assumed that each star is characterized by just one orbiting planet. We built mock light curves that included a realistic stellar activity pattern, the reflected light component of the planet and an instrumental noise level, which we have chosen to be at the same level as predicted for CHEOPS. We then fit these light curves to try to recover the reflected light component, assuming the activity patterns can be modeled with a Gaussian process. Results: We estimate that at least one full stellar rotation is necessary to obtain a reliable detection of the planetary albedo. This result is independent of the level of noise, but it depends on the limitation of the Gaussian process to describe the stellar activity when the light curve time-span is shorter than the stellar rotation. As an additional result, we found that with a 6.5 magnitude star and the noise level of CHEOPS, it is possible to detect the planetary albedo up to a lower limit of Rp = 0.03 R*. Finally, in presence of typical CHEOPS gaps in the simulations, we confirm that it is still possible to obtain a reliable albedo.

  5. The New Global Gapless GLASS Albedo Product from 1981 to 2014

    Science.gov (United States)

    Dou, B.; Liu, Q.; Qu, Y.; Wang, L.; Feng, Y.; Nie, A.; Li, X.; Zhang, J.; Niu, H.; Cai, E.; Zhao, L.

    2016-12-01

    Long-time series and various spatial resolution albedo products are needed for climate change and environmental studies at both global and regional scale. To meet these requirements, GLASS (Global LAnd Surface Satellites) gapless albedo product from 1981 to 2010 was firstly released in 2012 and widely used in long-term earth change researches. However, only shortwave albedo product in spatial resolution of 0.05 degree and 1 km were provided, which limits extensive applications for visible and near-infrared bands. Thus, new GLASS albedo product are produced and comprehensively enhanced in time series, algorithm and product content. Five major updates are conducted: 1) Time region is expanded from 1981-2010 to 1981-2014; 2) Physically ART (radiative transfer theory) and TCOWA (Three-Component Ocean Water Albedo) models rather than previous RTLSR (Rose-Thick Li-Sparse Reciprocal kernel combination) model are adopted for snow and inland water albedo estimation, respectively; 3) global shortwave, visible, and near-infrared albedos in spatial resolution of 0.05 degree and 1 km are released; 4) Clear-sky albedo is provided beyond the traditional black-sky albedo and white sky-albedo for amateurish user; 5) 250 m albedo product is provided in part of global for regional application. In this study, we firstly detail the updates of this inspiring product. Then the product is compared with the previous GLASS albedo product and preliminary assessed against field measurements under various land covers. Significant improvements are reported for snow and water albedo. The results demonstrate that the new GLASS albedo product is a gapless, long-term continuous, and self-consistent data-set. Comparing to previous GLASS albedo product, lower black-sky albedo and higher white-sky albedo are proved for permanent snow-cover region. Moreover, higher albedo of inland water and seasonal snow-cover mountain are captured. This product brings new chance and view to understanding long

  6. Inclusion of Solar Elevation Angle in Land Surface Albedo Parameterization Over Bare Soil Surface.

    Science.gov (United States)

    Zheng, Zhiyuan; Wei, Zhigang; Wen, Zhiping; Dong, Wenjie; Li, Zhenchao; Wen, Xiaohang; Zhu, Xian; Ji, Dong; Chen, Chen; Yan, Dongdong

    2017-12-01

    Land surface albedo is a significant parameter for maintaining a balance in surface energy. It is also an important parameter of bare soil surface albedo for developing land surface process models that accurately reflect diurnal variation characteristics and the mechanism behind the solar spectral radiation albedo on bare soil surfaces and for understanding the relationships between climate factors and spectral radiation albedo. Using a data set of field observations, we conducted experiments to analyze the variation characteristics of land surface solar spectral radiation and the corresponding albedo over a typical Gobi bare soil underlying surface and to investigate the relationships between the land surface solar spectral radiation albedo, solar elevation angle, and soil moisture. Based on both solar elevation angle and soil moisture measurements simultaneously, we propose a new two-factor parameterization scheme for spectral radiation albedo over bare soil underlying surfaces. The results of numerical simulation experiments show that the new parameterization scheme can more accurately depict the diurnal variation characteristics of bare soil surface albedo than the previous schemes. Solar elevation angle is one of the most important factors for parameterizing bare soil surface albedo and must be considered in the parameterization scheme, especially in arid and semiarid areas with low soil moisture content. This study reveals the characteristics and mechanism of the diurnal variation of bare soil surface solar spectral radiation albedo and is helpful in developing land surface process models, weather models, and climate models.

  7. Aerosol layer height from synergistic use of VIIRS and OMPS

    Science.gov (United States)

    Lee, J.; Hsu, N. Y. C.; Sayer, A. M.; Kim, W.; Seftor, C. J.

    2017-12-01

    This study presents an Aerosol Single-scattering albedo and Height Estimation (ASHE) algorithm, which retrieves the height of UV-absorbing aerosols by synergistically using the Visible Infrared Imaging Radiometer Suite (VIIRS) and the Ozone Mapping and Profiler Suite (OMPS). ASHE provides height information over a much broader area than ground-based or spaceborne lidar measurements by benefitting from the wide swaths of the two instruments used. As determination of single-scattering albedo (SSA) of the aerosol layer is the most critical part for the performance and coverage of ASHE, here we demonstrate three different strategies to constrain the SSA. First, ASHE is able to retrieve the SSA of UV-absorbing aerosols when Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) provides vertical profiles of the aerosol layer of interest. Second, Aerosol Robotic Network (AERONET) inversions can directly constrain the SSA of the aerosol layer when collocated with VIIRS or OMPS. Last, a SSA climatology from ASHE, AERONET, or other data sources can be used for large-scale, aged aerosol events, for which climatological SSA is well-known, at the cost of a slight decrease in retrieval accuracy. The same algorithm can be applied to measurements of similar type, such as those made by the Moderate Resolution Imaging Spectroradiometer (MODIS) and Ozone Monitoring Instrument (OMI), for a long-term, consistent data record.

  8. Sea Ice, Clouds, Sunlight, and Albedo: The Umbrella Versus the Blanket

    Science.gov (United States)

    Perovich, D. K.

    2017-12-01

    The Arctic sea ice cover has undergone a major decline in recent years, with reductions in ice extent, ice thickness, and ice age. Understanding the feedbacks and forcing driving these changes is critical in improving predictions. The surface radiation budget plays a central role in summer ice melt and is governed by clouds and surface albedo. Clouds act as an umbrella reducing the downwelling shortwave, but also serve as a blanket increasing the downwelling longwave, with the surface albedo also determining the net balance. Using field observations from the SHEBA program, pairs of clear and cloudy days were selected for each month from May through September and the net radiation flux was calculated for different surface conditions and albedos. To explore the impact of albedo we calculated a break even albedo, where the net radiation for cloudy skies is the same as clear skies. For albedos larger than the break-even value the net radiation flux is smaller under clear skies compared to cloudy skies. Break-even albedos ranged from 0.30 in September to 0.58 in July. For snow covered or bare ice, clear skies always resulted in less radiative heat input. In contrast, leads always had, and ponds usually had, more radiative heat input under clear skies than cloudy skies. Snow covered ice had a net radiation flux that was negative or near zero under clear skies resulting in radiative cooling. We combined the albedo of individual ice types with the area of those ice types to calculate albedos averaged over a 50 km x 50 km area. The July case had the smallest areally averaged albedo of 0.50. This was less than the breakeven albedo, so cloudy skies had a smaller net radiation flux than clear skies. For the cases from the other four months, the areally averaged albedo was greater than the break-even albedo. The areally averaged net radiation flux was negative under clear skies for the May and September cases.

  9. Overview of Human-Centric Space Situational Awareness (SSA) Science and Technology (S&T)

    Science.gov (United States)

    Ianni, J.; Aleva, D.; Ellis, S.

    2012-09-01

    A number of organizations, within the government, industry, and academia, are researching ways to help humans understand and react to events in space. The problem is both helped and complicated by the fact that there are numerous data sources that need to be planned (i.e., tasked), collected, processed, analyzed, and disseminated. A large part of the research is in support of the Joint Space Operational Center (JSpOC), National Air and Space Intelligence Center (NASIC), and similar organizations. Much recent research has been specifically targeting the JSpOC Mission System (JMS) which has provided a unifying software architecture. This paper will first outline areas of science and technology (S&T) related to human-centric space situational awareness (SSA) and space command and control (C2) including: 1. Object visualization - especially data fused from disparate sources. Also satellite catalog visualizations that convey the physical relationships between space objects. 2. Data visualization - improve data trend analysis as in visual analytics and interactive visualization; e.g., satellite anomaly trends over time, space weather visualization, dynamic visualizations 3. Workflow support - human-computer interfaces that encapsulate multiple computer services (i.e., algorithms, programs, applications) into a 4. Command and control - e.g., tools that support course of action (COA) development and selection, tasking for satellites and sensors, etc. 5. Collaboration - improve individuals or teams ability to work with others; e.g., video teleconferencing, shared virtual spaces, file sharing, virtual white-boards, chat, and knowledge search. 6. Hardware/facilities - e.g., optimal layouts for operations centers, ergonomic workstations, immersive displays, interaction technologies, and mobile computing. Secondly we will provide a survey of organizations working these areas and suggest where more attention may be needed. Although no detailed master plan exists for human

  10. Potential use of sewage sludge ash (SSA as a cement replacement in precast concrete blocks

    Directory of Open Access Journals (Sweden)

    Pérez-Carrión, M.

    2014-03-01

    Full Text Available The present study explored the technological feasibility of re-using sewage sludge ash (SSA as a Portland cement replacement in commercially manufactured pre cast concrete blocks. The blocks analysed were made to the guidelines laid down in Spain’s National Plan for Waste Water Treatment Plant Sludge, 2001–2006, and European Union specifications (CE marking for such products. Performance was compared in three families of blocks, with 0, 10 and 20% SSA. The findings proved that SSA is apt for pre cast concrete block manufacture and that, in addition to the economic and environmental benefits afforded, its use would improve certain of the properties of conventional block.El objetivo de esta investigación es estudiar el uso potencial de las cenizas de lodos de depuradora (CLD, como sustitución del cemento Portland en bloques de hormigón prefabricados, de forma que se pueda lograr una revalorización de este material de desecho mediante este procedimiento. La metodología utilizada en este trabajo se rige por las directrices del Plan Nacional Español de Lodos de Aguas Residuales de 2001–2006, y por las exigencias del Consejo Europeo (marcado CE, que es obligatorio para este tipo de productos. Se han utilizado dos niveles de sustitución de cemento (10% y 20%, y todos los resultados han sido referidos a las muestras control. Los resultados obtenidos muestran que es posible utilizar una sustitución parcial del cemento por CLD, en la fabricación de bloques de hormigón prefabricados, y por lo tanto, se pueden conseguir beneficios económicos y ambientales, así como la mejora de una serie de propiedades.

  11. MELiSSA third compartment: Nitrosomonas europaea and Nitrobacter winogradskyi axenic cultures in bioreactors

    Science.gov (United States)

    Cruvellier, Nelly; Lasseur, Christophe; Poughon, Laurent; Creuly, Catherine; Dussap, Gilles

    Nitrogen is a key element for the life and its balance on Earth is regulated by the nitrogen cycle. This loop includes several steps among which nitrification that permits the transformation of the ammonium into nitrate. The MELiSSA loop is an artificial ecosystem designed for life support systems (LSS). It is based on the carbon and nitrogen cycles and the recycling of the non-edible part of the higher plants and the waste produced by the crew. In this order, all the wastes are collected in the first compartment to degrade them into organic acids and CO2. These compounds are joining the second compartment which is a photoheterotrophic compartment where at the outlet an organic-free medium containing ammonium is produced. This solution will be the substrate of the third compartment where nitrification is done. This compartment has to oxidize the ammonium into nitrate, and this biological reaction needs two steps. In the MELiSSA loop, the nitrification is carried out by two bacteria: Nitrosomonas europaea ATCC® 19718™ which is oxidizing ammonia into nitrite and Nitrobacter winogradskyi ATCC® 25391™ which is producing nitrate from nitrite in the third compartment. These two bacteria are growing in axenic conditions on a fixed bed bioreactor filled with Biostyr® beads. The nitrogen compounds are controlled by Ionic Chromatography and colorimetric titration for each sample. The work presented here deals with the culture of both bacteria in pure cultures and mixed cultures in stirred and aerated bioreactors of different volumes. The first aim of our work is the characterization of the bacteria growth in bioreactors and in the nitrifying fixed-bed column. The experimental results confirm that the growth is slow; the maximal growth rate in suspended cultures is 0.054h-1 for Nitrosomonas europaea and 0.022h-1 for Nitrobacter winogradskyi. Mixed cultures are difficult to control and operate but one could be done for more than 500 hours. The characterization of the

  12. BOREAS Elevation Contours over the NSA and SSA in ARC/INFO Generate Format

    Science.gov (United States)

    Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)

    2000-01-01

    This data set was prepared by BORIS Staff by reformatting the original data into the ARC/INFO Generate format. The original data were received in SIF at a scale of 1:50,000. BORIS staff could not find a format document or commercial software for reading SIF; the BOREAS HYD-08 team pro-vided some C source code that could read some of the SIF files. The data cover the BOREAS NSA and SSA. The original data were compiled from information available in the 1970s and 1980s. The data are available in ARC/INFO Generate format files.

  13. BOREAS TF-8 NSA-OJP and SSA-OBS Ceilometer Data

    Science.gov (United States)

    Moore, Kathleen E.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Fitzjarrald, David R.

    2000-01-01

    The BOREAS TF-8 team used ceilometers to collect data on the fraction of the sky covered with clouds and the cloud height. Included with these data is the surface-based lifting condensation level, derived from temperature and humidity values acquired at the flux tower at the NSA-OJP site. Ceilo-meter data were collected at the NSA-OJP site in 1994 and at the NSA-OJP and SSA-OBS sites in 1996. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).

  14. BOREAS RSS-7 Landsat TM LAI IMages of the SSA and NSA

    Science.gov (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Chen, Jing; Cihlar, Josef

    2000-01-01

    The BOReal Ecosystem-Atmosphere Study Remote Sensing Science (BOREAS RSS-7) team used Landsat Thematic Mapper (TM) images processed at CCRS to produce images of Leaf Area Index (LAI) for the BOREAS study areas. Two images acquired on 06-Jun and 09-Aug-1991 were used for the SSA, and one image acquired on 09-Jun-1994 was used for the NSA. The LAI images are based on ground measurements and Landsat TM Reduced Simple Ratio (RSR) images. The data are stored in binary image-format files.

  15. Using albedo to reform wind erosion modelling, mapping and monitoring

    Science.gov (United States)

    Chappell, Adrian; Webb, Nicholas P.

    2016-12-01

    Wind erosion and dust emission models are used to assess the impacts of dust on radiative forcing in the atmosphere, cloud formation, nutrient fertilisation and human health. The models are underpinned by a two-dimensional geometric property (lateral cover; L) used to characterise the three-dimensional aerodynamic roughness (sheltered area or wakes) of the Earth's surface and calibrate the momentum it extracts from the wind. We reveal a fundamental weakness in L and demonstrate that values are an order of magnitude too small and significant aerodynamic interactions between roughness elements and their sheltered areas have been omitted, particularly under sparse surface roughness. We describe a solution which develops published work to establish a relation between sheltered area and the proportion of shadow over a given area; the inverse of direct beam directional hemispherical reflectance (black sky albedo; BSA). We show direct relations between shadow and wind tunnel measurements and thereby provide direct calibrations of key aerodynamic properties. Estimation of the aerodynamic parameters from albedo enables wind erosion assessments over areas, across platforms from the field to airborne and readily available satellite data. Our new approach demonstrated redundancy in existing wind erosion models and thereby reduced model complexity and improved fidelity. We found that the use of albedo enabled an adequate description of aerodynamic sheltering to characterise fluid dynamics and predict sediment transport without the use of a drag partition scheme (Rt) or threshold friction velocity (u∗t). We applied the calibrations to produce global maps of aerodynamic properties which showed very similar spatial patterns to each other and confirmed the redundancy in the traditional parameters of wind erosion modelling. We evaluated temporal patterns of predicted horizontal mass flux at locations across Australia which revealed variation between land cover types that would not

  16. The seasonal cycle of snow cover, sea ice and surface albedo

    Science.gov (United States)

    Robock, A.

    1980-01-01

    The paper examines satellite data used to construct mean snow cover caps for the Northern Hemisphere. The zonally averaged snow cover from these maps is used to calculate the seasonal cycle of zonally averaged surface albedo. The effects of meltwater on the surface, solar zenith angle, and cloudiness are parameterized and included in the calculations of snow and ice albedo. The data allows a calculation of surface albedo for any land or ocean 10 deg latitude band as a function of surface temperature ice and snow cover; the correct determination of the ice boundary is more important than the snow boundary for accurately simulating the ice and snow albedo feedback.

  17. Changes in the Albedo of the Pegasus and Phoenix Runways, 2000-2017

    Science.gov (United States)

    2017-07-18

    by the net heat transfer into the runway surface during the brief but intense peak of austral summer. The flux of downwelling shortwave solar energy...snow; and as ERDC/CRREL TR-17-10 2 mentioned above, the presence of melt water in the snow further reduces albedo and increases heating of the snow...interpolating over all possible angles, end member albedo cases (“white sky” and “black sky”) can be modeled . The actual albedo or “blue sky” albedo falls

  18. The importance of snow albedo for ice sheet evolution over the last glacial cycle

    Directory of Open Access Journals (Sweden)

    M. Willeit

    2018-05-01

    Full Text Available The surface energy and mass balance of ice sheets strongly depends on the amount of solar radiation absorbed at the surface, which is mainly controlled by the albedo of snow and ice. Here, using an Earth system model of intermediate complexity, we explore the role played by surface albedo for the simulation of glacial cycles. We show that the evolution of the Northern Hemisphere ice sheets over the last glacial cycle is very sensitive to the representation of snow albedo in the model. It is well known that the albedo of snow depends strongly on snow grain size and the content of light-absorbing impurities. Excluding either the snow aging effect or the dust darkening effect on snow albedo leads to an excessive ice build-up during glacial times and consequently to a failure in simulating deglaciation. While the effect of snow grain growth on snow albedo is well constrained, the albedo reduction due to the presence of dust in snow is much more uncertain because the light-absorbing properties of dust vary widely as a function of dust mineral composition. We also show that assuming slightly different optical properties of dust leads to very different ice sheet and climate evolutions in the model. Conversely, ice sheet evolution is less sensitive to the choice of ice albedo in the model. We conclude that a proper representation of snow albedo is a fundamental prerequisite for a successful simulation of glacial cycles.

  19. Effect of lime addition during sewage sludge treatment on characteristics of resulting SSA when it is used in cementitious materials.

    Science.gov (United States)

    Vouk, D; Nakic, D; Štirmer, N; Baricevic, A

    2017-02-01

    Final disposal of sewage sludge is important not only in terms of satisfying the regulations, but the aspect of choosing the optimal wastewater treatment technology, including the sludge treatment. In most EU countries, significant amounts of stabilized and dewatered sludge are incinerated, and sewage sludge ash (SSA) is generated as a by product. At the same time, lime is one of the commonly used additives in the sewage sludge treatment primarily to stabilize the sludge. In doing so, the question arose how desirable is such addition of lime if the sludge is subsequently incinerated, and the generated ash is further used in the production of cementitious materials. A series of mortars were prepared where 10-20% of the cement fraction was replaced by SSA. Since all three types of analyzed SSA (without lime, with lime added during sludge stabilization and with extra lime added during sludge incineration) yielded nearly same results, it can be concluded that if sludge incineration is accepted solution, lime addition during sludge treatment is unnecessary even from the standpoint of preserving the pozzolanic properties of the resulting SSA. Results of the research carried out on cement mortars point to the great possibilities of using SSA in concrete industry.

  20. Solar Flare Prediction Science-to-Operations: the ESA/SSA SWE A-EFFort Service

    Science.gov (United States)

    Georgoulis, Manolis K.; Tziotziou, Konstantinos; Themelis, Konstantinos; Magiati, Margarita; Angelopoulou, Georgia

    2016-07-01

    We attempt a synoptical overview of the scientific origins of the Athens Effective Solar Flare Forecasting (A-EFFort) utility and the actions taken toward transitioning it into a pre-operational service of ESA's Space Situational Awareness (SSA) Programme. The preferred method for solar flare prediction, as well as key efforts to make it function in a fully automated environment by coupling calculations with near-realtime data-downloading protocols (from the Solar Dynamics Observatory [SDO] mission), pattern recognition (solar active-region identification) and optimization (magnetic connectivity by simulated annealing) will be highlighted. In addition, the entire validation process of the service will be described, with its results presented. We will conclude by stressing the need for across-the-board efforts and synergistic work in order to bring science of potentially limited/restricted interest into realizing a much broader impact and serving the best public interests. The above presentation was partially supported by the ESA/SSA SWE A-EFFort project, ESA Contract No. 4000111994/14/D/MRP. Special thanks go to the ESA Project Officers R. Keil, A. Glover, and J.-P. Luntama (ESOC), M. Bobra and C. Balmer of the SDO/HMI team at Stanford University, and M. Zoulias at the RCAAM of the Academy of Athens for valuable technical help.

  1. A Multi-Scale Validation Strategy for Albedo Products over Rugged Terrain and Preliminary Application in Heihe River Basin, China

    Directory of Open Access Journals (Sweden)

    Xingwen Lin

    2018-01-01

    Full Text Available The issue for the validation of land surface remote sensing albedo products over rugged terrain is the scale effects between the reference albedo measurements and coarse scale albedo products, which is caused by the complex topography. This paper illustrates a multi-scale validation strategy specified for coarse scale albedo validation over rugged terrain. A Mountain-Radiation-Transfer-based (MRT-based albedo upscaling model was proposed in the process of multi-scale validation strategy for aggregating fine scale albedo to coarse scale. The simulated data of both the reference coarse scale albedo and fine scale albedo were used to assess the performance and uncertainties of the MRT-based albedo upscaling model. The results showed that the MRT-based model could reflect the albedo scale effects over rugged terrain and provided a robust solution for albedo upscaling from fine scale to coarse scale with different mean slopes and different solar zenith angles. The upscaled coarse scale albedos had the great agreements with the simulated coarse scale albedo with a Root-Mean-Square-Error (RMSE of 0.0029 and 0.0017 for black sky albedo (BSA and white sky albedo (WSA, respectively. Then the MRT-based model was preliminarily applied for the assessment of daily MODerate Resolution Imaging Spectroradiometer (MODIS Albedo Collection V006 products (MCD43A3 C6 over rugged terrain. Results showed that the MRT-based model was effective and suitable for conducting the validation of MODIS albedo products over rugged terrain. In this research area, it was shown that the MCD43A3 C6 products with full inversion algorithm, were generally in agreement with the aggregated coarse scale reference albedos over rugged terrain in the Heihe River Basin, with the BSA RMSE of 0.0305 and WSA RMSE of 0.0321, respectively, which were slightly higher than those over flat terrain.

  2. Advantageous use of SSA technique to observe effects of thickness, antioxidant and oxygen in gamma irradiated low density polyethylene

    Energy Technology Data Exchange (ETDEWEB)

    Perez, C.J., E-mail: cjperez@fi.mdp.edu.ar [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina); Failla, M.D. [Planta Piloto de Ingenieria Quimica-PLAPIQUI (UNS-CONICET), Camino ' La Carrindanga' Km 7, 8000 Bahia Blanca (Argentina); Carella, J.M. [Research Institute of Material Science and Technology (INTEMA), National Research Council (CONICET), Engineering Faculty, Mar del Plata University, Av. J.B. Justo 4302, 7600 Mar del Plata (Argentina)

    2012-06-20

    Highlights: Black-Right-Pointing-Pointer Information from successive self-nucleation and annealing technique is analyzed. Black-Right-Pointing-Pointer Oxygen and antioxidants reduce crosslinking efficiency by reaction with free radicals. Black-Right-Pointing-Pointer Recognizable differences are obtained in samples irradiated at different atmospheres. - Abstract: Information obtained from successive self-nucleation and annealing (SSA) technique is analyzed, paying special attention to the observable effects of samples thickness and antioxidant and oxygen concentrations. Molecular structure changes for low density polyethylene (LDPE) samples, irradiated under three different atmospheres for doses between 33 and 222 kGy were analyzed, with emphasis on the changes of longer polymethylene crystallizable lengths. Antioxidant and oxygen concentrations were varied for samples of different thickness to study the effects on degradation. The changes in the molecular structure were followed simultaneously by SSA and Infrared spectroscopy (FTIR) via carbonyl group concentration. Preliminary quantifications of the SSA technique sensitivity are also advanced.

  3. Spring–summer albedo variations of Antarctic sea ice from 1982 to 2009

    International Nuclear Information System (INIS)

    Shao, Zhu-De; Ke, Chang-Qing

    2015-01-01

    This study examined the spring–summer (November, December, January and February) albedo averages and trends using a dataset consisting of 28 years of homogenized satellite data for the entire Antarctic sea ice region and for five longitudinal sectors around Antarctica: the Weddell Sea (WS), the Indian Ocean sector (IO), the Pacific Ocean sector (PO), the Ross Sea (RS) and the Bellingshausen–Amundsen Sea (BS). Time series data of the sea ice concentrations and sea surface temperatures were used to analyse their relations to the albedo. The results indicated that the sea ice albedo increased slightly during the study period, at a rate of 0.314% per decade, over the Antarctic sea ice region. The sea ice albedos in the PO, the IO and the WS increased at rates of 2.599% per decade (confidence level 99.86%), 0.824% per decade and 0.413% per decade, respectively, and the steepest increase occurred in the PO. However, the sea ice albedo in the BS decreased at a rate of −1.617% per decade (confidence level 95.05%) and was near zero in the RS. The spring–summer average albedo over the Antarctic sea ice region was 50.24%. The highest albedo values were mainly found on the continental coast and in the WS; in contrast, the lowest albedo values were found on the outer edge of the sea ice, the RS and the Amery Ice Shelf. The average albedo in the western Antarctic sea ice region was distinctly higher than that in the east. The albedo was significantly positively correlated with sea ice concentration (SIC) and was significantly negatively correlated with sea surface temperature (SST); these scenarios held true for all five longitudinal sectors. Spatially, the higher surface albedos follow the higher SICs and lower SST patterns. The increasing albedo means that Antarctic sea ice region reflects more solar radiation and absorbs less, leading to a decrease in temperature and much snowfall on sea ice, and further resulted in an increase in albedo. Conversely, the decreasing

  4. Impacts of Satellite-Based Snow Albedo Assimilation on Offline and Coupled Land Surface Model Simulations.

    Directory of Open Access Journals (Sweden)

    Tao Wang

    Full Text Available Seasonal snow cover in the Northern Hemisphere is the largest component of the terrestrial cryosphere and plays a major role in the climate system through strong positive feedbacks related to albedo. The snow-albedo feedback is invoked as an important cause for the polar amplification of ongoing and projected climate change, and its parameterization across models is an important source of uncertainty in climate simulations. Here, instead of developing a physical snow albedo scheme, we use a direct insertion approach to assimilate satellite-based surface albedo during the snow season (hereafter as snow albedo assimilation into the land surface model ORCHIDEE (ORganizing Carbon and Hydrology In Dynamic EcosystEms and assess the influences of such assimilation on offline and coupled simulations. Our results have shown that snow albedo assimilation in both ORCHIDEE and ORCHIDEE-LMDZ (a general circulation model of Laboratoire de Météorologie Dynamique improve the simulation accuracy of mean seasonal (October throughout May snow water equivalent over the region north of 40 degrees. The sensitivity of snow water equivalent to snow albedo assimilation is more pronounced in the coupled simulation than the offline simulation since the feedback of albedo on air temperature is allowed in ORCHIDEE-LMDZ. We have also shown that simulations of air temperature at 2 meters in ORCHIDEE-LMDZ due to snow albedo assimilation are significantly improved during the spring in particular over the eastern Siberia region. This is a result of the fact that high amounts of shortwave radiation during the spring can maximize its snow albedo feedback, which is also supported by the finding that the spatial sensitivity of temperature change to albedo change is much larger during the spring than during the autumn and winter. In addition, the radiative forcing at the top of the atmosphere induced by snow albedo assimilation during the spring is estimated to be -2.50 W m-2, the

  5. Spatio-temporal Variability of Albedo and its Impact on Glacier Melt Modelling

    Science.gov (United States)

    Kinnard, C.; Mendoza, C.; Abermann, J.; Petlicki, M.; MacDonell, S.; Urrutia, R.

    2017-12-01

    Albedo is an important variable for the surface energy balance of glaciers, yet its representation within distributed glacier mass-balance models is often greatly simplified. Here we study the spatio-temporal evolution of albedo on Glacier Universidad, central Chile (34°S, 70°W), using time-lapse terrestrial photography, and investigate its effect on the shortwave radiation balance and modelled melt rates. A 12 megapixel digital single-lens reflex camera was setup overlooking the glacier and programmed to take three daily images of the glacier during a two-year period (2012-2014). One image was chosen for each day with no cloud shading on the glacier. The RAW images were projected onto a 10m resolution digital elevation model (DEM), using the IMGRAFT software (Messerli and Grinsted, 2015). A six-parameter camera model was calibrated using a single image and a set of 17 ground control points (GCPs), yielding a georeferencing accuracy of accounting for possible camera movement over time. The reflectance values from the projected image were corrected for topographic and atmospheric influences using a parametric solar irradiation model, following a modified algorithm based on Corripio (2004), and then converted to albedo using reference albedo measurements from an on-glacier automatic weather station (AWS). The image-based albedo was found to compare well with independent albedo observations from a second AWS in the glacier accumulation area. Analysis of the albedo maps showed that the albedo is more spatially-variable than the incoming solar radiation, making albedo a more important factor of energy balance spatial variability. The incorporation of albedo maps within an enhanced temperature index melt model revealed that the spatio-temporal variability of albedo is an important factor for the calculation of glacier-wide meltwater fluxes.

  6. Quantifying the missing link between forest albedo and productivity in the boreal zone

    Science.gov (United States)

    Hovi, Aarne; Liang, Jingjing; Korhonen, Lauri; Kobayashi, Hideki; Rautiainen, Miina

    2016-11-01

    Albedo and fraction of absorbed photosynthetically active radiation (FAPAR) determine the shortwave radiation balance and productivity of forests. Currently, the physical link between forest albedo and productivity is poorly understood, yet it is crucial for designing optimal forest management strategies for mitigating climate change. We investigated the relationships between boreal forest structure, albedo and FAPAR using a radiative transfer model called Forest Reflectance and Transmittance model FRT and extensive forest inventory data sets ranging from southern boreal forests to the northern tree line in Finland and Alaska (N = 1086 plots). The forests in the study areas vary widely in structure, species composition, and human interference, from intensively managed in Finland to natural growth in Alaska. We show that FAPAR of tree canopies (FAPARCAN) and albedo are tightly linked in boreal coniferous forests, but the relationship is weaker if the forest has broadleaved admixture, or if canopies have low leaf area and the composition of forest floor varies. Furthermore, the functional shape of the relationship between albedo and FAPARCAN depends on the angular distribution of incoming solar irradiance. We also show that forest floor can contribute to over 50 % of albedo or total ecosystem FAPAR. Based on our simulations, forest albedos can vary notably across the biome. Because of larger proportions of broadleaved trees, the studied plots in Alaska had higher albedo (0.141-0.184) than those in Finland (0.136-0.171) even though the albedo of pure coniferous forests was lower in Alaska. Our results reveal that variation in solar angle will need to be accounted for when evaluating climate effects of forest management in different latitudes. Furthermore, increasing the proportion of broadleaved trees in coniferous forests is the most important means of maximizing albedo without compromising productivity: based on our findings the potential of controlling forest

  7. Simulation and Analysis of Topographic Effect on Land Surface Albedo over Mountainous Areas

    Science.gov (United States)

    Hao, D.; Wen, J.; Xiao, Q.

    2017-12-01

    Land surface albedo is one of the significant geophysical variables affecting the Earth's climate and controlling the surface radiation budget. Topography leads to the formation of shadows and the redistribution of incident radiation, which complicates the modeling and estimation of the land surface albedo. Some studies show that neglecting the topography effect may lead to significant bias in estimating the land surface albedo for the sloping terrain. However, for the composite sloping terrain, the topographic effects on the albedo remain unclear. Accurately estimating the sub-topographic effect on the land surface albedo over the composite sloping terrain presents a challenge for remote sensing modeling and applications. In our study, we focus on the development of a simplified estimation method for land surface albedo including black-sky albedo (BSA) and white-sky albedo (WSA) of the composite sloping terrain at a kilometer scale based on the fine scale DEM (30m) and quantitatively investigate and understand the topographic effects on the albedo. The albedo is affected by various factors such as solar zenith angle (SZA), solar azimuth angle (SAA), shadows, terrain occlusion, and slope and aspect distribution of the micro-slopes. When SZA is 30°, the absolute and relative deviations between the BSA of flat terrain and that of rugged terrain reaches 0.12 and 50%, respectively. When the mean slope of the terrain is 30.63° and SZA=30°, the absolute deviation of BSA caused by SAA can reach 0.04. The maximal relative and relative deviation between the WSA of flat terrain and that of rugged terrain reaches 0.08 and 50%. These results demonstrate that the topographic effect has to be taken into account in the albedo estimation.

  8. Evaluation of Operational Albedo Algorithms For AVHRR, MODIS and VIIRS: Case Studies in Southern Africa

    Science.gov (United States)

    Privette, J. L.; Schaaf, C. B.; Saleous, N.; Liang, S.

    2004-12-01

    Shortwave broadband albedo is the fundamental surface variable that partitions solar irradiance into energy available to the land biophysical system and energy reflected back into the atmosphere. Albedo varies with land cover, vegetation phenological stage, surface wetness, solar angle, and atmospheric condition, among other variables. For these reasons, a consistent and normalized albedo time series is needed to accurately model weather, climate and ecological trends. Although an empirically-derived coarse-scale albedo from the 20-year NOAA AVHRR record (Sellers et al., 1996) is available, an operational moderate resolution global product first became available from NASA's MODIS sensor. The validated MODIS product now provides the benchmark upon which to compare albedo generated through 1) reprocessing of the historic AVHRR record and 2) operational processing of data from the future National Polar-Orbiting Environmental Satellite System's (NPOESS) Visible/Infrared Imager Radiometer Suite (VIIRS). Unfortunately, different instrument characteristics (e.g., spectral bands, spatial resolution), processing approaches (e.g., latency requirements, ancillary data availability) and even product definitions (black sky albedo, white sky albedo, actual or blue sky albedo) complicate the development of the desired multi-mission (AVHRR to MODIS to VIIRS) albedo time series -- a so-called Climate Data Record. This presentation will describe the different albedo algorithms used with AVHRR, MODIS and VIIRS, and compare their results against field measurements collected over two semi-arid sites in southern Africa. We also describe the MODIS-derived VIIRS proxy data we developed to predict NPOESS albedo characteristics. We conclude with a strategy to develop a seamless Climate Data Record from 1982- to 2020.

  9. Monitoring land surface albedo and vegetation dynamics using high spatial and temporal resolution synthetic time series from Landsat and the MODIS BRDF/NBAR/albedo product

    Science.gov (United States)

    Wang, Zhuosen; Schaaf, Crystal B.; Sun, Qingsong; Kim, JiHyun; Erb, Angela M.; Gao, Feng; Román, Miguel O.; Yang, Yun; Petroy, Shelley; Taylor, Jeffrey R.; Masek, Jeffrey G.; Morisette, Jeffrey T.; Zhang, Xiaoyang; Papuga, Shirley A.

    2017-07-01

    Seasonal vegetation phenology can significantly alter surface albedo which in turn affects the global energy balance and the albedo warming/cooling feedbacks that impact climate change. To monitor and quantify the surface dynamics of heterogeneous landscapes, high temporal and spatial resolution synthetic time series of albedo and the enhanced vegetation index (EVI) were generated from the 500 m Moderate Resolution Imaging Spectroradiometer (MODIS) operational Collection V006 daily BRDF/NBAR/albedo products and 30 m Landsat 5 albedo and near-nadir reflectance data through the use of the Spatial and Temporal Adaptive Reflectance Fusion Model (STARFM). The traditional Landsat Albedo (Shuai et al., 2011) makes use of the MODIS BRDF/Albedo products (MCD43) by assigning appropriate BRDFs from coincident MODIS products to each Landsat image to generate a 30 m Landsat albedo product for that acquisition date. The available cloud free Landsat 5 albedos (due to clouds, generated every 16 days at best) were used in conjunction with the daily MODIS albedos to determine the appropriate 30 m albedos for the intervening daily time steps in this study. These enhanced daily 30 m spatial resolution synthetic time series were then used to track albedo and vegetation phenology dynamics over three Ameriflux tower sites (Harvard Forest in 2007, Santa Rita in 2011 and Walker Branch in 2005). These Ameriflux sites were chosen as they are all quite nearby new towers coming on line for the National Ecological Observatory Network (NEON), and thus represent locations which will be served by spatially paired albedo measures in the near future. The availability of data from the NEON towers will greatly expand the sources of tower albedometer data available for evaluation of satellite products. At these three Ameriflux tower sites the synthetic time series of broadband shortwave albedos were evaluated using the tower albedo measurements with a Root Mean Square Error (RMSE) less than 0.013 and a

  10. Effect of sewage sludge ash (SSA on the mechanical performance and corrosion levels of reinforced Portland cement mortars

    Directory of Open Access Journals (Sweden)

    Andión, L. G.ª

    2006-06-01

    Full Text Available The article describes a study conducted to determinecorrosion in reinforcement embedded in Portland cement(PC mortars with different percentages of sewage sludgeash (SSA admixtures. The polarization resistancetechnique was used to determine the steel corrosion rate(Icorr in the test specimens. The samples were subjectedto different environmental conditions and aggressiveagents: 100% relative humidity (RH, accelerated carbonationat 70% RH and seawater immersion. Portlandcement was partially substituted for SSA in the mixes atrates of 0, 10, 20, 30 and 60% (by mass to make thedifferent mortars. The results show that where cementwas replaced by SSA at rates of up to 10% by mass,mortar corrosion performance was comparable to thebehaviour observed in SSA-free mortars (control mortar:0% SSA. Data for higher rates are also shown. From themechanical standpoint, SSA exhibited moderate pozzolanicactivity and the best performance when SSA wasadded at a rate of 10% to mixes with a water/(binder:PC + SSA (w/b ratio of 0.5.Se ha estudiado el nivel de corrosion que presentan lasarmaduras embebidas en morteros fabricados con cementoPortland (CP con diferentes porcentajes de sustitucion deceniza de lodo de depuradora (CLD. Se ha utilizado la tecnicade la Resistencia a la Polarizacion para determinar lavelocidad de corrosion del acero embebido en las muestrasestudiadas. Las muestras se han sometido a diferentes condicionesambientales y agentes agresivos: 100% de humedadrelativa (HR, carbonatacion acelerada al 70% HR einmersion en agua de mar. Para la fabricacion de los distintosmorteros, el cemento Portland ha sido parcialmente sustituidopor CLD en los siguientes porcentajes en masa: 0,10, 20, 30 y 60%. Los resultados muestran que sustitucionesde cemento por CLD de hasta el 10% en masa no alteranel comportamiento frente a la corrosion de los morterosal compararlos con los morteros libres de CLD (morteroscontrol: 0% de sustitucion de cemento por CLD. Se

  11. The AKARI IRC asteroid flux catalogue: updated diameters and albedos

    Science.gov (United States)

    Alí-Lagoa, V.; Müller, T. G.; Usui, F.; Hasegawa, S.

    2018-05-01

    The AKARI IRC all-sky survey provided more than twenty thousand thermal infrared observations of over five thousand asteroids. Diameters and albedos were obtained by fitting an empirically calibrated version of the standard thermal model to these data. After the publication of the flux catalogue in October 2016, our aim here is to present the AKARI IRC all-sky survey data and discuss valuable scientific applications in the field of small body physical properties studies. As an example, we update the catalogue of asteroid diameters and albedos based on AKARI using the near-Earth asteroid thermal model (NEATM). We fit the NEATM to derive asteroid diameters and, whenever possible, infrared beaming parameters. We fit groups of observations taken for the same object at different epochs of the survey separately, so we compute more than one diameter for approximately half of the catalogue. We obtained a total of 8097 diameters and albedos for 5170 asteroids, and we fitted the beaming parameter for almost two thousand of them. When it was not possible to fit the beaming parameter, we used a straight line fit to our sample's beaming parameter-versus-phase angle plot to set the default value for each fit individually instead of using a single average value. Our diameters agree with stellar-occultation-based diameters well within the accuracy expected for the model. They also match the previous AKARI-based catalogue at phase angles lower than 50°, but we find a systematic deviation at higher phase angles, at which near-Earth and Mars-crossing asteroids were observed. The AKARI IRC All-sky survey is an essential source of information about asteroids, especially the large ones, since, it provides observations at different observation geometries, rotational coverages and aspect angles. For example, by comparing in more detail a few asteroids for which dimensions were derived from occultations, we discuss how the multiple observations per object may already provide three

  12. Growing season carries stronger contributions to albedo dynamics on the Tibetan plateau.

    Science.gov (United States)

    Tian, Li; Chen, Jiquan; Zhang, Yangjian

    2017-01-01

    The Tibetan Plateau has experienced higher-than-global-average climate warming in recent decades, resulting in many significant changes in ecosystem structure and function. Among them is albedo, which bridges the causes and consequences of land surface processes and climate. The plateau is covered by snow/ice and vegetation in the non-growing season (nGS) and growing season (GS), respectively. Based on the MODIS products, we investigated snow/ice cover and vegetation greenness in relation to the spatiotemporal changes of albedo on the Tibetan Plateau from 2000 through 2013. A synchronous relationship was found between the change in GSNDVI and GSalbedo over time and across the Tibetan landscapes. We found that the annual average albedo had a decreasing trend, but that the albedo had slightly increased during the nGS and decreased during the GS. Across the landscapes, the nGSalbedo fluctuated in a synchronous pattern with snow/ice cover. Temporally, monthly snow/ice coverage also had a high correspondence with albedo, except in April and October. We detected clear dependencies of albedo on elevation. With the rise in altitude, the nGSalbedo decreased below 4000 m, but increased for elevations of 4500-5500 m. Above 5500 m, the nGSalbedo decreased, which was in accordance with the decreased amount of snow/ice coverage and the increased soil moisture on the plateau. More importantly, the decreasing albedo in the most recent decade appeared to be caused primarily by lowered growing season albedo.

  13. Variation in foliar nitrogen and albedo in response to nitrogen fertilization and elevated CO2

    Science.gov (United States)

    Haley F. Wicklein; Scott V. Ollinger; Mary E. Martin; David Y. Hollinger; Lucie C. Lepine; Michelle C. Day; Megan K. Bartlett; Andrew D. Richardson; Richard J. Norby

    2012-01-01

    Foliar nitrogen has been shown to be positively correlated with midsummer canopy albedo and canopy near infrared (NIR) reflectance over a broad range of plant functional types (e.g., forests, grasslands, and agricultural lands). To date, the mechanism(s) driving the nitrogen-albedo relationship have not been established, and it is unknown whether factors affecting...

  14. Intercomparison and validation of snow albedo parameterization schemes in climate models

    Energy Technology Data Exchange (ETDEWEB)

    Pedersen, Christina A.; Winther, Jan-Gunnar [Norwegian Polar Institute, Tromsoe (Norway)

    2005-09-01

    Snow albedo is known to be crucial for heat exchange at high latitudes and high altitudes, and is also an important parameter in General Circulation Models (GCMs) because of its strong positive feedback properties. In this study, seven GCM snow albedo schemes and a multiple linear regression model were intercompared and validated against 59 years of in situ data from Svalbard, the French Alps and six stations in the former Soviet Union. For each site, the significant meteorological parameters for modeling the snow albedo were identified by constructing the 95% confidence intervals. The significant parameters were found to be: temperature, snow depth, positive degree day and a dummy of snow depth, and the multiple linear regression model was constructed to include these. Overall, the intercomparison showed that the modeled snow albedo varied more than the observed albedo for all models, and that the albedo was often underestimated. In addition, for several of the models, the snow albedo decreased at a faster rate or by a greater magnitude during the winter snow metamorphosis than the observed albedo. Both the temperature dependent schemes and the prognostic schemes showed shortcomings. (orig.)

  15. A new albedo parameterization for use in climate models over the Antarctic ice sheet

    NARCIS (Netherlands)

    Kuipers Munneke, P.|info:eu-repo/dai/nl/304831891; van den Broeke, M.R.|info:eu-repo/dai/nl/073765643; Lenaerts, J.T.M.|info:eu-repo/dai/nl/314850163; Flanner, M.G.; Gardner, A.S.; van de Berg, W.J.|info:eu-repo/dai/nl/304831611

    2011-01-01

    A parameterization for broadband snow surface albedo, based on snow grain size evolution, cloud optical thickness, and solar zenith angle, is implemented into a regional climate model for Antarctica and validated against field observations of albedo for the period 1995–2004. Over the Antarctic

  16. The influence of inter-annually varying albedo on regional climate and drought

    KAUST Repository

    Meng, Xianhong

    2013-05-05

    Albedo plays an important role in land-atmosphere interactions and local climate. This study presents the impact on simulating regional climate, and the evolution of a drought, when using the default climatological albedo as is usually done in regional climate modelling, or using the actual observed albedo which is rarely done. Here, time-varying satellite derived albedo data is used to update the lower boundary condition of the Weather Research and Forecasting regional climate model in order to investigate the influence of observed albedo on regional climate simulations and also potential changes to land-atmosphere feedback over south-east Australia. During the study period from 2000 to 2008, observations show that albedo increased with an increasingly negative precipitation anomaly, though it lagged precipitation by several months. Compared to in-situ observations, using satellite observed albedo instead of the default climatological albedo provided an improvement in the simulated seasonal mean air temperature. In terms of precipitation, both simulations reproduced the drought that occurred from 2002 through 2006. Using the observed albedo produced a drier simulation overall. During the onset of the 2002 drought, albedo changes enhanced the precipitation reduction by 20 % on average, over locations where it was active. The area experiencing drought increased 6.3 % due to the albedo changes. Two mechanisms for albedo changes to impact land-atmosphere drought feedback are investigated. One accounts for the increased albedo, leading to reduced turbulent heat flux and an associated decrease of moist static energy density in the planetary boundary layer; the other considers that enhanced local radiative heating, due to the drought, favours a deeper planetary boundary layer, subsequently decreasing the moist static energy density through entrainment of the free atmosphere. Analysis shows that drought related large-scale changes in the regional climate favour a

  17. BOREAS RSS-8 BIOME-BGC SSA Simulation of Annual Water and Carbon Fluxes

    Science.gov (United States)

    Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Kimball, John

    2000-01-01

    The BOREAS RSS-8 team performed research to evaluate the effect of seasonal weather and landcover heterogeneity on boreal forest regional water and carbon fluxes using a process-level ecosystem model, BIOME-BGC, coupled with remote sensing-derived parameter maps of key state variables. This data set contains derived maps of landcover type and crown and stem biomass as model inputs to determine annual evapotranspiration, gross primary production, autotrophic respiration, and net primary productivity within the BOREAS SSA-MSA, at a 30-m spatial resolution. Model runs were conducted over a 3-year period from 1994-1996; images are provided for each of those years. The data are stored in binary image format. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  18. Personal neutron monitoring using TLD albedo combined with etched tracks detector

    Energy Technology Data Exchange (ETDEWEB)

    Tsujimura, N.; Momose, T. [Japan Nuclear Cycle Development Institute, Ibarakiken (Japan)

    2002-07-01

    The albedo dosimetry has been carried out in personal neutron monitoring in the MOX fuel plant of JNC Tokai Works, however, it has shortcomings mainly due to the inherently poor energy response. This paper describes our efforts to overcome these difficulties in practical use of albedo dosemeters. The following four subjects are presented: (1) the neutron energy response functions of albedo TLD obtained from the mono-energetic neutron irradiation experiments and the Monte-Carlo calculations, (2) the location- dependent correction factors calculated from the response functions and neutron energy spectra measured in the workplaces, (3) the results of the international personal neutron dosimetry intercomparison program, and (4) the operational comparison program of TLD albedo and etched tracks detector worn by workers engaged in the fabrication process of the MOX fuel plant. Finally, the characteristics of the combination neutron dosemeter using TLD albedo and solid state etched track detector are summarized.

  19. ARM Climate Research Facility Spectral Surface Albedo Value-Added Product (VAP) Report

    Energy Technology Data Exchange (ETDEWEB)

    McFarlane, S; Gaustad, K; Long, C; Mlawer, E

    2011-07-15

    This document describes the input requirements, output data products, and methodology for the Spectral Surface Albedo (SURFSPECALB) value-added product (VAP). The SURFSPECALB VAP produces a best-estimate near-continuous high spectral resolution albedo data product using measurements from multifilter radiometers (MFRs). The VAP first identifies best estimates for the MFR downwelling and upwelling shortwave irradiance values, and then calculates narrowband spectral albedo from these best-estimate irradiance values. The methodology for finding the best-estimate values is based on a simple process of screening suspect data and backfilling screened and missing data with estimated values when possible. The resulting best-estimate MFR narrowband spectral albedos are used to determine a daily surface type (snow, 100% vegetation, partial vegetation, or 0% vegetation). For non-snow surfaces, a piecewise continuous function is used to estimate a high spectral resolution albedo at 1 min temporal and 10 cm-1 spectral resolution.

  20. Calculation of neutron albedo from laminated semiinfinite media

    International Nuclear Information System (INIS)

    Dobrynin, Yu.L.; Mikaehlyan, L.A.; Skorokhvatov, M.D.

    1978-01-01

    A version of a laminated neutron detector with increased efficiency for recording external neutron fluxes by gamma-quanta from neutron capture is considered. The detector comprises two zones. The first zone constitutes an absorbent layer (europium oxide) 0.5 cm thick, and the second one is a moderator (water with gadolinium salt at the concentration of 0.8 g/l). Mono-energetic neutrons fall normally onto the detector surface. Neutron energy varied from 0.1 eV to MeV. The results of calculations of the integral numerical current albedo (INCA) of neutrons by the Monte Carlo method are presented. The INCA dependences on neutron energy are obtained for one moderator with different gadolinium contents; for the absorbent with the moderator containing and lacking the gadolinium. The resultant dependences are indicative of preferential capture of neutrons by the gadolinium in the moderator, this being more desirable for recording neutrons in the (n, γ) reaction

  1. THE STATISTICS OF ALBEDO AND HEAT RECIRCULATION ON HOT EXOPLANETS

    International Nuclear Information System (INIS)

    Cowan, Nicolas B.; Agol, Eric

    2011-01-01

    If both the day-side and night-side effective temperatures of a planet can be measured, it is possible to estimate its Bond albedo, 0 B 0 , and associated uncertainty. We then use a simple model-independent technique to estimate a planet's effective temperature from planet/star flux ratios. We use thermal secondary eclipse measurements-those obtained at λ>0.8 μm-to estimate day-side effective temperatures, T d , and thermal phase variations-when available-to estimate night-side effective temperature. We strongly rule out the 'null hypothesis' of a single A B and ε for all 24 planets. If we allow each planet to have different parameters, we find that low Bond albedos are favored (A B 0 , the day-side effective temperatures of the 24 planets describe a uni-modal distribution. The two biggest outliers are GJ 436b (abnormally hot) and HD 80606b (abnormally cool), and these are the only eccentric planets in our sample. The dimensionless quantity T d /T 0 exhibits no trend with the presence or absence of stratospheric inversions. There is also no clear trend between T d /T 0 and T 0 . That said, the six planets with the greatest sub-stellar equilibrium temperatures (T > 2400 K) have low ε, as opposed to the 18 cooler planets, which show a variety of recirculation efficiencies. This hints that the very hottest transiting giant planets are qualitatively different from the merely hot Jupiters. We propose an explanation of this trend based on how a planet's radiative and advective times scale with temperature: both timescales are expected to be shorter for hotter planets, but the temperature dependence of the radiative timescale is stronger, leading to decreased heat recirculation efficiency.

  2. The Statistics of Albedo and Heat Recirculation on Hot Exoplanets

    Science.gov (United States)

    Cowan, Nicolas B.; Agol, Eric

    2011-03-01

    If both the day-side and night-side effective temperatures of a planet can be measured, it is possible to estimate its Bond albedo, 0 calculate a sub-stellar equilibrium temperature, T 0, and associated uncertainty. We then use a simple model-independent technique to estimate a planet's effective temperature from planet/star flux ratios. We use thermal secondary eclipse measurements—those obtained at λ>0.8 μm—to estimate day-side effective temperatures, T d, and thermal phase variations—when available—to estimate night-side effective temperature. We strongly rule out the "null hypothesis" of a single AB and ɛ for all 24 planets. If we allow each planet to have different parameters, we find that low Bond albedos are favored (AB outliers are GJ 436b (abnormally hot) and HD 80606b (abnormally cool), and these are the only eccentric planets in our sample. The dimensionless quantity T d/T 0 exhibits no trend with the presence or absence of stratospheric inversions. There is also no clear trend between T d/T 0 and T 0. That said, the six planets with the greatest sub-stellar equilibrium temperatures (T > 2400 K) have low ɛ, as opposed to the 18 cooler planets, which show a variety of recirculation efficiencies. This hints that the very hottest transiting giant planets are qualitatively different from the merely hot Jupiters. We propose an explanation of this trend based on how a planet's radiative and advective times scale with temperature: both timescales are expected to be shorter for hotter planets, but the temperature dependence of the radiative timescale is stronger, leading to decreased heat recirculation efficiency.

  3. Long-Term Variability of Surface Albedo and Its Correlation with Climatic Variables over Antarctica

    Directory of Open Access Journals (Sweden)

    Minji Seo

    2016-11-01

    Full Text Available The cryosphere is an essential part of the earth system for understanding climate change. Components of the cryosphere, such as ice sheets and sea ice, are generally decreasing over time. However, previous studies have indicated differing trends between the Antarctic and the Arctic. The South Pole also shows internal differences in trends. These phenomena indicate the importance of continuous observation of the Polar Regions. Albedo is a main indicator for analyzing Antarctic climate change and is an important variable with regard to the radiation budget because it can provide positive feedback on polar warming and is related to net radiation and atmospheric heating in the mainly snow- and ice-covered Antarctic. Therefore, in this study, we analyzed long-term temporal and spatial variability of albedo and investigated the interrelationships between albedo and climatic variables over Antarctica. We used broadband surface albedo data from the Satellite Application Facility on Climate Monitoring and data for several climatic variables such as temperature and Antarctic oscillation index (AAO during the period of 1983 to 2009. Time series analysis and correlation analysis were performed through linear regression using albedo and climatic variables. The results of this research indicated that albedo shows two trends, west trend and an east trend, over Antarctica. Most of the western side of Antarctica showed a negative trend of albedo (about −0.0007 to −0.0015 year−1, but the other side showed a positive trend (about 0.0006 year−1. In addition, albedo and surface temperature had a negative correlation, but this relationship was weaker in west Antarctica than in east Antarctica. The correlation between albedo and AAO revealed different relationships in the two regions; west Antarctica had a negative correlation and east Antarctica showed a positive correlation. In addition, the correlation between albedo and AAO was weaker in the west. This

  4. 20 CFR 408.1205 - How can a State have SSA administer its State recognition payment program?

    Science.gov (United States)

    2010-04-01

    ... recognition payment program? 408.1205 Section 408.1205 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Federal Administration of State Recognition Payments § 408.1205 How can a State have SSA administer its State recognition payment program? A State (or...

  5. 20 CFR 408.1235 - How does the State transfer funds to SSA to administer its recognition payment program?

    Science.gov (United States)

    2010-04-01

    ... administer its recognition payment program? 408.1235 Section 408.1235 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SPECIAL BENEFITS FOR CERTAIN WORLD WAR II VETERANS Federal Administration of State Recognition Payments § 408.1235 How does the State transfer funds to SSA to administer its recognition payment program...

  6. Persistent fetal sinus bradycardia associated with maternal anti-SSA/Ro and anti-SSB/La antibodies

    NARCIS (Netherlands)

    Chockalingam, Priya; Jaeggi, Edgar T.; Rammeloo, Lukas A.; Haak, Monique C.; Adama van Scheltema, Phebe N.; Breur, Johannes M. P. J.; Bartelings, Margot M.; Clur, Sally-Ann B.; Blom, Nico A.

    2011-01-01

    To study the clinical course and outcome of fetal sinus bradycardia (SB) due to maternal antibody-induced sinus node dysfunction. We reviewed the maternal, prenatal, and postnatal findings of fetuses with SB associated with elevated maternal anti-SSA/Ro and anti-SSB/La antibodies. Of the 6 cases

  7. Comment s'inventer un père écrivain: Albert camus chez Maïssa Bey

    NARCIS (Netherlands)

    Rosello, M.

    2015-01-01

    This article focuses on the role played by Camus in Maïssa Bey’s work. Focusing on the ambivalent and paradoxical place he occupies in Au commencement était la mer and l’Ombre d’un homme qui marche au soleil, I analyse the construction of the father or rather Bey’s definition of fathers. The

  8. 78 FR 37875 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Fiscal Service...

    Science.gov (United States)

    2013-06-24

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... computer matching involving the Federal government could be performed and adding certain protections for...

  9. 75 FR 54213 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Office of Personnel Management...

    Science.gov (United States)

    2010-09-03

    ... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub... computer matching involving the Federal government could be performed and adding certain protections for...

  10. 76 FR 21091 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Centers for Medicare & Medicaid...

    Science.gov (United States)

    2011-04-14

    ...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching...: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...), as amended, (Pub. L. 100-503, the Computer Matching and Privacy Protection Act (CMPPA) of 1988), the...

  11. 76 FR 5235 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA Internal Match)-Match Number 1014

    Science.gov (United States)

    2011-01-28

    ...; Computer Matching Program (SSA Internal Match)--Match Number 1014 AGENCY: Social Security Administration... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching....C. 552a, as amended, and the provisions of the Computer Matching and Privacy Protection Act of 1988...

  12. 76 FR 12397 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Bureau of the Public Debt (BPD...

    Science.gov (United States)

    2011-03-07

    ...; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1038 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... containing SSNs extracted from the Supplemental Security Record database. Exchanges for this computer...

  13. 76 FR 71417 - Privacy Act of 1974, as Amended; Computer Matching Program (SSA/Law Enforcement Agencies (LEA...

    Science.gov (United States)

    2011-11-17

    ...; Computer Matching Program (SSA/ Law Enforcement Agencies (LEA)) Match Number 5001 AGENCY: Social Security... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... accordance with the Privacy Act of 1974, as amended by the Computer Matching and Privacy Protection Act of...

  14. Development of a high spectral resolution surface albedo product for the ARM Southern Great Plains Central Facility

    Energy Technology Data Exchange (ETDEWEB)

    McFarlane, Sally A.; Gaustad, Krista L.; Mlawer, Eli J.; Long, Charles N.; Delamere, Jennifer

    2011-09-01

    We present a method for identifying dominant surface type and estimating high spectral resolution surface albedo at the Atmospheric Radiation Measurement (ARM) facility at the Southern Great Plains (SGP) site in Oklahoma for use in radiative transfer calculations. Given a set of 6-channel narrowband visible and near-infrared irradiance measurements from upward and downward looking multi-filter radiometers (MFRs), four different surface types (snow-covered, green vegetation, partial vegetation, non-vegetated) can be identified. A normalized difference vegetation index (NDVI) is used to distinguish between vegetated and non-vegetated surfaces, and a scaled NDVI index is used to estimate the percentage of green vegetation in partially vegetated surfaces. Based on libraries of spectral albedo measurements, a piecewise continuous function is developed to estimate the high spectral resolution surface albedo for each surface type given the MFR albedo values as input. For partially vegetated surfaces, the albedo is estimated as a linear combination of the green vegetation and non-vegetated surface albedo values. The estimated albedo values are evaluated through comparison to high spectral resolution albedo measurements taken during several Intensive Observational Periods (IOPs) and through comparison of the integrated spectral albedo values to observed broadband albedo measurements. The estimated spectral albedo values agree well with observations for the visible wavelengths constrained by the MFR measurements, but have larger biases and variability at longer wavelengths. Additional MFR channels at 1100 nm and/or 1600 nm would help constrain the high resolution spectral albedo in the near infrared region.

  15. Development of a high spectral resolution surface albedo product for the ARM Southern Great Plains central facility

    Science.gov (United States)

    McFarlane, S. A.; Gaustad, K. L.; Mlawer, E. J.; Long, C. N.; Delamere, J.

    2011-09-01

    We present a method for identifying dominant surface type and estimating high spectral resolution surface albedo at the Atmospheric Radiation Measurement (ARM) facility at the Southern Great Plains (SGP) site in Oklahoma for use in radiative transfer calculations. Given a set of 6-channel narrowband visible and near-infrared irradiance measurements from upward and downward looking multi-filter radiometers (MFRs), four different surface types (snow-covered, green vegetation, partial vegetation, non-vegetated) can be identified. A normalized difference vegetation index (NDVI) is used to distinguish between vegetated and non-vegetated surfaces, and a scaled NDVI index is used to estimate the percentage of green vegetation in partially vegetated surfaces. Based on libraries of spectral albedo measurements, a piecewise continuous function is developed to estimate the high spectral resolution surface albedo for each surface type given the MFR albedo values as input. For partially vegetated surfaces, the albedo is estimated as a linear combination of the green vegetation and non-vegetated surface albedo values. The estimated albedo values are evaluated through comparison to high spectral resolution albedo measurements taken during several Intensive Observational Periods (IOPs) and through comparison of the integrated spectral albedo values to observed broadband albedo measurements. The estimated spectral albedo values agree well with observations for the visible wavelengths constrained by the MFR measurements, but have larger biases and variability at longer wavelengths. Additional MFR channels at 1100 nm and/or 1600 nm would help constrain the high resolution spectral albedo in the near infrared region.

  16. Sewage sludge ash (SSA) from large and small incineration plants as a potential source of phosphorus - Polish case study.

    Science.gov (United States)

    Smol, Marzena; Kulczycka, Joanna; Kowalski, Zygmunt

    2016-12-15

    The aim of this research is to present the possibility of using the sewage sludge ash (SSA) generated in incineration plants as a secondary source of phosphorus (P). The importance of issues related to P recovery from waste materials results from European Union (UE) legislation, which indicated phosphorus as a critical raw material (CRM). Due to the risks of a shortage of supply and its impact on the economy, which is greater than other raw materials, the proper management of phosphorus resources is required in order to achieve global P security. Based on available databases and literature, an analysis of the potential use of SSA for P-recovery in Poland was conducted. Currently, approx. 43,000 Mg/year of SSA is produced in large and small incineration plants and according to in the Polish National Waste Management Plan 2014 (NWMP) further steady growth is predicted. This indicates a great potential to recycle phosphorus from SSA and to reintroduce it again into the value chain as a component of fertilisers which can be applied directly on fields. The amount of SSA generated in installations, both large and small, varies and this contributes to the fact that new and different P recovery technology solutions must be developed and put into use in the years to come (e.g. mobile/stationary P recovery installations). The creation of a database focused on the collection and sharing of data about the amount of P recovered in EU and Polish installations is identified as a helpful tool in the development of an efficient P management model for Poland. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Using Remote Sensing to Quantify Roof Albedo in Seven California Cities

    Science.gov (United States)

    Ban-Weiss, G. A.; Woods, J.; Millstein, D.; Levinson, R.

    2013-12-01

    Cool roofs reflect sunlight and therefore can reduce cooling energy use in buildings. Further, since roofs cover about 20-25% of cities, wide spread deployment of cool roofs could mitigate the urban heat island effect and partially counter urban temperature increases associated with global climate change. Accurately predicting the potential for increasing urban albedo using reflective roofs and its associated energy use and climate benefits requires detailed knowledge of the current stock of roofs at the city scale. Until now this knowledge has been limited due to a lack of availability of albedo data with sufficient spatial coverage, spatial resolution, and spectral information. In this work we use a novel source of multiband aerial imagery to derive the albedos of individual roofs in seven California cities: Los Angeles, Long Beach, San Diego, Bakersfield, Sacramento, San Francisco, and San Jose. The radiometrically calibrated, remotely sensed imagery has high spatial resolution (1 m) and four narrow (less than 0.1 μm wide) band reflectances: blue, green, red, and near-infrared. To derive the albedo of roofs in each city, we first locate roof pixels within GIS building outlines. Next we use laboratory measurements of the solar spectral reflectances of 190 roofing products to empirically relate solar reflectance (albedo) to reflectances in the four narrow bands; the root-mean-square of the residuals for the albedo prediction is 0.016. Albedos computed from remotely sensed reflectances are calibrated to ground measurements of roof albedo in each city. The error (both precision and accuracy) of albedo values is presented for each city. The area-weighted mean roof albedo (× standard deviation) for each city ranges from 0.17 × 0.08 (Los Angeles) to 0.29 × 0.15 (San Diego). In each city most roofs have low albedo in the range of 0.1 to 0.3. Roofs with albedo greater than 0.4 comprise less than 3% of total roofs and 7% of total roof area in each city. The California

  18. Near-ground cooling efficacies of trees and high-albedo surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Levinson, Ronnen M. [Univ. of California, Berkeley, CA (United States). Dept. of Mechanical Engineering

    1997-05-01

    Daytime summer urban heat islands arise when the prevalence of dark-colored surfaces and lack of vegetation make a city warmer than neighboring countryside. Two frequently-proposed summer heat island mitigation measures are to plant trees and to increase the albedo (solar reflectivity) of ground surfaces. This dissertation examines the effects of these measures on the surface temperature of an object near the ground, and on solar heating of air near the ground. Near-ground objects include people, vehicles, and buildings. The variation of the surface temperature of a near-ground object with ground albedo indicates that a rise in ground albedo will cool a near-ground object only if the object`s albedo exceeds a critical value. This critical value of object albedo depends on wind speed, object geometry, and the height of the atmospheric thermal boundary layer. It ranges from 0.15 to 0.37 for a person. If an object has typical albedo of 0.3, increasing the ground albedo by.

  19. Mapping Surface Broadband Albedo from Satellite Observations: A Review of Literatures on Algorithms and Products

    Directory of Open Access Journals (Sweden)

    Ying Qu

    2015-01-01

    Full Text Available Surface albedo is one of the key controlling geophysical parameters in the surface energy budget studies, and its temporal and spatial variation is closely related to the global climate change and regional weather system due to the albedo feedback mechanism. As an efficient tool for monitoring the surfaces of the Earth, remote sensing is widely used for deriving long-term surface broadband albedo with various geostationary and polar-orbit satellite platforms in recent decades. Moreover, the algorithms for estimating surface broadband albedo from satellite observations, including narrow-to-broadband conversions, bidirectional reflectance distribution function (BRDF angular modeling, direct-estimation algorithm and the algorithms for estimating albedo from geostationary satellite data, are developed and improved. In this paper, we present a comprehensive literature review on algorithms and products for mapping surface broadband albedo with satellite observations and provide a discussion of different algorithms and products in a historical perspective based on citation analysis of the published literature. This paper shows that the observation technologies and accuracy requirement of applications are important, and long-term, global fully-covered (including land, ocean, and sea-ice surfaces, gap-free, surface broadband albedo products with higher spatial and temporal resolution are required for climate change, surface energy budget, and hydrological studies.

  20. Analysis of earth albedo effect on sun sensor measurements based on theoretical model and mission experience

    Science.gov (United States)

    Brasoveanu, Dan; Sedlak, Joseph

    1998-01-01

    Analysis of flight data from previous missions indicates that anomalous Sun sensor readings could be caused by Earth albedo interference. A previous Sun sensor study presented a detailed mathematical model of this effect. The model can be used to study the effect of both diffusive and specular reflections and to improve Sun angle determination based on perturbed Sun sensor measurements, satellite position, and an approximate knowledge of attitude. The model predicts that diffuse reflected light can cause errors of up to 10 degrees in Coarse Sun Sensor (CSS) measurements and 5 to 10 arc sec in Fine Sun Sensor (FSS) measurements, depending on spacecraft orbit and attitude. The accuracy of these sensors is affected as long as part of the illuminated Earth surface is present in the sensor field of view. Digital Sun Sensors (DSS) respond in a different manner to the Earth albedo interference. Most of the time DSS measurements are not affected, but for brief periods of time the Earth albedo can cause errors which are a multiple of the sensor least significant bit and may exceed one degree. This paper compares model predictions with Tropical Rainfall Measuring Mission (TRMM) CSS measurements in order to validate and refine the model. Methods of reducing and mitigating the impact of Earth albedo are discussed. ne CSS sensor errors are roughly proportional to the Earth albedo coefficient. Photocells that are sensitive only to ultraviolet emissions would reduce the effective Earth albedo by up to a thousand times, virtually eliminating all errors caused by Earth albedo interference.

  1. Surface albedo in different land-use and cover types in Amazon forest region

    Directory of Open Access Journals (Sweden)

    Thiago de Oliveira Faria

    2018-05-01

    Full Text Available Albedo is the portion of energy from the Sun that is reflected by the earth's surface, thus being an important variable that controls climate and energy processes on Earth. Surface albedo is directly related to the characteristics of the Earth’s surface materials, making it a useful parameter to evaluate the effects of original soil cover replacement due to human occupation. This study evaluated the changes in the surface albedo values due to the conversion of vegetation to other land uses and to analyze the applicability of the use of albedo in the spatial delimitation of land-use classes in the transitional region between the Cerrado and Amazon biomes. Surface albedo measurements were obtained from processing of Landsat Thematic Mapper data in the Geographic Information System (GIS, and land-use information were collected using Google Earth high-resolution images. The results show that human activities such as the cultivation of crops and burning have contributed substantially to variations in the surface albedo, and that albedo estimates from Landsat imagery have the potential to help in the recognition and delimitation of features of land use and cover.

  2. A Method for Retrieving Daily Land Surface Albedo from Space at 30-m Resolution

    Directory of Open Access Journals (Sweden)

    Bo Gao

    2015-08-01

    Full Text Available Land surface albedo data with high spatio-temporal resolution are increasingly important for scientific studies addressing spatially and/or temporally small-scale phenomena, such as urban heat islands and urban land surface energy balance. Our previous study derived albedo data with 2–4-day and 30-m temporal and spatial resolution that have better spatio-temporal resolution than existing albedo data, but do not completely satisfy the requirements for monitoring high-frequency land surface changes at the small scale. Downscaling technology provides a chance to further improve the albedo data spatio-temporal resolution and accuracy. This paper introduces a method that combines downscaling technology for land surface reflectance with an empirical method of deriving land surface albedo. Firstly, downscaling daily MODIS land surface reflectance data (MOD09GA from 500 m to 30 m on the basis of HJ-1A/B BRDF data with 2–4-day and 30-m temporal and spatial resolution is performed: this is the key step in the improved method. Subsequently, the daily 30-m land surface albedo data are derived by an empirical method combining prior knowledge of the MODIS BRDF product and the downscaled daily 30-m reflectance. Validation of albedo data obtained using the proposed method shows that the new method has both improved spatio-temporal resolution and good accuracy (a total absolute accuracy of 0.022 and a total root mean squared error at six sites of 0.028.

  3. Climate implications of including albedo effects in terrestrial carbon policy

    Science.gov (United States)

    Jones, A. D.; Collins, W.; Torn, M. S.; Calvin, K. V.

    2012-12-01

    Proposed strategies for managing terrestrial carbon in order to mitigate anthropogenic climate change, such as financial incentives for afforestation, soil carbon sequestration, or biofuel production, largely ignore the direct effects of land use change on climate via biophysical processes that alter surface energy and water budgets. Subsequent influences on temperature, hydrology, and atmospheric circulation at regional and global scales could potentially help or hinder climate stabilization efforts. Because these policies often rely on payments or credits expressed in units of CO2-equivalents, accounting for biophysical effects would require a metric for comparing the strength of biophysical climate perturbation from land use change to that of emitting CO2. One such candidate metric that has been suggested in the literature on land use impacts is radiative forcing, which underlies the global warming potential metric used to compare the climate effects of various greenhouse gases with one another. Expressing land use change in units of radiative forcing is possible because albedo change results in a net top-of-atmosphere radiative flux change. However, this approach has also been critiqued on theoretical grounds because not all climatic changes associated with land use change are principally radiative in nature, e.g. changes in hydrology or the vertical distribution of heat within the atmosphere, and because the spatial scale of land use change forcing differs from that of well-mixed greenhouse gases. To explore the potential magnitude of this discrepancy in the context of plausible scenarios of future land use change, we conduct three simulations with the Community Climate System Model 4 (CCSM4) utilizing a slab ocean model. Each simulation examines the effect of a stepwise change in forcing relative to a pre-industrial control simulation: 1) widespread conversion of forest land to crops resulting in approximately 1 W/m2 global-mean radiative forcing from albedo

  4. Improvement of Mars surface snow albedo modeling in LMD Mars GCM with SNICAR

    Science.gov (United States)

    Singh, D.; Flanner, M.; Millour, E.

    2017-12-01

    The current version of Laboratoire de Météorologie Dynamique (LMD) Mars GCM (original-MGCM) uses annually repeating (prescribed) albedo values from the Thermal Emission Spectrometer observations. We integrate the Snow, Ice, and Aerosol Radiation (SNICAR) model with MGCM (SNICAR-MGCM) to prognostically determine H2O and CO2 ice cap albedos interactively in the model. Over snow-covered regions mean SNICAR-MGCM albedo is higher by about 0.034 than original-MGCM. Changes in albedo and surface dust content also impact the shortwave energy flux at the surface. SNICAR-MGCM model simulates a change of -1.26 W/m2 shortwave flux on a global scale. Globally, net CO2 ice deposition increases by about 4% over one Martian annual cycle as compared to original-MGCM simulations. SNICAR integration reduces the net mean global surface temperature, and the global surface pressure of Mars by about 0.87% and 2.5% respectively. Changes in albedo also show a similar distribution as dust deposition over the globe. The SNICAR-MGCM model generates albedos with higher sensitivity to surface dust content as compared to original-MGCM. For snow-covered regions, we improve the correlation between albedo and optical depth of dust from -0.91 to -0.97 with SNICAR-MGCM as compared to original-MGCM. Using new diagnostic capabilities with this model, we find that cryospheric surfaces (with dust) increase the global surface albedo of Mars by 0.022. The cryospheric effect is severely muted by dust in snow, however, which acts to decrease the planet-mean surface albedo by 0.06.

  5. Impacts of Synoptic Weather Patterns on Snow Albedo at Sites in New England

    Science.gov (United States)

    Adolph, A. C.; Albert, M. R.; Lazarcik, J.; Dibb, J. E.; Amante, J.; Price, A. N.

    2015-12-01

    Winter snow in the northeastern United States has changed over the last several decades, resulting in shallower snow packs, fewer days of snow cover and increasing precipitation falling as rain in the winter. In addition to these changes which cause reductions in surface albedo, increasing winter temperatures also lead to more rapid snow grain growth, resulting in decreased snow reflectivity. We present in-situ measurements and analyses to test the sensitivity of seasonal snow albedo to varying weather conditions at sites in New England. In particular, we investigate the impact of temperature on snow albedo through melt and grain growth, the impact of precipitation event frequency on albedo through snow "freshening," and the impact of storm path on snow structure and snow albedo. Over three winter seasons between 2013 and 2015, in-situ snow characterization measurements were made at three non-forested sites across New Hampshire. These near-daily measurements include spectrally resolved albedo, snow optical grain size determined through contact spectroscopy, snow depth, snow density and local meteorological parameters. Combining this information with storm tracks derived from HYSPLIT modeling, we quantify the current sensitivity of northeastern US snow albedo to temperature as well as precipitation type, frequency and path. Our analysis shows that southerly winter storms result in snow with a significantly lower albedo than storms which come from across the continental US or the Atlantic Ocean. Interannual variability in temperature and statewide spatial variability in snowfall rates at our sites show the relative importance of snowfall amount and temperatures in albedo evolution over the course of the winter.

  6. Albedo enhancement over land to counteract global warming: impacts on hydrological cycle

    Energy Technology Data Exchange (ETDEWEB)

    Bala, Govindasamy; Nag, Bappaditya [Indian Institute of Science, Divecha Center for Climate Change and Center for Atmospheric and Oceanic Sciences, Bangalore (India)

    2012-09-15

    A recent modelling study has shown that precipitation and runoff over land would increase when the reflectivity of marine clouds is increased to counter global warming. This implies that large scale albedo enhancement over land could lead to a decrease in runoff over land. In this study, we perform simulations using NCAR CAM3.1 that have implications for Solar Radiation Management geoengineering schemes that increase the albedo over land. We find that an increase in reflectivity over land that mitigates the global mean warming from a doubling of CO{sub 2} leads to a large residual warming in the southern hemisphere and cooling in the northern hemisphere since most of the land is located in northern hemisphere. Precipitation and runoff over land decrease by 13.4 and 22.3%, respectively, because of a large residual sinking motion over land triggered by albedo enhancement over land. Soil water content also declines when albedo over land is enhanced. The simulated magnitude of hydrological changes over land are much larger when compared to changes over oceans in the recent marine cloud albedo enhancement study since the radiative forcing over land needed (-8.2 W m{sup -2}) to counter global mean radiative forcing from a doubling of CO{sub 2} (3.3 W m{sup -2}) is approximately twice the forcing needed over the oceans (-4.2 W m{sup -2}). Our results imply that albedo enhancement over oceans produce climates closer to the unperturbed climate state than do albedo changes on land when the consequences on land hydrology are considered. Our study also has important implications for any intentional or unintentional large scale changes in land surface albedo such as deforestation/afforestation/reforestation, air pollution, and desert and urban albedo modification. (orig.)

  7. Deriving albedo maps for HAPEX-Sahel from ASAS data using kernel-driven BRDF models

    Directory of Open Access Journals (Sweden)

    P. Lewis

    1999-01-01

    Full Text Available This paper describes the application and testing of a method for deriving spatial estimates of albedo from multi-angle remote sensing data. Linear kernel-driven models of surface bi-directional reflectance have been inverted against high spatial resolution multi-angular, multi- spectral airborne data of the principal cover types within the HAPEX-Sahel study site in Niger, West Africa. The airborne data are obtained from the NASA Airborne Solid-state Imaging Spectrometer (ASAS instrument, flown in Niger in September and October 1992. The maps of model parameters produced are used to estimate integrated reflectance properties related to spectral albedo. Broadband albedo has been estimated from this by weighting the spectral albedo for each pixel within the map as a function of the appropriate spectral solar irradiance and proportion of direct and diffuse illumination. Partial validation of the results was performed by comparing ASAS reflectance and derived directional-hemispherical reflectance with simulations of a millet canopy made with a complex geometric canopy reflectance model, the Botanical Plant Modelling System (BPMS. Both were found to agree well in magnitude. Broadband albedo values derived from the ASAS data were compared with ground-based (point sample albedo measurements and found to agree extremely well. These results indicate that the linear kernel-driven modelling approach, which is to be used operationally to produce global 16 day, 1 km albedo maps from forthcoming NASA Earth Observing System spaceborne data, is both sound and practical for the estimation of angle-integrated spectral reflectance quantities related to albedo. Results for broadband albedo are dependent on spectral sampling and on obtaining the correct spectral weigthings.

  8. Migration of Frosts from High-Albedo Regions of Pluto: what New Horizons Reveals

    Science.gov (United States)

    Buratti, Bonnie J.; Stern, S. A.; Weaver, Hal A.; Young, Leslie A.; Olkin, Cathy B.; Ennico, Kimberly; Binzel, Richard P.; Zangari, Amanda; Earle, Alissa M.

    2015-11-01

    With its high eccentricity and obliquity, Pluto should exhibit seasonal volatile transport on its surface. Several lines of evidence support this transport: doubling of Pluto’s atmospheric pressure over the past two decades (Young et al., 2013, Ap. J. 766, L22; Olkin et al., 2015, Icarus 246, 230); changes in its historical rotational light curve, once all variations due to viewing geometry have been modelled (Buratti et al., 2015; Ap. J. 804, L6); and changes in HST albedo maps (Buie et al., 2010, Astron. J. 139, 1128). New Horizons LORRI images reveal that the region of greatest albedo change is not the polar cap(s) of Pluto, but the feature informally named Tombaugh Regio (TR). This feature has a normal reflectance as high as ~0.8 in some places, and it is superposed on older, lower-albedo pre-existing terrain with an albedo of only ~0.10. This contrast is larger than any other body in the Solar System, except for Iapetus. This albedo dichotomy leads to a complicated system of cold-trapping and thermal segregation, beyond the simple picture of seasonal volatile transport. Whatever the origin of TR, it initially acted as a cold trap, as the temperature differential between the high and low albedo regions could be enormous, possibly approaching 20K, based on their albedo differences and assuming their normalized phase curves are similar. This latter assumption will be refined as the full New Horizons data set is returned.Over six decades of ground-based photometry suggest that TR has been decreasing in albedo over the last 25 years. Possible causes include changing insolation angles, or sublimation from the edges where the high-albedo material impinges on a much warmer substrate.Funding by the NASA New Horizons Project acknowledged.

  9. Assessment of Satellite Albedos Using NASA-CAR Airborne Data

    Science.gov (United States)

    Kharbouche, S.; Charles, G.; Muller, J. P.

    2016-12-01

    Airborne BRF (Bidirectional Reflectance Factor) data has been acquired at multiple altitudes by the NASA CAR (Cloud Absorption Radiometer) multi-spectral instrument since the late 1990s in order to study the reflectance over different types of landscapes depending upon wavelengths, view angles and spatial scales, and to assess derived BRFs from multispectral satellites. As the measured BRFs are taken over a very short period (BRDF for different sites in the Arctic. Also, as the measurements have been taken at different flight heights, the upscaling issue can be addressed and detailed with concrete samples. The CAR instrument is well calibrated (back to NIST standards) and can be compared with some ground measurements on the ground. So the derived BRF data for this instrument are likely to be highly reliable and can be used in the validation of some satellites products like radiance, reflectance and albedo, as well as in the BRDF (Bidirectional Reflectance Distribution Function) modelling and in the development of new atmospheric correction techniques. The NASA-CAR, developed by NASA-GSFC can be carried and integrated into many experimental aircraft. So, CAR can be considered as an airborne multi-wavelength scanning radiometer that can measure radiance with instantaneous fields of view of 1°. Over targeted sites, the CAR flies circularly and scans through 180° from straight above, through the horizon to straight down. Data are recorded in 14 narrow spectral bands located in the ultraviolet, visible and near-infrared regions in the electromagnetic spectrum (0.340-2.301 mm). The ray or spot at nadir depends on the flight height. It varies from 1m (height=110m) to 48m (height=5500m). We will show in this presentation the accuracy of BRF, BRDF and Black-Sky-Albedo of MODIS, MISR, MERIS, VGT, Landsat-7 and AVHRR, over vegetated, non-vegetated and ice-covered sites. We will show also how CAR data are arranged and how can be read and deployed. This work was supported by

  10. Three-group albedo method applied to the diffusion phenomenon with up-scattering of neutrons

    International Nuclear Information System (INIS)

    Terra, Andre M. Barge Pontes Torres; Silva, Jorge A. Valle da; Cabral, Ronaldo G.

    2007-01-01

    The main objective of this research is to develop a three-group neutron Albedo algorithm considering the up-scattering of neutrons in order to analyse the diffusion phenomenon in nonmultiplying media. The neutron Albedo method is an analytical method that does not try to solve describing explicit equations for the neutron fluxes. Thus the neutron Albedo methodology is very different from the conventional methodology, as the neutron diffusion theory model. Graphite is analyzed as a model case. One major application is in the determination of the nonleakage probabilities with more understandable results in physical terms than conventional radiation transport method calculations. (author)

  11. Empirical models of monthly and annual surface albedo in managed boreal forests of Norway

    Science.gov (United States)

    Bright, Ryan M.; Astrup, Rasmus; Strømman, Anders H.

    2013-04-01

    As forest management activities play an increasingly important role in climate change mitigation strategies of Nordic regions such as Norway, Sweden, and Finland -- the need for a more comprehensive understanding of the types and magnitude of biogeophysical climate effects and their various tradeoffs with the global carbon cycle becomes essential to avoid implementation of sub-optimal policy. Forest harvest in these regions reduces the albedo "masking effect" and impacts Earth's radiation budget in opposing ways to that of concomitant carbon cycle perturbations; thus, policies based solely on biogeochemical considerations in these regions risk being counterproductive. There is therefore a need to better understand how human disturbances (i.e., forest management activities) affect important biophysical factors like surface albedo. An 11-year remotely sensed surface albedo dataset coupled with stand-level forest management data for a variety of stands in Norway's most productive logging region are used to develop regression models describing temporal changes in monthly and annual forest albedo following clear-cut harvest disturbance events. Datasets are grouped by dominant tree species and site indices (productivity), and two alternate multiple regression models are developed and tested following a potential plus modifier approach. This resulted in an annual albedo model with statistically significant parameters that explains a large proportion of the observed variation, requiring as few as two predictor variables: i) average stand age - a canopy modifier predictor of albedo, and ii) stand elevation - a local climate predictor of a forest's potential albedo. The same model structure is used to derive monthly albedo models, with models for winter months generally found superior to summer models, and conifer models generally outperforming deciduous. We demonstrate how these statistical models can be applied to routine forest inventory data to predict the albedo

  12. A MATHEMATICAL APPROACH TO ECONOMY OF EXPERIMENT IN DETERMINATIONS OF THE DIFFERENTIAL DOSE ALBEDO OF GAMMA RAYS

    Energy Technology Data Exchange (ETDEWEB)

    Shoemaker, N. F.; Huddleston, C. M.

    1962-12-10

    Treatments of the differential dose albedo of gamma rays on concrete have supposed that the albedo value is a function of: the energy of the incident gamma radiation, the polar angle of incidence, the polar angle of reflection (or scatter), and the azimuthal angle of reflection. It is demonstrated that, if certain reasonable assumptions are made regarding the mechanism of reflection, it is not necessary to investigate variations in albedo with azimuthal angle of refiection. Once differential dose albedo has been determined for a complete set of incident and reflected polar angles with zero azimuth, albedo at any azimuth can be derived by a suitable transformation. (auth)

  13. The influence of quorum sensing in compartment II of the MELiSSA loop

    Science.gov (United States)

    Condori, Sandra; Mastroleo, Felice; Wattiez, Ruddy; Leys, Natalie

    MELiSSA (Micro-Ecological Life Support System Alternative) has been conceived as a 5 compartments microorganisms and higher plants recycling system for long haul space flights. Rhodospirillum rubrum S1H colonizes compartment II. Previous work reported that continuous culture of the bacterium in a photobioreactor could lead to thick biofilm formation, leading to bioreactor arrest. Our aim is to investigate the unknown quorum sensing (QS) system of R. rubrum S1H, specifically under MELiSSA relevant culture conditions meaning light anaerobic (LAN) and using acetate as carbon source. In that purpose an autoinducer synthase gene (Rru_A3396) knockout mutant was constructed by allelic exchange generating strain M68. In addition phenotypic comparison between wild type (WT) and M68 was performed. Results of thin layer chromatography assay where Agrobacterium tumefaciens NT1 have been used as reporter strain showed that WT produces acyl-homoserine lactones (AHLs) from C4 to C12 acyl carbon chain length; however, in M68 no AHLs were detected confirming that gene Rru_A3396 (named rruI) encodes an autoinducer synthase. Interestingly under a low shear or static environment M68 showed cell aggregation similar as reported in a closely related bacterium Rhodobacter sphaeroides (cerI mutant). In contrast to WT, M68 did not form biofilm and exhibited a decreased motility and pigment content. M68 vs wild type transcriptomics results showed that 326 genes were statistically significant differentially expressed. Downregulation of genes related to photosynthesis e.g., reaction center subunits, light harvesting complex and photosynthetic assembly proteins was observed. Similar results were obtained for preliminary proteomic analysis. Results obtained showed that in R. rubrum S1H the AHL-based QS system regulates almost 8% of the genome which is linked to biofilm formation among other biological processes described above. Since strain M68 could not be used in compartment II due to its less

  14. Constraining the instantaneous aerosol influence on cloud albedo

    Energy Technology Data Exchange (ETDEWEB)

    Gryspeerdt, Edward; Quaas, Johannes; Ferrachat, Sylvaine; Gettelman, Andrew; Ghan, Steven; Lohmann, Ulrike; Morrison, Hugh; Neubauer, David; Partridge, Daniel G.; Stier, Philip; Takemura, Toshihiko; Wang, Hailong; Wang, Minghuai; Zhang, Kai

    2017-04-26

    Much of the uncertainty in estimates of the anthropogenic forcing of climate change comes from uncertainties in the instantaneous effect of aerosols on cloud albedo, known as the Twomey effect or the radiative forcing from aerosol–cloud interactions (RFaci), a component of the total or effective radiative forcing. Because aerosols serving as cloud condensation nuclei can have a strong influence on the cloud droplet number concentration (Nd), previous studies have used the sensitivity of the Nd to aerosol properties as a constraint on the strength of the RFaci. However, recent studies have suggested that relationships between aerosol and cloud properties in the present-day climate may not be suitable for determining the sensitivity of the Nd to anthropogenic aerosol perturbations. Using an ensemble of global aerosol–climate models, this study demonstrates how joint histograms between Nd and aerosol properties can account for many of the issues raised by previous studies. It shows that if the anthropogenic contribution to the aerosol is known, the RFaci can be diagnosed to within 20% of its actual value. The accuracy of different aerosol proxies for diagnosing the RFaci is investigated, confirming that using the aerosol optical depth significantly underestimates the strength of the aerosol–cloud interactions in satellite data.

  15. NEOWISE Reactivation Mission Year Three: Asteroid Diameters and Albedos

    Energy Technology Data Exchange (ETDEWEB)

    Masiero, Joseph R.; Mainzer, A. K.; Kramer, E. [Jet Propulsion Laboratory/California Institute of Technology, 4800 Oak Grove Drive, MS 183-301, Pasadena, CA 91109 (United States); Nugent, C.; Cutri, R. M. [California Institute of Technology, Infrared Processing and Analysis Center, 1200 California Boulevard, Pasadena, CA 91125 (United States); Wright, E. L. [University of California, Los Angeles, CA 90095 (United States); Bauer, J. M. [University of Maryland, College Park, MD 20742 (United States); Grav, T.; Sonnett, S., E-mail: Joseph.Masiero@jpl.nasa.gov [Planetary Science Institute, 1700 E Fort Lowell Road #106, Tucson, AZ 85719 (United States)

    2017-10-01

    The Near-Earth Object Wide-field Infrared Survey Explorer (NEOWISE) reactivation mission has completed its third year of surveying the sky in the thermal infrared for near-Earth asteroids and comets. NEOWISE collects simultaneous observations at 3.4 and 4.6  μ m of solar system objects passing through its field of regard. These data allow for the determination of total thermal emission from bodies in the inner solar system, and thus the sizes of these objects. In this paper, we present thermal model fits of asteroid diameters for 170 NEOs and 6110 Main Belt asteroids (MBAs) detected during the third year of the survey, as well as the associated optical geometric albedos. We compare our results with previous thermal model results from NEOWISE for overlapping sample sets, as well as diameters determined through other independent methods, and find that our diameter measurements for NEOs agree to within 26% (1 σ ) of previously measured values. Diameters for the MBAs are within 17% (1 σ ). This brings the total number of unique near-Earth objects characterized by the NEOWISE survey to 541, surpassing the number observed during the fully cryogenic mission in 2010.

  16. NEOWISE Reactivation Mission Year Three: Asteroid Diameters and Albedos

    International Nuclear Information System (INIS)

    Masiero, Joseph R.; Mainzer, A. K.; Kramer, E.; Nugent, C.; Cutri, R. M.; Wright, E. L.; Bauer, J. M.; Grav, T.; Sonnett, S.

    2017-01-01

    The Near-Earth Object Wide-field Infrared Survey Explorer (NEOWISE) reactivation mission has completed its third year of surveying the sky in the thermal infrared for near-Earth asteroids and comets. NEOWISE collects simultaneous observations at 3.4 and 4.6  μ m of solar system objects passing through its field of regard. These data allow for the determination of total thermal emission from bodies in the inner solar system, and thus the sizes of these objects. In this paper, we present thermal model fits of asteroid diameters for 170 NEOs and 6110 Main Belt asteroids (MBAs) detected during the third year of the survey, as well as the associated optical geometric albedos. We compare our results with previous thermal model results from NEOWISE for overlapping sample sets, as well as diameters determined through other independent methods, and find that our diameter measurements for NEOs agree to within 26% (1 σ ) of previously measured values. Diameters for the MBAs are within 17% (1 σ ). This brings the total number of unique near-Earth objects characterized by the NEOWISE survey to 541, surpassing the number observed during the fully cryogenic mission in 2010.

  17. Constraining the instantaneous aerosol influence on cloud albedo.

    Science.gov (United States)

    Gryspeerdt, Edward; Quaas, Johannes; Ferrachat, Sylvaine; Gettelman, Andrew; Ghan, Steven; Lohmann, Ulrike; Morrison, Hugh; Neubauer, David; Partridge, Daniel G; Stier, Philip; Takemura, Toshihiko; Wang, Hailong; Wang, Minghuai; Zhang, Kai

    2017-05-09

    Much of the uncertainty in estimates of the anthropogenic forcing of climate change comes from uncertainties in the instantaneous effect of aerosols on cloud albedo, known as the Twomey effect or the radiative forcing from aerosol-cloud interactions (RFaci), a component of the total or effective radiative forcing. Because aerosols serving as cloud condensation nuclei can have a strong influence on the cloud droplet number concentration ( N d ), previous studies have used the sensitivity of the N d to aerosol properties as a constraint on the strength of the RFaci. However, recent studies have suggested that relationships between aerosol and cloud properties in the present-day climate may not be suitable for determining the sensitivity of the N d to anthropogenic aerosol perturbations. Using an ensemble of global aerosol-climate models, this study demonstrates how joint histograms between N d and aerosol properties can account for many of the issues raised by previous studies. It shows that if the anthropogenic contribution to the aerosol is known, the RFaci can be diagnosed to within 20% of its actual value. The accuracy of different aerosol proxies for diagnosing the RFaci is investigated, confirming that using the aerosol optical depth significantly underestimates the strength of the aerosol-cloud interactions in satellite data.

  18. Benefits of Applying Predictive Intelligence to the Space Situational Awareness (SSA) Mission

    Science.gov (United States)

    Lane, B.; Mann, B.; Millard, C.

    Recent events have heightened the interest in providing improved Space Situational Awareness (SSA) to the warfighter using novel techniques that are affordable and effective. The current Space Surveillance Network (SSN) detects, tracks, catalogs and identifies artificial objects orbiting earth and provides information on Resident Space Objects (RSO) as well as new foreign launch (NFL) satellites. The reactive nature of the SSN provides little to no warning on changes to the expected states of these RSOs or NFLs. This paper will detail the use of the historical data collected on RSOs to characterize what their steady state is, proactively help identify when changes or anomalies have occurred using a pattern-of-like activity based intelligence approach, and apply dynamic, adaptive mission planning to the observables that lead up to a NFL. Multiple hypotheses will be carried along with the intent or the changes to the steady state to assist the SSN in tasking the various sensors in the network to collect the relevant data needed to help prune the number of hypotheses by assigning likelihood to each of those activities. Depending on the hypothesis and thresholds set, these likelihoods will then be used in turn to alert the SSN operator with changes to the steady state, prioritize additional data collections, and provide a watch list of likely next activities.

  19. BOREAS AFM-08 ECMWF Hourly Surface and Upper Air Data for the SSA and NSA

    Science.gov (United States)

    Viterbo, Pedro; Betts, Alan; Hall, Forrest G. (Editor); Newcomer, Jeffrey A.; Smith, David E. (Technical Monitor)

    2000-01-01

    The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-8 team focused on modeling efforts to improve the understanding of the diurnal evolution of the convective boundary layer over the boreal forest. This data set contains hourly data from the European Center for for Medium-Range Weather Forecasts (ECMWF) operational model from below the surface to the top of the atmosphere, including the model fluxes at the surface. Spatially, the data cover a pair of the points that enclose the rawinsonde sites at Candle Lake, Saskatchewan, in the Southern Study Area (SSA) and Thompson, Manitoba, in the Northern Study Area (NSA). Temporally, the data include the two time periods of 13 May 1994 to 30 Sept 1994 and 01 Mar 1996 to 31 Mar 1997. The data are stored in tabular ASCII files. The number of records in the upper air data files may exceed 20,000, causing a problem for some software packages. The ECMWF hourly surface and upper air data are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  20. Seasonal albedo of an urban/rural landscape from satellite observations

    Science.gov (United States)

    Brest, Christopher L.

    1987-01-01

    Using data from 27 calibrated Landsat observations of the Hartford, Connecticut area, the spatial distribution and seasonal variation of surface reflectance and albedo were examined. Mean values of visible reflectance, near-IR reflectance, and albedo are presented (for both snow-free and snow-cover observations) according to 14 land use/land cover categories. A diversity of albedo values was found to exist in this type of environment, associated with land cover. Many land-cover categories display a seasonal dependence, with intracategory seasonal differences being of comparable magnitude to intercategory differences. Key factors in determining albedo (and its seasonal dynamics) are the presence or absence of vegetation and the canopy structure. Snow-cover/snow-free differences range from a few percent (for urban land covers) to over 40 percent (for low-canopy vegetation).

  1. Quality assurance of in-situ measurements of land surface albedo: A model-based approach

    Science.gov (United States)

    Adams, Jennifer; Gobron, Nadine; Widlowski, Jean-Luc; Mio, Corrado

    2016-04-01

    This paper presents the development of a model-based framework for assessing the quality of in-situ measurements of albedo used to validate land surface albedo products. Using a 3D Monte Carlo Ray Tracing (MCRT) radiative transfer model, a quality assurance framework is built based on simulated field measurements of albedo within complex 3D canopies and under various illumination scenarios. This method provides an unbiased approach in assessing the quality of field measurements, and is also able to trace the contributions of two main sources of uncertainty in field-measurements of albedo; those resulting from 1) the field measurement protocol, such as height or placement of field measurement within the canopy, and 2) intrinsic factors of the 3D canopy under specific illumination characteristics considered, such as the canopy structure and landscape heterogeneity, tree heights, ecosystem type and season.

  2. The extreme ultraviolet albedos of the planet Mercury and of the moon

    Science.gov (United States)

    Wu, H. H.; Broadfoot, A. L.

    1977-01-01

    The albedo of the moon in the far UV was measured by Mariner 10 at a solar phase angle of 74 deg, and the geometric albedo of Mercury was measured in same wavelength range (584-1657 A) at solar phase angles ranging from 50 to 120 deg. For both the moon and Mercury there is a general increase in albedo for wavelengths decreasing from 1657 to 584 A. The ratio of the albedos of Mercury and the moon increases from about 0.6 to 0.8 in the range 600-1600 A. This merely points to a difference in the surfaces of the moon and Mercury, there being insufficient data to make any conclusions regarding the nature of the difference.

  3. Arctic sea ice albedo - A comparison of two satellite-derived data sets

    Science.gov (United States)

    Schweiger, Axel J.; Serreze, Mark C.; Key, Jeffrey R.

    1993-01-01

    Spatial patterns of mean monthly surface albedo for May, June, and July, derived from DMSP Operational Line Scan (OLS) satellite imagery are compared with surface albedos derived from the International Satellite Cloud Climatology Program (ISCCP) monthly data set. Spatial patterns obtained by the two techniques are in general agreement, especially for June and July. Nevertheless, systematic differences in albedo of 0.05 - 0.10 are noted which are most likely related to uncertainties in the simple parameterizations used in the DMSP analyses, problems in the ISCCP cloud-clearing algorithm and other modeling simplifications. However, with respect to the eventual goal of developing a reliable automated retrieval algorithm for compiling a long-term albedo data base, these initial comparisons are very encouraging.

  4. Offset of the potential carbon sink from boreal forestation by decreases in surface albedo

    International Nuclear Information System (INIS)

    Betts, R.A.

    2000-01-01

    Carbon uptake by forestation is one method proposed to reduce net carbon dioxide emissions to the atmosphere and so limit the radiative forcing of climate change. But the overall impact of forestation on climate will also depend on other effects associated with the creation of new forests. In particular the albedo of a forested landscape is generally lower than that of cultivated land, especially when snow is lying, and decreasing albedo exerts a positive radiative forcing on climate. Here I simulate the radiative forcings associated with changes in surface albedo as a result of forestation in temperate and boreal forest areas, and translate these forcings into equivalent changes in local carbon stock for comparison with estimated carbon sequestration potentials. I suggest that in many boreal forest areas, the positive forcing induced by decreases in albedo can offset the negative forcing that is expected from carbon sequestration. Some high-latitude forestation activities may therefore increase climate change, rather that mitigating it as intended

  5. Atmospheric effect on the ground-based measurements of broadband surface albedo

    Directory of Open Access Journals (Sweden)

    T. Manninen

    2012-11-01

    Full Text Available Ground-based pyranometer measurements of the (clear-sky broadband surface albedo are affected by the atmospheric conditions (mainly by aerosol particles, water vapour and ozone. A new semi-empirical method for estimating the magnitude of the effect of atmospheric conditions on surface albedo measurements in clear-sky conditions is presented. Global and reflected radiation and/or aerosol optical depth (AOD at two wavelengths are needed to apply the method. Depending on the aerosol optical depth and the solar zenith angle values, the effect can be as large as 20%. For the cases we tested using data from the Cabauw atmospheric test site in the Netherlands, the atmosphere caused typically up to 5% overestimation of surface albedo with respect to corresponding black-sky surface albedo values.

  6. Modeling Earth Albedo Currents on Sun Sensors for Improved Vector Observations

    DEFF Research Database (Denmark)

    Bhanderi, Dan

    2006-01-01

    Earth albedo influences vector measurements of the solar line of sight vector, due to the induced current on in the photo voltaics of Sun sensors. Although advanced digital Sun sensors exist, these are typically expensive and may not be suited for satellites in the nano or pico-class. Previously...... an Earth albedo model, based on reflectivity data from NASA's Total Ozone Mapping Spectrometer project, has been published. In this paper the proposed model is presented, and the model is sought validated by comparing simulated data with telemetry from the Danish Ørsted satellite. A novel method...... for modeling Sun sensor output by incorporating the Earth albedo model is presented. This model utilizes the directional information of in the Earth albedo model, which is achieved by Earth surface partitioning. This allows accurate simulation of the Sun sensor output and the results are consistent with Ørsted...

  7. Albedo-adjusted fast-neutron diffusion coefficients in reactor reflectors

    International Nuclear Information System (INIS)

    Terney, W.B.

    1975-01-01

    In the newer, larger pressurized-water reactor cores, the calculated power distributions are fairly sensitive to the number of neutron groups used and to the treatment of the reflector cross sections. Comparisons between transport and diffusion calculations show that the latter substantially underpredict the reflector albedos in the fast (top) group and that the power distribution is shifted toward the core center when compared to 4-group transport theory results. When the fast-neutron diffusion coefficients are altered to make the transport- and diffusion-theory albedos agree, the power distributions are also brought into agreement. An expression for the fast-neutron diffusion coefficients in reflector regions has been derived such that the diffusion calculation reproduces the albedo obtained from a transport solution. In addition, a correction factor for mesh effects applicable to coarse mesh problems is presented. The use of the formalism gives the correct albedos and improved power distributions. (U.S.)

  8. Role of albedo from the Gamma-400 telescope calorimeter when recording the primary gamma emission.

    Science.gov (United States)

    Ginsburg, V. L.; Kurnosova, L. V.; Labensky, A. G.; Topchiev, N. P.; Fradkin, M. I.; Kaplin, V. A.; Kaplin, D. V.; Loginov, V. A.; Maklyaev, E. F.; Runtso, M. F.; Gorchakov, E. V.

    A calorimeter albedo emission affecting the Gamma-400 telescope operation is studied, when recording γ-quanta at energies from 10 to 1000 GeV. Methods for diminishing this impact on measuring data are proposed.

  9. DUST, Albedo Monte-Carlo Simulation of Neutron Streaming in Multi-legged Square Concrete Ducts

    International Nuclear Information System (INIS)

    1993-01-01

    1 - Description of program or function: DUST simulates the thermal neutron streaming through multi-legged square concrete ducts. 2 - Method of solution: DUST uses the albedo Monte Carlo method. The albedo data used are in the form of empirical formulae based on the measured doubly differential albedo data. Sampling of the reflected polar and azimuthal angles is done by the rejection method. Variance reduction devices such as Russian Roulette are used. 3 - Restrictions on the complexity of the problem: - The albedo data and the subroutines for sampling the reflected polar and azimuthal angles are specific for concrete ducts. The maximum number of legs (as specified by dimension statements) is 5 and the maximum number of dose points is 50. The dose points considered are only in the last leg of the multi-legged duct

  10. Glacier albedo decrease in the European Alps: potential causes and links with mass balances

    Science.gov (United States)

    Di Mauro, Biagio; Julitta, Tommaso; Colombo, Roberto

    2016-04-01

    Both mountain glaciers and polar ice sheets are losing mass all over the Earth. They are highly sensitive to climate variation, and the widespread reduction of glaciers has been ascribed to the atmospheric temperature increase. Beside this driver, also ice albedo plays a fundamental role in defining mass balance of glaciers. In fact, dark ice absorbs more energy causing faster glacier melting, and this can drive to more negative balances. Previous studies showed that the albedo of Himalayan glaciers and the Greenland Ice Sheet is decreasing with important rates. In this contribution, we tested the hypothesis that also glaciers in the European Alps are getting darker. We analyzed 16-year time series of MODIS (MODerate resolution Imaging Spectrometer) snow albedo from Terra (MOD13A1, 2000-2015) and Aqua (MYD13A1, 2002-2015) satellites. These data feature a spatial resolution of 500m and a daily temporal resolution. We evaluated the existence of a negative linear and nonlinear trend of the summer albedo values both at pixel and at glacier level. We also calculated the correlation between MODIS summer albedo and glacier mass balances (from the World Glaciological Monitoring Service, WGMS database), for all the glaciers with available mass balance during the considered period. In order to estimate the percentage of the summer albedo that can be explained by atmospheric temperature, we correlated MODIS albedo and monthly air temperature extracted from the ERA-Interim reanalysis dataset. Results show that decreasing trends exist with a strong spatial variability in the whole Alpine chain. In large glaciers, such as the Aletch (Swiss Alps), the trend varies significantly also within the glacier, showing that the trend is higher in the area across the accumulation and ablation zone. Over the 17 glaciers with mass balance available in the WGMS data set, 11 gave significant relationship with the MODIS summer albedo. Moreover, the comparison between ERA-Interim temperature

  11. Implications of albedo changes following afforestation on the benefits of forests as carbon sinks

    Directory of Open Access Journals (Sweden)

    M. U. F. Kirschbaum

    2011-12-01

    Full Text Available Increased carbon storage with afforestation leads to a decrease in atmospheric carbon dioxide concentration and thus decreases radiative forcing and cools the Earth. However, afforestation also changes the reflective properties of the surface vegetation from more reflective pasture to relatively less reflective forest cover. This increase in radiation absorption by the forest constitutes an increase in radiative forcing, with a warming effect. The net effect of decreased albedo and carbon storage on radiative forcing depends on the relative magnitude of these two opposing processes.

    We used data from an intensively studied site in New Zealand's Central North Island that has long-term, ground-based measurements of albedo over the full short-wave spectrum from a developing Pinus radiata forest. Data from this site were supplemented with satellite-derived albedo estimates from New Zealand pastures. The albedo of a well-established forest was measured as 13 % and pasture albedo as 20 %. We used these data to calculate the direct radiative forcing effect of changing albedo as the forest grew.

    We calculated the radiative forcing resulting from the removal of carbon from the atmosphere as a decrease in radiative forcing of −104 GJ tC−1 yr−1. We also showed that the observed change in albedo constituted a direct radiative forcing of 2759 GJ ha−1 yr−1. Thus, following afforestation, 26.5 tC ha−1 needs to be stored in a growing forest to balance the increase in radiative forcing resulting from the observed albedo change. Measurements of tree biomass and albedo were used to estimate the net change in radiative forcing as the newly planted forest grew. Albedo and carbon-storage effects were of similar magnitude for the first four to five years after tree planting, but as the stand grew older, the carbon storage effect increasingly dominated. Averaged over the whole

  12. Surface Albedo Darkening from wildfires in Northern Sub-Saharan Africa

    Science.gov (United States)

    Gatebe, C. K.; Ichoku, C. M.; Poudal, R.; Roman, M. O.; Wilcox, E.

    2014-01-01

    Wildfires are recognized as a key physical disturbance of terrestrial ecosystems and a major source of atmospheric trace gases and aerosols. They are known to produce changes in landscape patterns and lead to changes in surface albedo that can persist for long periods. Here, we estimate the darkening of surface albedo due to wildfires in different land cover ecosystems in the Northern Sub-Saharan Africa using data from the Moderate Resolution Imaging Spectroradiometer (MODIS). We determined a decrease in albedo after fires over most land cover types (e.g. woody savannas: (-0.00352 0.00003) and savannas: (- 0.003910.00003), which together accounted for >86% of the total MODIS fire count between 2003 and 2011). Grasslands had a higher value (-0.00454 0.00003) than the savannas, but accounted for only about 5% of the total fire count. A few other land cover types (e.g. Deciduous broad leaf: (0.00062 0.00015), and barren: 0.00027 0.00019), showed an increase in albedo after fires, but accounted for less than 1% of the total fires. Albedo change due to wildfires is more important during the fire season (October-February). The albedo recovery progresses rapidly during the first year after fires, where savannas show the greatest recovery (>77%) within one year, while deciduous broadleaf, permanent wetlands and barren lands show the least one-year recovery (56%). The persistence of surface albedo darkening in most land cover types is limited to about six to seven years, after which at least 98% of the burnt pixels recover to their pre-fire albedo.

  13. Growing season carries stronger contributions to albedo dynamics on the Tibetan plateau.

    Directory of Open Access Journals (Sweden)

    Li Tian

    Full Text Available The Tibetan Plateau has experienced higher-than-global-average climate warming in recent decades, resulting in many significant changes in ecosystem structure and function. Among them is albedo, which bridges the causes and consequences of land surface processes and climate. The plateau is covered by snow/ice and vegetation in the non-growing season (nGS and growing season (GS, respectively. Based on the MODIS products, we investigated snow/ice cover and vegetation greenness in relation to the spatiotemporal changes of albedo on the Tibetan Plateau from 2000 through 2013. A synchronous relationship was found between the change in GSNDVI and GSalbedo over time and across the Tibetan landscapes. We found that the annual average albedo had a decreasing trend, but that the albedo had slightly increased during the nGS and decreased during the GS. Across the landscapes, the nGSalbedo fluctuated in a synchronous pattern with snow/ice cover. Temporally, monthly snow/ice coverage also had a high correspondence with albedo, except in April and October. We detected clear dependencies of albedo on elevation. With the rise in altitude, the nGSalbedo decreased below 4000 m, but increased for elevations of 4500-5500 m. Above 5500 m, the nGSalbedo decreased, which was in accordance with the decreased amount of snow/ice coverage and the increased soil moisture on the plateau. More importantly, the decreasing albedo in the most recent decade appeared to be caused primarily by lowered growing season albedo.

  14. Stochastic dynamics of melt ponds and sea ice-albedo climate feedback

    Science.gov (United States)

    Sudakov, Ivan

    Evolution of melt ponds on the Arctic sea surface is a complicated stochastic process. We suggest a low-order model with ice-albedo feedback which describes stochastic dynamics of melt ponds geometrical characteristics. The model is a stochastic dynamical system model of energy balance in the climate system. We describe the equilibria in this model. We conclude the transition in fractal dimension of melt ponds affects the shape of the sea ice albedo curve.

  15. Simulation and Analysis of the Topographic Effects on Snow-Free Albedo over Rugged Terrain

    Directory of Open Access Journals (Sweden)

    Dalei Hao

    2018-02-01

    Full Text Available Topography complicates the modeling and retrieval of land surface albedo due to shadow effects and the redistribution of incident radiation. Neglecting topographic effects may lead to a significant bias when estimating land surface albedo over a single slope. However, for rugged terrain, a comprehensive and systematic investigation of topographic effects on land surface albedo is currently ongoing. Accurately estimating topographic effects on land surface albedo over a rugged terrain presents a challenge in remote sensing modeling and applications. In this paper, we focused on the development of a simplified estimation method for snow-free albedo over a rugged terrain at a 1-km scale based on a 30-m fine-scale digital elevation model (DEM. The proposed method was compared with the radiosity approach based on simulated and real DEMs. The results of the comparison showed that the proposed method provided adequate computational efficiency and satisfactory accuracy simultaneously. Then, the topographic effects on snow-free albedo were quantitatively investigated and interpreted by considering the mean slope, subpixel aspect distribution, solar zenith angle, and solar azimuth angle. The results showed that the more rugged the terrain and the larger the solar illumination angle, the more intense the topographic effects were on black-sky albedo (BSA. The maximum absolute deviation (MAD and the maximum relative deviation (MRD of the BSA over a rugged terrain reached 0.28 and 85%, respectively, when the SZA was 60° for different terrains. Topographic effects varied with the mean slope, subpixel aspect distribution, SZA and SAA, which should not be neglected when modeling albedo.

  16. Calculation of double energy angle differential neutron albedos for radiation shielding applications

    International Nuclear Information System (INIS)

    Litaize, O.; Diop, C.M.; Nimal, J.C.

    2000-01-01

    Void radiation shielding problems can be dealt with albedo concept which is an alternative to the complex bringing into operation of the 'exact' transport method calculations (SN, Monte Carlo). Up to here, differential albedos are used for single reflections from walls in the NARCISSE-3 propagation albedo code developed at CEA and used for project calculations. For taking into account the neutron multiple reflections on lacunar medium walls, double energy-angle differential albedos are needed. TRIPOLI-4 neutral particle transport Monte Carlo code in three dimensional geometries, has been chosen to implement a double differential albedo calculus routine and therefore to generate albedo data for different kinds of medium. The surfacic estimator, which could be used, is not enough efficient because all neutrons do not contribute to the result. A new estimator is carried out. At each collision site, during the neutron history simulation, it allows to compute the probability of the neutron to go through the medium and to come through the reflection surface in the direction and at the energy considered. This estimator is about hundred times more efficient than the surfacic estimator. (author)

  17. Impact of Dust on Mars Surface Albedo and Energy Flux with LMD General Circulation Model

    Science.gov (United States)

    Singh, D.; Flanner, M.; Millour, E.; Martinez, G.

    2015-12-01

    Mars, just like Earth experience different seasons because of its axial tilt (about 25°). This causes growth and retreat of snow cover (primarily CO2) in Martian Polar regions. The perennial caps are the only place on the planet where condensed H2O is available at surface. On Mars, as much as 30% atmospheric CO2 deposits in each hemisphere depending upon the season. This leads to a significant variation on planet's surface albedo and hence effecting the amount of solar flux absorbed or reflected at the surface. General Circulation Model (GCM) of Laboratoire de Météorologie Dynamique (LMD) currently uses observationally derived surface albedo from Thermal Emission Spectrometer (TES) instrument for the polar caps. These TES albedo values do not have any inter-annual variability, and are independent of presence of any dust/impurity on surface. Presence of dust or other surface impurities can significantly reduce the surface albedo especially during and right after a dust storm. This change will also be evident in the surface energy flux interactions. Our work focuses on combining earth based Snow, Ice, and Aerosol Radiation (SNICAR) model with current state of GCM to incorporate the impact of dust on Martian surface albedo, and hence the energy flux. Inter-annual variability of surface albedo and planet's top of atmosphere (TOA) energy budget along with their correlation with currently available mission data will be presented.

  18. Retrieval of snow albedo and grain size using reflectance measurements in Himalayan basin

    Directory of Open Access Journals (Sweden)

    H. S. Negi

    2011-03-01

    Full Text Available In the present paper, spectral reflectance measurements of Himalayan seasonal snow were carried out and analysed to retrieve the snow albedo and effective grain size. The asymptotic radiative transfer (ART theory was applied to retrieve the plane and spherical albedo. The retrieved plane albedo was compared with the measured spectral albedo and a good agreement was observed with ±10% differences. Retrieved integrated albedo was found within ±6% difference with ground observed broadband albedo. The retrieved snow grain sizes using different models based on the ART theory were compared for various snow types and it was observed that the grain size model using two channel method (one in visible and another in NIR region can work well for the Himalayan seasonal snow and it was found consistent with temporal changes in grain size. This method can work very well for clean, dry snow as in the upper Himalaya, but sometimes, due to the low reflectances (<20% using wavelength 1.24 μm, the ART theory cannot be applied, which is common in lower and middle Himalayan old snow. This study is important for monitoring the Himalayan cryosphere using air-borne or space-borne sensors.

  19. CLARA-SAL: a global 28 yr timeseries of Earth's black-sky surface albedo

    Directory of Open Access Journals (Sweden)

    A. Riihelä

    2013-04-01

    Full Text Available We present a novel 28 yr dataset of Earth's black-sky surface albedo, derived from AVHRR instruments. The dataset is created using algorithms to separately derive the surface albedo for different land use areas globally. Snow, sea ice, open water and vegetation are all treated independently. The product features corrections for the atmospheric effect in satellite-observed surface radiances, a BRDF correction for the anisotropic reflectance properties of natural surfaces, and a novel topography correction of geolocation and radiometric accuracy of surface reflectance observations over mountainous areas. The dataset is based on a homogenized AVHRR radiance timeseries. The product is validated against quality-controlled in situ observations of clear-sky surface albedo at various BSRN sites around the world. Snow and ice albedo retrieval validation is given particular attention using BSRN sites over Antarctica, Greenland Climate Network stations on the Greenland Ice Sheet (GrIS, as well as sea ice albedo data from the SHEBA and Tara expeditions. The product quality is found to be comparable to other previous long-term surface albedo datasets from AVHRR.

  20. Forecasting Energy-Related CO2 Emissions Employing a Novel SSA-LSSVM Model: Considering Structural Factors in China

    Directory of Open Access Journals (Sweden)

    Huiru Zhao

    2018-03-01

    Full Text Available Carbon dioxide (CO2 emissions forecasting is becoming more important due to increasing climatic problems, which contributes to developing scientific climate policies and making reasonable energy plans. Considering that the influential factors of CO2 emissions are multiplex and the relationships between factors and CO2 emissions are complex and non-linear, a novel CO2 forecasting model called SSA-LSSVM, which utilizes the Salp Swarm Algorithm (SSA to optimize the two parameters of the least squares support sector machine (LSSVM model, is proposed in this paper. The influential factors of CO2 emissions, including the gross domestic product (GDP, population, energy consumption, economic structure, energy structure, urbanization rate, and energy intensity, are regarded as the input variables of the SSA-LSSVM model. The proposed model is verified to show a better forecasting performance compared with the selected models, including the single LSSVM model, the LSSVM model optimized by the particle swarm optimization algorithm (PSO-LSSVM, and the back propagation (BP neural network model, on CO2 emissions in China from 2014 to 2016. The comparative analysis indicates the SSA-LSSVM model is greatly superior and has the potential to improve the accuracy and reliability of CO2 emissions forecasting. CO2 emissions in China from 2017 to 2020 are forecast combined with the 13th Five-Year Plan for social, economic and energy development. The comparison of CO2 emissions of China in 2020 shows that structural factors significantly affect CO2 emission forecasting results. The average annual growth of CO2 emissions slows down significantly due to a series of policies and actions taken by the Chinese government, which means China can keep the promise that greenhouse gas emissions will start to drop after 2030.

  1. The Alpine snow-albedo feedback in regional climate models

    Science.gov (United States)

    Winter, Kevin J.-P. M.; Kotlarski, Sven; Scherrer, Simon C.; Schär, Christoph

    2017-02-01

    The effect of the snow-albedo feedback (SAF) on 2m temperatures and their future changes in the European Alps is investigated in the ENSEMBLES regional climate models (RCMs) with a focus on the spring season. A total of 14 re-analysis-driven RCM experiments covering the period 1961-2000 and 10 GCM-driven transient climate change projections for 1950-2099 are analysed. A positive springtime SAF is found in all RCMs, but the range of the diagnosed SAF is large. Results are compared against an observation-based SAF estimate. For some RCMs, values very close to this estimate are found; other models show a considerable overestimation of the SAF. Net shortwave radiation has the largest influence of all components of the energy balance on the diagnosed SAF and can partly explain its spatial variability. Model deficiencies in reproducing 2m temperatures above snow and ice and associated cold temperature biases at high elevations seem to contribute to a SAF overestimation in several RCMs. The diagnosed SAF in the observational period strongly influences the estimated SAF contribution to twenty first century temperature changes in the European Alps. This contribution is subject to a clear elevation dependency that is governed by the elevation-dependent change in the number of snow days. Elevations of maximum SAF contribution range from 1500 to 2000 m in spring and are found above 2000 m in summer. Here, a SAF contribution to the total simulated temperature change between 0 and 0.5 °C until 2099 (multi-model mean in spring: 0.26 °C) or 0 and 14 % (multi-model mean in spring: 8 %) is obtained for models showing a realistic SAF. These numbers represent a well-funded but only approximate estimate of the SAF contribution to future warming, and a remaining contribution of model-specific SAF misrepresentations cannot be ruled out.

  2. Kinetic and isotherm studies of bisphenol A adsorption onto orange albedo(Citrus sinensis): Sorption mechanisms based on the main albedo components vitamin C, flavones glycosides and carotenoids.

    Science.gov (United States)

    Kamgaing, Theophile; Doungmo, Giscard; Melataguia Tchieno, Francis Merlin; Gouoko Kouonang, Jimmy Julio; Mbadcam, Ketcha Joseph

    2017-07-03

    Orange albedo and its adsorption capacity towards bisphenol A (BPA) were studied. Adsorption experiments were conducted in batch mode at 25-55°C. Scanning electron microscopy (SEM), Energy dispersive X-ray spectroscopy (EDX), X-ray diffraction (XRD), Brunauer-Emmett-Teller (BET) and Fourier transform infrared (FTIR) spectroscopy were used to characterise the biosorbent. The effects of various parameters including adsorption time, equilibrium pH, adsorbent dosage and initial adsorbate concentration were investigated. The optimum contact time and pH for the removal of BPA were 60 min and 2, respectively. It was found that the adsorption isotherms best matched the Freundlich model, the adsorption of BPA being multilayer and that of the albedo surface heterogeneous. From the kinetic studies, it was found that the removal of BPA best matched the pseudo-second order kinetic model. An adsorption mechanism based on the albedo surface molecules is proposed and gives a good account of π-π interactions and hydrogen bonding. Orange albedo, with a maximum BPA loading capacity of 82.36 mg g -1 (significantly higher than that of most agricultural residues), is a good candidate for BPA adsorption in aqueous media.

  3. Human Ro60 (SSA2) genomic organization and sequence alterations, examined in cutaneous lupus erythematosus.

    Science.gov (United States)

    Millard, T P; Ashton, G H S; Kondeatis, E; Vaughan, R W; Hughes, G R V; Khamashta, M A; Hawk, J L M; McGregor, J M; McGrath, J A

    2002-02-01

    The Ro 60 kDa protein (Ro60 or SSA2) is the major component of the Ro ribonucleoprotein (Ro RNP) complex, to which an immune response is a specific feature of several autoimmune diseases. The genomic organization and any sequence variation within the DNA encoding Ro60 are unknown. To characterize the Ro60 gene structure and to assess whether any sequence alterations might be associated with serum anti-Ro antibody in subacute cutaneous lupus erythematosus (SCLE), thus potentially providing new insight into disease pathogenesis. The cDNA sequence for Ro60 was obtained from the NCBI database and used for a BLAST search for a clone containing the entire genomic sequence. The intron-exon borders were confirmed by designing intronic primer pairs to flank each exon, which were then used to amplify genomic DNA for automated sequencing from 36 caucasian patients with SCLE (anti-Ro positive) and 49 with discoid LE (DLE, anti-Ro negative), in addition to 36 healthy caucasian controls. Heteroduplex analysis of polymerase chain reaction (PCR) products from patients and controls spanning all Ro60 exons (1-8) revealed a common bandshift in the PCR products spanning exon 7. Sequencing of the corresponding PCR products demonstrated an A > G substitution at nucleotide position 1318-7, within the consensus acceptor splice site of exon 7 (GenBank XM001901). The allele frequencies were major allele A (0.71) and minor allele G (0.29) in 72 control chromosomes, with no significant differences found between SCLE patients, DLE patients and controls. The genomic organization of the DNA encoding the Ro60 protein is described, including a common polymorphism within the consensus acceptor splice site of exon 7. Our delineation of a strategy for the genomic amplification of Ro60 forms a basis for further examination of the pathological functions of the Ro RNP in autoimmune disease.

  4. Pectins from the albedo of immature lemon fruitlets have high water binding capacity.

    Science.gov (United States)

    Schröder, Roswitha; Clark, Christopher J; Sharrock, Keith; Hallett, Ian C; MacRae, Elspeth A

    2004-04-01

    The white part of citrus peel, the albedo, has a special role in water relations of both fruit and leaves from early on in fruit development. In times of drought, this tissue acts as a water reservoir for juice sacs, seeds and leaves. When water was injected into the albedo, free water was undetectable using magnetic resonance imaging. Microscopy showed tightly packed cells with little intercellular space, and thick cell walls. Cell wall material comprised 21% of the fresh albedo weight, and contained 26.1% galacturonic acid, the main constituent of pectin. From this, we postulated that pectin of the cell wall was responsible for the high water-binding capacity of the immature lemon albedo. Cell wall material was extracted using mild procedures that keep polymers intact, and four pectic fractions were recovered. Of these fractions, the SDS and chelator-soluble fractions showed viscosities ten and twenty times higher than laboratory-grade citrus pectin or the other albedo-derived pectins. The yield of these two pectins represented 28% of the cell walls and 62% of the galacturonic acid content of immature lemon albedo. We concluded that, from viscosity and abundance, these types of pectin account for the high water-binding capacity of this tissue. Compositional analyses showed that the two highly viscous pectic fractions differ in galacturonic acid content, degree of branching and length of side chains from the less viscous albedo-derived pectins. The most striking feature of these highly viscous pectins, however, was their high molecular weight distribution compared to the other pectic fractions.

  5. Spatiotemporal variation of surface shortwave forcing from fire-induced albedo change in interior Alaska

    Science.gov (United States)

    Huang, Shengli; Dahal, Devendra; Liu, Heping; Jin, Suming; Young, Claudia J.; Liu, Shuang; Liu, Shu-Guang

    2015-01-01

    The albedo change caused by both fires and subsequent succession is spatially heterogeneous, leading to the need to assess the spatiotemporal variation of surface shortwave forcing (SSF) as a component to quantify the climate impacts of high-latitude fires. We used an image reconstruction approach to compare postfire albedo with the albedo assuming fires had not occurred. Combining the fire-caused albedo change from the 2001-2010 fires in interior Alaska and the monthly surface incoming solar radiation, we examined the spatiotemporal variation of SSF in the early successional stage of around 10 years. Our results showed that while postfire albedo generally increased in fall, winter, and spring, some burned areas could show an albedo decrease during these seasons. In summer, the albedo increased for several years and then declined again. The spring SSF distribution did not show a latitudinal decrease from south to north as previously reported. The results also indicated that although the SSF is usually largely negative in the early successional years, it may not be significant during the first postfire year. The annual 2005-2010 SSF for the 2004 fire scars was -1.30, -4.40, -3.31, -4.00, -3.42, and -2.47 Wm-2. The integrated annual SSF map showed significant spatial variation with a mean of -3.15 Wm-2 and a standard deviation of 3.26 Wm-2, 16% of burned areas having positive SSF. Our results suggest that boreal deciduous fires would be less positive for climate change than boreal evergreen fires. Future research is needed to comprehensively investigate the spatiotemporal radiative and non-radiative forcings to determine the effect of boreal fires on climate.

  6. Radiative forcing and temperature response to changes in urban albedos and associated CO2 offsets

    International Nuclear Information System (INIS)

    Menon, Surabi; Akbari, Hashem; Sednev, Igor; Levinson, Ronnen; Mahanama, Sarith

    2010-01-01

    The two main forcings that can counteract to some extent the positive forcings from greenhouse gases from pre-industrial times to present day are the aerosol and related aerosol-cloud forcings, and the radiative response to changes in surface albedo. Here, we quantify the change in radiative forcing and land surface temperature that may be obtained by increasing the albedos of roofs and pavements in urban areas in temperate and tropical regions of the globe by 0.1. Using the catchment land surface model (the land model coupled to the GEOS-5 Atmospheric General Circulation Model), we quantify the change in the total outgoing (outgoing shortwave+longwave) radiation and land surface temperature to a 0.1 increase in urban albedos for all global land areas. The global average increase in the total outgoing radiation was 0.5 W m -2 , and temperature decreased by ∼0.008 K for an average 0.003 increase in surface albedo. These averages represent all global land areas where data were available from the land surface model used and are for the boreal summer (June-July-August). For the continental US the total outgoing radiation increased by 2.3 W m -2 , and land surface temperature decreased by ∼0.03 K for an average 0.01 increase in surface albedo. Based on these forcings, the expected emitted CO 2 offset for a plausible 0.25 and 0.15 increase in albedos of roofs and pavements, respectively, for all global urban areas, was found to be ∼57 Gt CO 2 . A more meaningful evaluation of the impacts of urban albedo increases on global climate and the expected CO 2 offsets would require simulations which better characterize urban surfaces and represent the full annual cycle.

  7. Global warming and climate forcing by recent albedo changes on Mars

    Science.gov (United States)

    Fenton, L.K.; Geissler, P.E.; Haberle, R.M.

    2007-01-01

    For hundreds of years, scientists have tracked the changing appearance of Mars, first by hand drawings and later by photographs. Because of this historical record, many classical albedo patterns have long been known to shift in appearance over time. Decadal variations of the martian surface albedo are generally attributed to removal and deposition of small amounts of relatively bright dust on the surface. Large swaths of the surface (up to 56 million km2) have been observed to darken or brighten by 10 per cent or more. It is unknown, however, how these albedo changes affect wind circulation, dust transport and the feedback between these processes and the martian climate. Here we present predictions from a Mars general circulation model, indicating that the observed interannual albedo alterations strongly influence the martian environment. Results indicate enhanced wind stress in recently darkened areas and decreased wind stress in brightened areas, producing a positive feedback system in which the albedo changes strengthen the winds that generate the changes. The simulations also predict a net annual global warming of surface air temperatures by ???0.65 K, enhancing dust lifting by increasing the likelihood of dust devil generation. The increase in global dust lifting by both wind stress and dust devils may affect the mechanisms that trigger large dust storm initiation, a poorly understood phenomenon, unique to Mars. In addition, predicted increases in summertime air temperatures at high southern latitudes would contribute to the rapid and steady scarp retreat that has been observed in the south polar residual ice for the past four Mars years. Our results suggest that documented albedo changes affect recent climate change and large-scale weather patterns on Mars, and thus albedo variations are a necessary component of future atmospheric and climate studies. ??2007 Nature Publishing Group.

  8. Sea ice roughness: the key for predicting Arctic summer ice albedo

    Science.gov (United States)

    Landy, J.; Ehn, J. K.; Tsamados, M.; Stroeve, J.; Barber, D. G.

    2017-12-01

    Although melt ponds on Arctic sea ice evolve in stages, ice with smoother surface topography typically allows the pond water to spread over a wider area, reducing the ice-albedo and accelerating further melt. Building on this theory, we simulated the distribution of meltwater on a range of statistically-derived topographies to develop a quantitative relationship between premelt sea ice surface roughness and summer ice albedo. Our method, previously applied to ICESat observations of the end-of-winter sea ice roughness, could account for 85% of the variance in AVHRR observations of the summer ice-albedo [Landy et al., 2015]. Consequently, an Arctic-wide reduction in sea ice roughness over the ICESat operational period (from 2003 to 2008) explained a drop in ice-albedo that resulted in a 16% increase in solar heat input to the sea ice cover. Here we will review this work and present new research linking pre-melt sea ice surface roughness observations from Cryosat-2 to summer sea ice albedo over the past six years, examining the potential of winter roughness as a significant new source of sea ice predictability. We will further evaluate the possibility for high-resolution (kilometre-scale) forecasts of summer sea ice albedo from waveform-level Cryosat-2 roughness data in the landfast sea ice zone of the Canadian Arctic. Landy, J. C., J. K. Ehn, and D. G. Barber (2015), Albedo feedback enhanced by smoother Arctic sea ice, Geophys. Res. Lett., 42, 10,714-10,720, doi:10.1002/2015GL066712.

  9. Criticality analysis of thermal reactors for two energy groups applying Monte Carlo and neutron Albedo method

    International Nuclear Information System (INIS)

    Terra, Andre Miguel Barge Pontes Torres

    2005-01-01

    The Albedo method applied to criticality calculations to nuclear reactors is characterized by following the neutron currents, allowing to make detailed analyses of the physics phenomena about interactions of the neutrons with the core-reflector set, by the determination of the probabilities of reflection, absorption, and transmission. Then, allowing to make detailed appreciations of the variation of the effective neutron multiplication factor, keff. In the present work, motivated for excellent results presented in dissertations applied to thermal reactors and shieldings, was described the methodology to Albedo method for the analysis criticality of thermal reactors by using two energy groups admitting variable core coefficients to each re-entrant current. By using the Monte Carlo KENO IV code was analyzed relation between the total fraction of neutrons absorbed in the core reactor and the fraction of neutrons that never have stayed into the reflector but were absorbed into the core. As parameters of comparison and analysis of the results obtained by the Albedo method were used one dimensional deterministic code ANISN (ANIsotropic SN transport code) and Diffusion method. The keff results determined by the Albedo method, to the type of analyzed reactor, showed excellent agreement. Thus were obtained relative errors of keff values smaller than 0,78% between the Albedo method and code ANISN. In relation to the Diffusion method were obtained errors smaller than 0,35%, showing the effectiveness of the Albedo method applied to criticality analysis. The easiness of application, simplicity and clarity of the Albedo method constitute a valuable instrument to neutronic calculations applied to nonmultiplying and multiplying media. (author)

  10. The MODIS (Collection V005) BRDF/albedo product: Assessment of spatial representativeness over forested landscapes

    Energy Technology Data Exchange (ETDEWEB)

    Roman, Miguel O. [NASA Goddard Space Flight Center; Schaaf, Crystal [Boston University; Woodcock, Curtis E. [Boston University; Strahler, Alan [Boston University; Yang, Xiaoyuan [Boston University; Braswell, Rob H. [Complex Systems Research Center, Durham, NH; Curtis, Peter [Ohio State University, The, Columbus; Davis, Kenneth J. [Pennsylvania State University; Dragoni, Danilo [Indiana University; Goulden, Michael L. [University of California, Irvine; Gu, Lianhong [ORNL; Hollinger, David Y [ORNL; Meyers, Tilden P. [NOAA, Oak Ridge, TN; Wilson, Tim B. [NOAA; Munger, J. William [Harvard University; Wofsy, Steve [Harvard University; Privette, Jeffrey L. [NOAA; Richardson, Andrew D. [Harvard University

    2009-11-01

    A new methodology for establishing the spatial representativeness of tower albedo measurements that are routinely used in validation of satellite retrievals from global land surface albedo and reflectance anisotropy products is presented. This method brings together knowledge of the intrinsic biophysical properties of a measurement site, and the surrounding landscape to produce a number of geostatistical attributes that describe the overall variability, spatial extent, strength of the spatial correlation, and spatial structure of surface albedo patterns at separate seasonal periods throughout the year. Variogram functions extracted from Enhanced Thematic Mapper Plus (ETM+) retrievals of surface albedo using multiple spatial and temporal thresholds were used to assess the degree to which a given point (tower) measurement is able to capture the intrinsic variability of the immediate landscape extending to a satellite pixel. A validation scheme was implemented over a wide range of forested landscapes, looking at both deciduous and coniferous sites, from tropical to boreal ecosystems. The experiment focused on comparisons between tower measurements of surface albedo acquired at local solar noon and matching retrievals from the MODerate Resolution Imaging Spectroradiometer (MODIS) (Collection V005) Bidirectional Reflectance Distribution Function (BRDF)/albedo algorithm. Assessments over a select group of field stations with comparable landscape features and daily retrieval scenarios further demonstrate the ability of this technique to identify measurement sites that contain the intrinsic spatial and seasonal features of surface albedo over sufficiently large enough footprints for use in modeling and remote sensing studies. This approach, therefore, improves our understanding of product uncertainty both in terms of the representativeness of the field data and its relationship to the larger satellite pixel.

  11. The SSB-positive/SSA-negative antibody profile is not associated with key phenotypic features of Sjögren's syndrome

    DEFF Research Database (Denmark)

    Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C

    2015-01-01

    phenotypic features. Among SICCA participants classified with SS on the basis of the American-European Consensus Group or American College of Rheumatology criteria, only 2% required the anti-SSB-alone test result to meet these criteria. CONCLUSIONS: The presence of anti-SSB, without anti-SSA antibodies, had...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than...... in those with anti-SSB alone or negative SSA/SSB serology. These between-group differences were highly significant and not explained by confounding by age, race/ethnicity or gender. Participants with anti-SSB alone were comparable to those with negative SSA/SSB serology in their association with these key...

  12. Use of exact albedo conditions in numerical methods for one-dimensional one-speed discrete ordinates eigenvalue problems

    International Nuclear Information System (INIS)

    Abreu, M.P. de

    1994-01-01

    The use of exact albedo boundary conditions in numerical methods applied to one-dimensional one-speed discrete ordinates (S n ) eigenvalue problems for nuclear reactor global calculations is described. An albedo operator that treats the reflector region around a nuclear reactor core implicitly is described and exactly was derived. To illustrate the method's efficiency and accuracy, it was used conventional linear diamond method with the albedo option to solve typical model problems. (author)

  13. Combining NLCD and MODIS to create a land cover-albedo database for the continental United States

    Science.gov (United States)

    Wickham, J.; Barnes, Christopher A.; Nash, M.S.; Wade, T.G.

    2015-01-01

    Land surface albedo is an essential climate variable that is tightly linked to land cover, such that specific land cover classes (e.g., deciduous broadleaf forest, cropland) have characteristic albedos. Despite the normative of land-cover class specific albedos, there is considerable variability in albedo within a land cover class. The National Land Cover Database (NLCD) and the Moderate Resolution Imaging Spectroradiometer (MODIS) albedo product were combined to produce a long-term (14 years) integrated land cover-albedo database for the continental United States that can be used to examine the temporal behavior of albedo as a function of land cover. The integration identifies areas of homogeneous land cover at the nominal spatial resolution of the MODIS (MCD43A) albedo product (500 m × 500 m) from the NLCD product (30 m × 30 m), and provides an albedo data record per 500 m × 500 m pixel for 14 of the 16 NLCD land cover classes. Individual homogeneous land cover pixels have up to 605 albedo observations, and 75% of the pixels have at least 319 MODIS albedo observations (≥ 50% of the maximum possible number of observations) for the study period (2000–2013). We demonstrated the utility of the database by conducting a multivariate analysis of variance of albedo for each NLCD land cover class, showing that locational (pixel-to-pixel) and inter-annual variability were significant factors in addition to expected seasonal (intra-annual) and geographic (latitudinal) effects.

  14. Development of a high spectral resolution surface albedo product for the ARM Southern Great Plains central facility

    Directory of Open Access Journals (Sweden)

    J. Delamere

    2011-09-01

    Full Text Available We present a method for identifying dominant surface type and estimating high spectral resolution surface albedo at the Atmospheric Radiation Measurement (ARM facility at the Southern Great Plains (SGP site in Oklahoma for use in radiative transfer calculations. Given a set of 6-channel narrowband visible and near-infrared irradiance measurements from upward and downward looking multi-filter radiometers (MFRs, four different surface types (snow-covered, green vegetation, partial vegetation, non-vegetated can be identified. A normalized difference vegetation index (NDVI is used to distinguish between vegetated and non-vegetated surfaces, and a scaled NDVI index is used to estimate the percentage of green vegetation in partially vegetated surfaces. Based on libraries of spectral albedo measurements, a piecewise continuous function is developed to estimate the high spectral resolution surface albedo for each surface type given the MFR albedo values as input. For partially vegetated surfaces, the albedo is estimated as a linear combination of the green vegetation and non-vegetated surface albedo values. The estimated albedo values are evaluated through comparison to high spectral resolution albedo measurements taken during several Intensive Observational Periods (IOPs and through comparison of the integrated spectral albedo values to observed broadband albedo measurements. The estimated spectral albedo values agree well with observations for the visible wavelengths constrained by the MFR measurements, but have larger biases and variability at longer wavelengths. Additional MFR channels at 1100 nm and/or 1600 nm would help constrain the high resolution spectral albedo in the near infrared region.

  15. Change in Urban Albedo in London: A Multi-scale Perspective

    Science.gov (United States)

    Susca, T.; Kotthaus, S.; Grimmond, S.

    2013-12-01

    Urbanization-induced change in land use has considerable implications for climate, air quality, resources and ecosystems. Urban-induced warming is one of the most well-known impacts. This directly and indirectly can extend beyond the city. One way to reduce the size of this is to modify the surface atmosphere exchanges through changing the urban albedo. As increased rugosity caused by the morphology of a city results in lower albedo with constant material characteristics, the impacts of changing the albedo has impacts across a range of scales. Here a multi-scale assessment of the potential effects of the increase in albedo in London is presented. This includes modeling at the global and meso-scale informed by local and micro-scale measurements. In this study the first order calculations are conducted for the impact of changing the albedo (e.g. a 0.01 increase) on the radiative exchange. For example, when incoming solar radiation and cloud cover are considered, based on data retrieved from NASA (http://power.larc.nasa.gov/) for ~1600 km2 area of London, would produce a mean decrease in the instantaneous solar radiative forcing on the same surface of 0.40 W m-2. The nature of the surface is critical in terms of considering the impact of changes in albedo. For example, in the Central Activity Zone in London pavement and building can vary from 10 to 100% of the plan area. From observations the albedo is seen to change dramatically with changes in building materials. For example, glass surfaces which are being used increasingly in the central business district results in dramatic changes in albedo. Using the documented albedo variations determined across different scales the impacts are considered. For example, the effect of the increase in urban albedo is translated into the corresponding amount of avoided emission of carbon dioxide that produces the same effect on climate. At local scale, the effect that the increase in urban albedo can potentially have on local

  16. Albedo control as an effective strategy to tackle Global Warming: A case study

    International Nuclear Information System (INIS)

    Cotana, Franco; Rossi, Federico; Filipponi, Mirko; Coccia, Valentina; Pisello, Anna Laura; Bonamente, Emanuele; Petrozzi, Alessandro; Cavalaglio, Gianluca

    2014-01-01

    Highlights: • We modeled the energy exchanges for the system Earth–Atmosphere–Outer space. • We proposed a method quantifying the CO 2eq offset potential of high-albedo surfaces. • We presented the application of the method to a case study in Tunis. • The CO 2eq offsetting potential depends on the geometry-orientation of the surfaces. • An economic value was attributed to the Albedo control compensation mechanism. - Abstract: Recent research developments focused on Climate Change issue aimed at achieving Kyoto targets. In this context, an innovative methodology (officially recognized by WEC in 2009) is proposed to mitigate Global Warming by artificially enhancing earth’s Albedo. Such a methodology allows to quantify the maximum environmental benefit achievable through the installation of Albedo control technologies, as a function of the geographical features of the installation site, local meteorological conditions, radiative properties, tilt angle, and orientation of the surfaces. This benefit is directly quantified in terms of CO 2eq offset. Albedo control can be an effective mitigation strategy by means of three synergistic effects: a direct contribution towards Global Warming mitigation produced by an enhanced reflection to the space of the shortwave incident radiation; the indirect contribution from energy saving in buildings with high Albedo envelopes; the indirect contribution from the mitigation of Urban Heat Island phenomenon. Since the effectiveness of Albedo control is mostly relevant in Mediterranean area, for both climate conditions and historical-architectural heritage, this work presents procedures and findings of the ABCD project (Albedo, Building green, Control of Global Warming and Desertification) concluded in 2012, funded by the Italian Ministry for the Environment. A description of the analytic model is also presented. The paper focuses on the application of the methodology to a Tunisian factory site, showing that approximately

  17. Field calibration of a TLD albedo dosemeter in the high-energy neutron field of CERF

    International Nuclear Information System (INIS)

    Haninger, T.; Kleinau, P.; Haninger, S.

    2017-01-01

    The new albedo dosemeter-type AWST-TL-GD 04 has been calibrated in the CERF neutron field (CERN-EU high-energy Reference Field). This type of albedo dosemeter is based on thermoluminescent detectors (TLDs) and used by the individual monitoring service of the Helmholtz Zentrum Muenchen (AWST) since 2015 for monitoring persons, who are exposed occupationally against photon and neutron radiation. The motivation for this experiment was to gain a field specific neutron correction factor N n for workplaces at high-energy particle accelerators. N n is a dimensionless factor relative to a basic detector calibration with 137 Cs and is used to calculate the personal neutron dose in terms of H p (10) from the neutron albedo signal. The results show that the sensitivity of the albedo dosemeter for this specific neutron field is not significantly lower as for fast neutrons of a radionuclide source like 252 Cf. The neutron correction factor varies between 0.73 and 1.16 with a midrange value of 0.94. The albedo dosemeter is therefore appropriate to monitor persons, which are exposed at high-energy particle accelerators. (authors)

  18. Splash albedo protons between 4 and 315 MeV at high and low geomagnetic latitudes

    International Nuclear Information System (INIS)

    Wenzel, K.; Stone, E.C.; Vogt, R.E.

    1975-01-01

    The differential energy spectrum of splash albedo protons has been measured at high geomagnetic latitude near Fort Churchill, Manitoba, at three periods of the solar cycle in 1966, and 1969 and at low latitude near Palestine, Texas, in 1967 by using a balloon-borne solid state detector telescope. We observed splash albedo proton fluxes between 4 and 315 MeV of 81plus-or-minus11, 70plus-or-minus11, and 48plus-or-minus8 protons/(m 2 s sr) at high latitude in 1966, 1967, and 1969 and of 37plus-or-minus9 protons/(m 2 s sr) at low latitude in 1967. The decreases from 1966 to 1969 are due to solar modulation of the cosmic ray parent nuclei. The albedo spectrum shows a similar shape for both latitudes. The difference in intensity can be explained by different local geomagnetic cutoffs; i.e., a significant contribution to the splash albedo flux arises from primary particles with rigidity below 4.5 GV. The splash albedo flux near Fort Churchill is consistent with corresponding fluxes previously reported near 53degree--55degreeN. The flux below 100 MeV near Palestine is significantly lower than that reported by Verma (1967)

  19. Intercomparison of MODIS Albedo Retrievals and In Situ Measurements Across the Global FLUXNET Network

    Science.gov (United States)

    Cescatti, Alessandro; Marcolla, Barbara; Vannan, Suresh K. Santhana; Pan, Jerry Yun; Roman, Miguel O.; Yang, Xiaoyuan; Ciais, Philippe; Cook, Robert B.; Law, Beverly E.; Matteucci, Girogio; hide

    2012-01-01

    Surface albedo is a key parameter in the Earth's energy balance since it affects the amount of solar radiation directly absorbed at the planet surface. Its variability in time and space can be globally retrieved through the use of remote sensing products. To evaluate and improve the quality of satellite retrievals, careful intercomparisons with in situ measurements of surface albedo are crucial. For this purpose we compared MODIS albedo retrievals with surface measurements taken at 53 FLUXNET sites that met strict conditions of land cover homogeneity. A good agreement between mean yearly values of satellite retrievals and in situ measurements was found (R(exp 2)= 0.82). The mismatch is correlated to the spatial heterogeneity of surface albedo, stressing the relevance of land cover homogeneity when comparing point to pixel data. When the seasonal patterns of MODIS albedo is considered for different plant functional types, the match with surface observation is extremely good at all forest sites. On the contrary, in non-forest sites satellite retrievals underestimate in situ measurements across the seasonal cycle. The mismatch observed at grasslands and croplands sites is likely due to the extreme fragmentation of these landscapes, as confirmed by geostatistical attributes derived from high resolution scenes.

  20. Albedo and estimates of net radiation for green beans under polyethylene cover and field conditions

    International Nuclear Information System (INIS)

    Souza, J.L. de; Escobedo, J.F.; Tornero, M.T.T.

    1999-01-01

    This paper describes the albedo (r) and estimates of net radiation and global solar irradiance for green beans crop (Phaseolus vulgaris L.), cultivated in greenhouse with cover of polyethylene and field conditions, in Botucatu, SP, Brazil (22° 54' S; 48° 27' W; 850 m). The solar global irradiance (R g ) and solar reflected radiation (R r ) were used to estimate the albedo through the ratio between R r and R g . The diurnal curves of albedo were obtained for days with clear sky and partially cloudy conditions, for different phenological stages of the crop. The albedo ranged with the solar elevation, the environment and the phenological stages. The cloudiness range have almost no influence on the albedo diurnal amount. The estimation of radiation were made by linear regression, using the global solar irradiance (R g ) and net short-waves radiation (R c ) as independent variables. All estimates of radiation showed better adjustment for specific phenological periods compared to the entire crop growing cycle. The net radiation in the greenhouse has been estimated by the global solar irradiance measured at field conditions. (author) [pt

  1. Observational determination of albedo decrease caused by vanishing Arctic sea ice.

    Science.gov (United States)

    Pistone, Kristina; Eisenman, Ian; Ramanathan, V

    2014-03-04

    The decline of Arctic sea ice has been documented in over 30 y of satellite passive microwave observations. The resulting darkening of the Arctic and its amplification of global warming was hypothesized almost 50 y ago but has yet to be verified with direct observations. This study uses satellite radiation budget measurements along with satellite microwave sea ice data to document the Arctic-wide decrease in planetary albedo and its amplifying effect on the warming. The analysis reveals a striking relationship between planetary albedo and sea ice cover, quantities inferred from two independent satellite instruments. We find that the Arctic planetary albedo has decreased from 0.52 to 0.48 between 1979 and 2011, corresponding to an additional 6.4 ± 0.9 W/m(2) of solar energy input into the Arctic Ocean region since 1979. Averaged over the globe, this albedo decrease corresponds to a forcing that is 25% as large as that due to the change in CO2 during this period, considerably larger than expectations from models and other less direct recent estimates. Changes in cloudiness appear to play a negligible role in observed Arctic darkening, thus reducing the possibility of Arctic cloud albedo feedbacks mitigating future Arctic warming.

  2. Evaluation of the MODIS Albedo Product over a Heterogeneous Agricultural Area

    Science.gov (United States)

    Sobrino, Jose Antonio; Franch, B.; Oltra-Carrio, R.; Vermote, E. F.; Fedele, E.

    2013-01-01

    In this article, the Moderate Resolution Imaging Spectroradiometer (MODIS) Bidirectional Reflectance Distribution Function (BRDF)/Albedo product (MCD43) is evaluated over a heterogeneous agricultural area in the framework of the Earth Observation: Optical Data Calibration and Information Extraction (EODIX) project campaign, which was developed in Barrax (Spain) in June 2011. In this method, two models, the RossThick-LiSparse-Reciprocal (RTLSR) (which corresponds to the MODIS BRDF algorithm) and the RossThick-Maignan-LiSparse-Reciprocal (RTLSR-HS), were tested over airborne data by processing high-resolution images acquired with the Airborne Hyperspectral Scanner (AHS) sensor. During the campaign, airborne images were retrieved with different view zenith angles along the principal and orthogonal planes. Comparing the results of applying the models to the airborne data with ground measurements, we obtained a root mean square error (RMSE) of 0.018 with both RTLSR and RTLSR-HS models. The evaluation of the MODIS BRDF/Albedo product (MCD43) was performed by comparing satellite images with AHS estimations. The results reported an RMSE of 0.04 with both models. Additionally, taking advantage of a homogeneous barley pixel, we compared in situ albedo data to satellite albedo data. In this case, the MODIS albedo estimation was (0.210 +/- 0.003), while the in situ measurement was (0.204 +/- 0.003). This result shows good agreement in regard to a homogeneous pixel.

  3. Albedo Neutron Dosimetry in a Deep Geological Disposal Repository for High-Level Nuclear Waste.

    Science.gov (United States)

    Pang, Bo; Becker, Frank

    2017-04-28

    Albedo neutron dosemeter is the German official personal neutron dosemeter in mixed radiation fields where neutrons contribute to personal dose. In deep geological repositories for high-level nuclear waste, where neutrons can dominate the radiation field, it is of interest to investigate the performance of albedo neutron dosemeter in such facilities. In this study, the deep geological repository is represented by a shielding cask loaded with spent nuclear fuel placed inside a rock salt emplacement drift. Due to the backscattering of neutrons in the drift, issues concerning calibration of the dosemeter arise. Field-specific calibration of the albedo neutron dosemeter was hence performed with Monte Carlo simulations. In order to assess the applicability of the albedo neutron dosemeter in a deep geological repository over a long time scale, spent nuclear fuel with different ages of 50, 100 and 500 years were investigated. It was found out, that the neutron radiation field in a deep geological repository can be assigned to the application area 'N1' of the albedo neutron dosemeter, which is typical in reactors and accelerators with heavy shielding. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  4. Mapping Global Ocean Surface Albedo from Satellite Observations: Models, Algorithms, and Datasets

    Science.gov (United States)

    Li, X.; Fan, X.; Yan, H.; Li, A.; Wang, M.; Qu, Y.

    2018-04-01

    Ocean surface albedo (OSA) is one of the important parameters in surface radiation budget (SRB). It is usually considered as a controlling factor of the heat exchange among the atmosphere and ocean. The temporal and spatial dynamics of OSA determine the energy absorption of upper level ocean water, and have influences on the oceanic currents, atmospheric circulations, and transportation of material and energy of hydrosphere. Therefore, various parameterizations and models have been developed for describing the dynamics of OSA. However, it has been demonstrated that the currently available OSA datasets cannot full fill the requirement of global climate change studies. In this study, we present a literature review on mapping global OSA from satellite observations. The models (parameterizations, the coupled ocean-atmosphere radiative transfer (COART), and the three component ocean water albedo (TCOWA)), algorithms (the estimation method based on reanalysis data, and the direct-estimation algorithm), and datasets (the cloud, albedo and radiation (CLARA) surface albedo product, dataset derived by the TCOWA model, and the global land surface satellite (GLASS) phase-2 surface broadband albedo product) of OSA have been discussed, separately.

  5. Strength of forest-albedo feedback in mid-Holocene climate simulations

    Directory of Open Access Journals (Sweden)

    J. Otto

    2011-09-01

    Full Text Available Reconstructions of the mid-Holocene climate, 6000 years before present, suggest that spring temperatures were higher at high northern latitudes compared to the pre-industrial period. A positive feedback between expansion of forest and climate presumably contributed to this warming. In the presence of snow, forests have a lower albedo than grass land. Therefore, the expansion of forest likely favoured a warming in spring, counteracting the lower insolation at the mid-Holocene.

    We investigate the sensitivity of the vegetation-atmosphere interaction under mid-Holocene orbital forcing with respect to the strength of the forest-albedo feedback by using a comprehensive coupled atmosphere-vegetation model (ECHAM5/JSBACH. We perform two sets of model simulations: a first set of simulations with a relatively weak reduction of albedo of snow by forest; and a second set of simulations with a relatively strong reduction of the albedo of snow by forest.

    We show that the parameterisation of the albedo of snow leads to uncertainties in the temperature signal. Compared to the set with weak snow masking, the simulations with strong snow masking reveal a spring warming that is three times higher, by 0.34 °C north of 60° N. This warming is related to a forest expansion of only 13%.

  6. Impact of Grain Shape and Multiple Black Carbon Internal Mixing on Snow Albedo: Parameterization and Radiative Effect Analysis

    Science.gov (United States)

    He, Cenlin; Liou, Kuo-Nan; Takano, Yoshi; Yang, Ping; Qi, Ling; Chen, Fei

    2018-01-01

    We quantify the effects of grain shape and multiple black carbon (BC)-snow internal mixing on snow albedo by explicitly resolving shape and mixing structures. Nonspherical snow grains tend to have higher albedos than spheres with the same effective sizes, while the albedo difference due to shape effects increases with grain size, with up to 0.013 and 0.055 for effective radii of 1,000 μm at visible and near-infrared bands, respectively. BC-snow internal mixing reduces snow albedo at wavelengths external mixing, internal mixing enhances snow albedo reduction by a factor of 1.2-2.0 at visible wavelengths depending on BC concentration and snow shape. The opposite effects on albedo reductions due to snow grain nonsphericity and BC-snow internal mixing point toward a careful investigation of these two factors simultaneously in climate modeling. We further develop parameterizations for snow albedo and its reduction by accounting for grain shape and BC-snow internal/external mixing. Combining the parameterizations with BC-in-snow measurements in China, North America, and the Arctic, we estimate that nonspherical snow grains reduce BC-induced albedo radiative effects by up to 50% compared with spherical grains. Moreover, BC-snow internal mixing enhances the albedo effects by up to 30% (130%) for spherical (nonspherical) grains relative to external mixing. The overall uncertainty induced by snow shape and BC-snow mixing state is about 21-32%.

  7. The role of phantom parameters on the response of the AEOI Neutriran Albedo Neutron Personnel Dosemeter

    International Nuclear Information System (INIS)

    Sohrabi, M.; Katouzi, M.

    1992-01-01

    The response of the AEOI Neutriran Albedo Neutron Personnel Dosemeter (NANPD) which can also be used for other albedo dosemeter types was determined on 18 different phantom configurations. The effects of type, geometry, material, thickness, dosemeter-to-phantom angle in particular with the presence of legs were investigated using a Pu-Be neutron source. It was concluded that the slab phantoms (single or double) and circular and elliptical cylinder phantoms seemed to provide a better response, whereas the ICRU sphere geometry does not seem to be appropriate for the calibration of albedo dosemeters. It is interesting to note that the presence of legs maintains the constancy of the response in a situation when a radiation worker bends down during work. (author)

  8. The Atmospheric Aerosols And Their Effects On Cloud Albedo And Radiative Forcing

    International Nuclear Information System (INIS)

    Stefan, S.; Iorga, G.; Zoran, M.

    2007-01-01

    The aim of this study is to provide results of the theoretical experiments in order to improve the estimates of indirect effect of aerosol on the cloud albedo and consequently on the radiative forcing. The cloud properties could be changed primarily because of changing of both the aerosol type and concentration in the atmosphere. Only a part of aerosol interacts effectively with water and will, in turn, determine the number concentration of cloud droplets (CDNC). We calculated the CDNC, droplet effective radius (reff), cloud optical thickness (or), cloud albedo and radiative forcing, for various types of aerosol. Our results show into what extent the change of aerosol characteristics (number concentration and chemical composition) on a regional scale can modify the cloud reflectivity. Higher values for cloud albedo in the case of the continental (urban) clouds were obtained

  9. Spring snow albedo feedback over northern Eurasia: Comparing in situ measurements with reanalysis products

    Directory of Open Access Journals (Sweden)

    M. Wegmann

    2018-06-01

    Full Text Available This study uses daily observations and modern reanalyses in order to evaluate reanalysis products over northern Eurasia regarding the spring snow albedo feedback (SAF during the period from 2000 to 2013. We used the state-of-the-art reanalyses from ERA-Interim/Land and the Modern-Era Retrospective Analysis for Research and Applications version 2 (MERRA-2 as well as an experimental set-up of ERA-Interim/Land with prescribed short grass as land cover to enhance the comparability with the station data while underlining the caveats of comparing in situ observations with gridded data. Snow depth statistics derived from daily station data are well reproduced in all three reanalyses. However day-to-day albedo variability is notably higher at the stations than for any reanalysis product. The ERA-Interim grass set-up shows improved performance when representing albedo variability and generates comparable estimates for the snow albedo in spring. We find that modern reanalyses show a physically consistent representation of SAF, with realistic spatial patterns and area-averaged sensitivity estimates. However, station-based SAF values are significantly higher than in the reanalyses, which is mostly driven by the stronger contrast between snow and snow-free albedo. Switching to grass-only vegetation in ERA-Interim/Land increases the SAF values up to the level of station-based estimates. We found no significant trend in the examined 14-year time series of SAF, but interannual changes of about 0.5 % K−1 in both station-based and reanalysis estimates were derived. This interannual variability is primarily dominated by the variability in the snowmelt sensitivity, which is correctly captured in reanalysis products. Although modern reanalyses perform well for snow variables, efforts should be made to improve the representation of dynamic albedo changes.

  10. Iapetus Surface Temperatures, and the Influence of Sublimation on the Albedo Dichotomy: Cassini CIRS Constraints

    Science.gov (United States)

    Spencer, J. R.; Pearl, J. C.; Segura, M.; Cassini CIRS Team

    2005-08-01

    The Composite Infrared Spectrometer (CIRS) on the Cassini orbiter obtained extensive observations of Iapetus' thermal emission during the New Year 2005 flyby, with best 8 - 16 μ m spatial resolution of 35 km per pixel. Observed subsolar temperatures on the dark terrain reach nearly 130 K, much warmer than any other satellite surface in the Saturn system, due to the combination of low albedo and slow rotation. These high temperatures mean that, uniquely in the Saturn system, water ice sublimation rates are significant at low latitudes on Iapetus' dark side, and surface water ice is probably not stable there on geological timescales. This result is consistent with the lack of water ice at low latitudes on the dark terrain inferred from Cassini UVIS UV spectra (Hendrix et al., 2005 LPSC). Thermally-controlled migration of water ice may thus contribute to the curious shape of the light/dark boundary on Iapetus, with bright poles and dark terrain extending round the equator onto the trailing side. Impacts of Saturn-centric or prograde heliocentric material cannot alone explain this shape, as their impact flux depends only on distance from the apex of motion (though the impact distribution of Oort cloud comet dust may be consistent with the observed albedo pattern (Cook and Franklin 1970)). We model the ballistic migration of water ice across the surface of Iapetus, determining temperatures and sublimation rates assuming CIRS-constrained thermal inertia and a simple dependence of albedo on distance from the apex of motion. Water ice is lost rapidly from low latitudes on the dark leading side and accumulates near the poles, and is also lost, though more slowly, in equatorial regions near the sub-Saturn and anti-Saturn points. The resulting water ice distribution pattern matches the distribution of Iapetus' bright terrain remarkably well. Albedo modification by thermal migration can thus help to reconcile Iapetus' albedo patterns with albedo control by Saturn-centric or

  11. The Effect of Bond Albedo on Venus' Atmospheric and Surface Temperatures

    Science.gov (United States)

    Bullock, M. A.; Limaye, S. S.; Grinspoon, D. H.; Way, M.

    2017-12-01

    In spite of Venus' high planetary albedo, sufficient solar energy reaches the surface to drive a powerful greenhouse effect. The surface temperature is three times higher than it would be without an atmosphere. However, the details of the energy balance within Venus' atmosphere are poorly understood. Half of the solar energy absorbed within the clouds, where most of the solar energy is absorbed, is due to an unknown agent. One of the challenges of modeling Venus' atmosphere has been to account for all the sources of opacity sufficient to generate a globally averaged surface temperature of 735 K, when only 2% of the incoming solar energy is deposited at the surface. The wavelength and spherically integrated albedo, or Bond albedo, has typically been cited as between 0.7 and 0.82 (Colin 1983). Yet, recent photometry of Venus at extended phase angles between 2 and 179° indicate a Bond albedo of 0.90 (Mallama et al., 2006). The authors note an increase in cloud top brightness at phase angles fixed. Figure 1b (right). Venus surface temperature as Bond Albedo changes. Radiative-convective equilibrium models predict the correct globally averaged surface temperature at a=0.81. Calculations here show that a Bond albedo of a=0.9 would yield a surface temperature of 666.4 K, about 70 K too low, unless there is additional thermal absorption within the atmosphere that is not understood. Colin, L.,, Venus, University of Arizona Press, Tucson, 1983, pp 10-26. Mallama, A., et al., 2006. Icarus. 182, 10-22.

  12. Measurement of the North-South asymmetry in the solar proton albedo neutron flux

    International Nuclear Information System (INIS)

    Ifedili, S.O.

    1979-01-01

    The solar proton albedo neutron flux in the range 10 -2 --10 7 eV measured by a neutron detector on board the Ogo 6 satellite was examined for north-south asymmetry. For the solar proton event of December 19, 1969, the S/N ratio of the solar proton albedo neutron rate at geomagnetic latitude lambda>70 0 was 1.61 +- 0.27 during the event, while for the November 2, 1969, event at 40 0 0 and altitudes ranging from 700 km to 800 km the solar proton albedo neutron rate was 0.40 +- 0.10 count/s in the north and 0.00 +- 0.10 count/s in the south. During the solar proton event of December 18, 1969, the N/S ratio of the solar proton albedo neutron rate at lambda>70 0 was 1.00 +- 0.26. The results are consistent with the expected N-S asymmetry in the solar proton flux. An interplanetary proton anisotropy with the interplanetary magnetic field polarity away from the sun corresponded to larger fluxes of solar proton albedo neutrons at the north polar cap than at the south, while an interplanetary proton anisotropy with the interplanetary magnetic field polarity toward the sun corresponded to larger fluxes of solar proton albedo neutrons at the south polar cap than at the north. This evidence favors the direct access of solar protons to the earth's polar caps via the merged interplanetary and geomagnetic field lines

  13. Changes in summer sea ice, albedo, and portioning of surface solar radiation in the Pacific sector of Arctic Ocean during 1982-2009

    OpenAIRE

    Lei, Ruibo; Tian-Kunze, Xiangshan; Leppäranta, Matti; Wang, Jia; Kaleschke, Lars; Zhang, Zhanhai

    2016-01-01

    SSM/I sea ice concentration and CLARA black-sky composite albedo were used to estimate sea ice albedo in the region 70 degrees N-82 degrees N, 130 degrees W-180 degrees W. The long-term trends and seasonal evolutions of ice concentration, composite albedo, and ice albedo were then obtained. In July-August 1982-2009, the linear trend of the composite albedo and the ice albedo was -0.069 and -0.046 units per decade, respectively. During 1 June to 19 August, melting of sea ice resulted in an inc...

  14. Approximate albedo boundary conditions for energy multigroup X,Y-geometry discrete ordinates nuclear global calculations

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Davi J.M.; Nunes, Carlos E.A.; Alves Filho, Hermes; Barros, Ricardo C., E-mail: davijmsilva@yahoo.com.br, E-mail: ceanunes@yahoo.com.br, E-mail: rcbarros@pq.cnpq.br [Secretaria Municipal de Educacao de Itaborai, RJ (Brazil); Universidade Estacio de Sa (UNESA), Rio de Janeiro, RJ (Brazil); Universidade do Estado do Rio de Janeiro (UERJ), Novra Friburgo, RJ (Brazil). Instituto Politecnico. Departamento de Modelagem Computacional

    2017-11-01

    Discussed here is the accuracy of approximate albedo boundary conditions for energy multigroup discrete ordinates (S{sub N}) eigenvalue problems in two-dimensional rectangular geometry for criticality calculations in neutron fission reacting systems, such as nuclear reactors. The multigroup (S{sub N}) albedo matrix substitutes approximately the non-multiplying media around the core, e.g., baffle and reflector, as we neglect the transverse leakage terms within these non-multiplying regions. Numerical results to a typical model problem are given to illustrate the accuracy versus the computer running time. (author)

  15. Microgeometry capture and RGB albedo estimation by photometric stereo without demosaicing

    Science.gov (United States)

    Quéau, Yvain; Pizenberg, Mathieu; Durou, Jean-Denis; Cremers, Daniel

    2017-03-01

    We present a photometric stereo-based system for retrieving the RGB albedo and the fine-scale details of an opaque surface. In order to limit specularities, the system uses a controllable diffuse illumination, which is calibrated using a dedicated procedure. In addition, we rather handle RAW, non-demosaiced RGB images, which both avoids uncontrolled operations on the sensor data and simplifies the estimation of the albedo in each color channel and of the normals. We finally show on real-world examples the potential of photometric stereo for the 3D-reconstruction of very thin structures from a wide variety of surfaces.

  16. Production characteristics of lettuce Lactuca sativa L. in the frame of the first crop tests in the Higher Plant Chamber integrated into the MELiSSA Pilot Plant

    Science.gov (United States)

    Tikhomirova, Natalia; Lawson, Jamie; Stasiak, Michael; Dixon, Mike; Paille, Christel; Peiro, Enrique; Fossen, Arnaud; Godia, Francesc

    Micro-Ecological Life Support System Alternative (MELiSSA) is an artificial closed ecosystem that is considered a tool for the development of a bioregenerative life support system for manned space missions. One of the five compartments of MELiSSA loop -Higher Plant Chamber was recently integrated into the MELiSSA Pilot Plant facility at Universitat Aut`noma deo Barcelona. The main contributions expected by integration of this photosynthetic compartment are oxygen, water, vegetable food production and CO2 consumption. Production characteristics of Lactuca sativa L., as a MELiSSA candidate crop, were investigated in this work in the first crop experiments in the MELiSSA Pilot Plant facility. The plants were grown in batch culture and totaled 100 plants with a growing area 5 m long and 1 m wide in a sealed controlled environment. Several replicates of the experiments were carried out with varying duration. It was shown that after 46 days of lettuce cultivation dry edible biomass averaged 27, 2 g per plant. However accumulation of oxygen in the chamber, which required purging of the chamber, and decrease in the food value of the plants was observed. Reducing the duration of the tests allowed uninterrupted test without opening the system and also allowed estimation of the crop's carbon balance. Results of productivity, tissue composition, nutrient uptake and canopy photosynthesis of lettuce regardless of test duration are discussed in the paper.

  17. Simulated cold bias being improved by using MODIS time-varying albedo in the Tibetan Plateau in WRF model

    Science.gov (United States)

    Meng, X.; Lyu, S.; Zhang, T.; Zhao, L.; Li, Z.; Han, B.; Li, S.; Ma, D.; Chen, H.; Ao, Y.; Luo, S.; Shen, Y.; Guo, J.; Wen, L.

    2018-04-01

    Systematic cold biases exist in the simulation for 2 m air temperature in the Tibetan Plateau (TP) when using regional climate models and global atmospheric general circulation models. We updated the albedo in the Weather Research and Forecasting (WRF) Model lower boundary condition using the Global LAnd Surface Satellite Moderate-Resolution Imaging Spectroradiometer albedo products and demonstrated evident improvement for cold temperature biases in the TP. It is the large overestimation of albedo in winter and spring in the WRF model that resulted in the large cold temperature biases. The overestimated albedo was caused by the simulated precipitation biases and over-parameterization of snow albedo. Furthermore, light-absorbing aerosols can result in a large reduction of albedo in snow and ice cover. The results suggest the necessity of developing snow albedo parameterization using observations in the TP, where snow cover and melting are very different from other low-elevation regions, and the influence of aerosols should be considered as well. In addition to defining snow albedo, our results show an urgent call for improving precipitation simulation in the TP.

  18. Validation of AVHRR- and MODIS-derived albedos of snow and ice surfaces by means of helicopter measurements

    NARCIS (Netherlands)

    Greuell, W.; Oerlemans, J.

    2005-01-01

    We describe the validation of surface albedos of snow and glacier ice as derived from Advanced Very High Resolution Radiometer (AVHRR) and MOderate Resolution Imaging Spectrometer (MODIS) satellite data. For this purpose we measured surface albedos from a helicopter over Vatnajökull, Iceland, and

  19. On the importance of the albedo parameterization for the mass balance of the Greenland ice sheet in EC-Earth

    NARCIS (Netherlands)

    Helsen, Michiel M.; van de Wal, Roderik S. W.; Reerink, Thomas J.; Bintanja, Richard; Madsen, Marianne S.; Yang, Shuting; Li, Qiang; Zhang, Qiong

    2017-01-01

    The albedo of the surface of ice sheets changes as a function of time due to the effects of deposition of new snow, ageing of dry snow, bare ice exposure, melting and run-off. Currently, the calculation of the albedo of ice sheets is highly parameterized within the earth system model EC-Earth by

  20. On the importance of the albedo parameterization for the mass balance of the Greenland ice sheet in EC-Earth

    NARCIS (Netherlands)

    Helsen, Michiel M.; Van De Wal, Roderik S.W.; Reerink, Thomas J.; Bintanja, Richard; Madsen, Marianne S.; Yang, Shuting; Li, Qiang; Zhang, Qiong

    2017-01-01

    The albedo of the surface of ice sheets changes as a function of time due to the effects of deposition of new snow, ageing of dry snow, bare ice exposure, melting and run-off. Currently, the calculation of the albedo of ice sheets is highly parameterized within the earth system model ECEarth by

  1. Induction of Osmoadaptive Mechanisms and Modulation of Cellular Physiology Help Bacillus licheniformis Strain SSA 61 Adapt to Salt Stress

    Energy Technology Data Exchange (ETDEWEB)

    Paul, Sangeeta; Aggarwal, Chetana; Thakur, Jyoti Kumar; Bandeppa, G. S.; Khan, Md. Aslam; Pearson, Lauren M.; Babnigg, Gyorgy; Giometti, Carol S.; Joachimiak, Andrzej

    2015-01-06

    Bacillus licheniformis strain SSA 61, originally isolated from Sambhar salt lake, was observed to grow even in the presence of 25 % salt stress. Osmoadaptive mechanisms of this halotolerant B. licheniformis strain SSA 61, for long-term survival and growth under salt stress, were determined. Proline was the preferentially accumulated compatible osmolyte. There was also increased accumulation of antioxidants ascorbic acid and glutathione. Among the different antioxidative enzymes assayed, superoxide dismutase played the most crucial role in defense against salt-induced stress in the organism. Adaptation to stress by the organism involved modulation of cellular physiology at various levels. There was enhanced expression of known proteins playing essential roles in stress adaptation, such as chaperones DnaK and GroEL, and general stress protein YfkM and polynucleotide phosphorylase/polyadenylase. Proteins involved in amino acid biosynthetic pathway, ribosome structure, and peptide elongation were also overexpressed. Salt stress-induced modulation of expression of enzymes involved in carbon metabolism was observed. There was up-regulation of a number of enzymes involved in generation of NADH and NADPH, indicating increased cellular demand for both energy and reducing power.

  2. Neurodevelopment in children with and without congenital heart block born to anti-Ro/SSA-positive mothers.

    Science.gov (United States)

    Skog, Amanda; Tingström, Joanna; Salomonsson, Stina; Sonesson, Sven-Erik; Wahren-Herlenius, Marie

    2013-01-01

    To define factors influencing neurodevelopment in children with and without complete congenital heart block (CHB) born to mothers with Ro/SSA autoantibodies. Medical records of a population-based cohort of siblings with (n = 60) and without (n = 54) CHB born 1974-2009 to anti-Ro/SSA-positive mothers were retrieved from children primary healthcare centres and school health services and used to extract data on neurodevelopment. Impaired neurodevelopment was reported in 16% of the children (18/114) during the follow-up time of 13.0 (8.2-17.5) years, median (quartiles). Reported problems included speech (9%), motor (8%) and learning (8%) impairment, attention deficit (5%) and behavioural impairment (4%). Impairment in motor skill development was more common in boys (p influenced by maternal SLE (p influenced by both maternal SLE (p influence neurodevelopment. Follow-up of neurodevelopment should therefore be considered for children with CHB, especially if the mother is diagnosed with SLE. ©2012 The Author(s)/Acta Paediatrica ©2012 Foundation Acta Paediatrica.

  3. BOREAS HYP-8 DEM Data Over The NSA-MSA and SSA-MSA in The AEAC Projection

    Science.gov (United States)

    Knapp, David E.; Hall, Forrest G. (Editor); Wang, Xue-Wen; Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    These data were derived from the original Digital Elevation Models (DEMs) produced by the Boreal Ecosystem-Atmosphere Study (BOREAS) Hydrology (HYD)-8 team. The original DEMs were in the Universal Transverse Mercator (UTM) projection, while this product is projected in the Albers Equal-Area Conic (AEAC) projection. The pixel size of the data is 100 meters, which is appropriate for the 1:50,000-scale contours from which the DEMs were made. The original data were compiled from information available in the 1970s and 1980s. This data set covers the two Modeling Sub-Areas (MSAs) that are contained within the Southern Study Area (SSA) and the Northern Study Area (NSA). The data are stored in binary, image format files. The DEM data over the NSA-MSA and SSA-MSA in the AEAC projection are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).

  4. Surface albedo in relation to disturbance and early stand dynamics in the boreal forest: Implications for climate models

    Science.gov (United States)

    Halim, M. A.; Thomas, S. C.

    2017-12-01

    Surface albedo is the most important biophysical radiative forcing in the boreal forest. General Circulation Model studies have suggested that harvesting of boreal forest has a net cooling effect, in contrast to other terrestrial biomes, by increasing surface albedo. However, albedo estimation in these models has been achieved by simplifying processes governing albedo at a coarse scale (both spatial and temporal). Biophysical processes that determine albedo likely operate on small spatial and temporal scales, requiring more direct estimates of effects of landcover change on net radiation. We established a chronosequence study in post-fire and post-clearcut sites (2013, 2006, 1998), logging data from July 2013 to July 2017 in boreal forest sites in northwestern Ontario, Canada. Each age-class X disturbance had 3 three replicates, matched to 18 permanent circular plots (10-m radius) each with an instrumented tower measuring surface albedo, air and soil temperature, and soil moisture. We also measured leaf area index, species composition and soil organic matter content at each site. BRDF-corrected surface albedo was calculated from daily 30m x 30m reflectance data fused from the MODIS MOD09GA product and Landsat 7 reflectance data. Calculated albedo was verified using ground-based measurements. Results show that fire sites generally had lower (15-25%) albedo than clearcut sites in all seasons. Because of rapid forest regrowth, large perturbations of clearcut harvests on forest albedo started to fade out within a year. Albedo differences between fire and clearcut sites also declined sharply with stand age. Younger stands generally had higher albedo than older stands mainly due to the presence of broadleaf species (for example, Populus tremuloides). In spring, snow melted 10-12 days earlier in recent (2013) clearcut sites compared to closed-canopy sites, causing a sharp reduction in surface albedo in comparison to old clearcut/fire sites (2006 and 1998). Snow melted

  5. Urban Morphology Influence on Urban Albedo: A Revisit with the S olene Model

    Science.gov (United States)

    Groleau, Dominique; Mestayer, Patrice G.

    2013-05-01

    This heuristic study of the urban morphology influence on urban albedo is based on some 3,500 simulations with the S olene model. The studied configurations include square blocks in regular and staggered rows, rectangular blocks with different street widths, cross-shaped blocks, infinite street canyons and several actual districts in Marseilles, Toulouse and Nantes, France. The scanned variables are plan density, facade density, building height, layout orientation, latitude, date and time of the day. The sky-view factors of the ground and canopy surfaces are also considered. This study demonstrates the significance of the facade density, in addition to the built plan density, as the explanatory geometrical factor to characterize the urban morphology, rather than building height. On the basis of these albedo calculations the puzzling results of Kondo et al. (Boundary-Layer Meteorol 100:225-242, 2001) for the influence of building height are explained, and the plan density influence is quantitatively assessed. It is shown that the albedo relationship with plan and facade densities obtained with the regular square plot configuration may be considered as a reference for all other configurations, with the exception of the infinite street canyon that shows systematic differences for the lower plan densities. The curves representing this empirical relationship may be used as a sort of abacus for all other geometries while an approximate simple mathematical model is proposed, as well as relationships between the albedo and sky-view factors.

  6. Photometric evidence on long-term stability of albedo and colour markings on Io

    International Nuclear Information System (INIS)

    Morrison, D.; Pieri, D.; Veverka, J.; Johnson, T.V.

    1979-01-01

    This article re-examines the historical measurements of the albedo and colour of Io to determine whether there is evidence of variations, or if not, to set a limit on major resurfacing events resulting in hemispheric brightness changes during the past half century. (author)

  7. A Comparison of Numerical and Analytical Radiative-Transfer Solutions for Plane Albedo in Natural Waters

    Science.gov (United States)

    Several numerical and analytical solutions of the radiative transfer equation (RTE) for plane albedo were compared for solar light reflection by sea water. The study incorporated the simplest case, that being a semi-infinite one-dimensional plane-parallel absorbing and scattering...

  8. The slab albedo problem for the triplet scattering kernel with modified F{sub N} method

    Energy Technology Data Exchange (ETDEWEB)

    Tuereci, Demet [Ministry of Education, 75th year Anatolia High School, Ankara (Turkey)

    2016-12-15

    One speed, time independent neutron transport equation for a slab geometry with the quadratic anisotropic scattering kernel is considered. The albedo and transmission factor are calculated by the modified F{sub N} method. The obtained numerical results are listed for different scattering coefficients.

  9. Attitude estimation from magnetometer and earth-albedo-corrected coarse sun sensor measurements

    Science.gov (United States)

    Appel, Pontus

    2005-01-01

    For full 3-axes attitude determination the magnetic field vector and the Sun vector can be used. A Coarse Sun Sensor consisting of six solar cells placed on each of the six outer surfaces of the satellite is used for Sun vector determination. This robust and low cost setup is sensitive to surrounding light sources as it sees the whole sky. To compensate for the largest error source, the Earth, an albedo model is developed. The total albedo light vector has contributions from the Earth surface which is illuminated by the Sun and visible from the satellite. Depending on the reflectivity of the Earth surface, the satellite's position and the Sun's position the albedo light changes. This cannot be calculated analytically and hence a numerical model is developed. For on-board computer use the Earth albedo model consisting of data tables is transferred into polynomial functions in order to save memory space. For an absolute worst case the attitude determination error can be held below 2∘. In a nominal case it is better than 1∘.

  10. Sensitivity of cloud albedo to aerosol concentration and spectral dispersion of cloud droplet size distribution

    Energy Technology Data Exchange (ETDEWEB)

    Iorga, G. [Faculty of Chemistry, University of Bucharest, Bucharest (Romania)]. E-mail: giorga@gw-chimie.math.unibuc.ro; Stefan, S. [Faculty of Physics, University of Bucharest, Bucharest (Romania)

    2007-07-15

    Both the enhancement of the aerosol number concentration and the relative dispersion of the cloud droplet size distribution (spectral dispersion) on a regional scale can modify the cloud reflectivity. This work is focused on the role that pre-cloud aerosol plays in cloud reflectivity. Log-normal aerosol size distributions were used to describe two aerosol types: marine and rural. The number of aerosols that activate to droplets was obtained based on Abdul-Razzak and Ghan's (2000) activation parameterization. The cloud albedo taking into account the spectral dispersion effect in the parameterization of cloud effective radius and in the scattering asymmetry factor has been estimated. Two different scaling factors to account for dispersion were used. The sensitivity of cloud albedo to spectral dispersion-cloud droplet number concentration relationship in connection to the changes in liquid water content (LWC), and the cloud droplet effective radius has been also investigated. We obtained higher values of effective radius when dispersion is taken into account, with respect to the base case (without considering dispersion). The inferred absolute differences in effective radius values between calculations with each of the scaling factors are below 0.8 {mu}m as LWC ranges between 0.1 and 1.0 g m-3. The optical depth decreased by up to 14% (marine), and up to 29% (continental) when dispersion is considered in both effective radius and asymmetry factor ({beta}LDR scaling factor). Correspondingly, the relative change in cloud albedo is up to 6% (marine) and up to 11% (continental) clouds. For continental clouds, the calculated effective radius when dispersion is considered fits well within the measured range of effective radius in SCAR-B project. The calculated cloud albedo when dispersion is considered shows better agreement with the estimated cloud albedo from measured effective radius in SCAR-B project than the cloud albedo calculated without dispersion. In cleaner

  11. Albedo feedbacks to future climate via climate change impacts on dryland biocrusts

    Science.gov (United States)

    Rutherford, William A.; Painter, Thomas H.; Ferrenberg, Scott; Belnap, Jayne; Okin, Gregory S.; Flagg, Cody B.; Reed, Sasha C.

    2017-01-01

    Drylands represent the planet’s largest terrestrial biome and evidence suggests these landscapes have large potential for creating feedbacks to future climate. Recent studies also indicate that dryland ecosystems are responding markedly to climate change. Biological soil crusts (biocrusts) ‒ soil surface communities of lichens, mosses, and/or cyanobacteria ‒ comprise up to 70% of dryland cover and help govern fundamental ecosystem functions, including soil stabilization and carbon uptake. Drylands are expected to experience significant changes in temperature and precipitation regimes, and such alterations may impact biocrust communities by promoting rapid mortality of foundational species. In turn, biocrust community shifts affect land surface cover and roughness—changes that can dramatically alter albedo. We tested this hypothesis in a full-factorial warming (+4 °C above ambient) and altered precipitation (increased frequency of 1.2 mm monsoon-type watering events) experiment on the Colorado Plateau, USA. We quantified changes in shortwave albedo via multi-angle, solar-reflectance measurements. Warming and watering treatments each led to large increases in albedo (>30%). This increase was driven by biophysical factors related to treatment effects on cyanobacteria cover and soil surface roughness following treatment-induced moss and lichen mortality. A rise in dryland surface albedo may represent a previously unidentified feedback to future climate.

  12. Albedo feedbacks to future climate via climate change impacts on dryland biocrusts

    Science.gov (United States)

    Rutherford, William A.; Painter, Thomas H.; Ferrenberg, Scott; Belnap, Jayne; Okin, Gregory S.; Flagg, Cody; Reed, Sasha C.

    2017-03-01

    Drylands represent the planet’s largest terrestrial biome and evidence suggests these landscapes have large potential for creating feedbacks to future climate. Recent studies also indicate that dryland ecosystems are responding markedly to climate change. Biological soil crusts (biocrusts) ‒ soil surface communities of lichens, mosses, and/or cyanobacteria ‒ comprise up to 70% of dryland cover and help govern fundamental ecosystem functions, including soil stabilization and carbon uptake. Drylands are expected to experience significant changes in temperature and precipitation regimes, and such alterations may impact biocrust communities by promoting rapid mortality of foundational species. In turn, biocrust community shifts affect land surface cover and roughness—changes that can dramatically alter albedo. We tested this hypothesis in a full-factorial warming (+4 °C above ambient) and altered precipitation (increased frequency of 1.2 mm monsoon-type watering events) experiment on the Colorado Plateau, USA. We quantified changes in shortwave albedo via multi-angle, solar-reflectance measurements. Warming and watering treatments each led to large increases in albedo (>30%). This increase was driven by biophysical factors related to treatment effects on cyanobacteria cover and soil surface roughness following treatment-induced moss and lichen mortality. A rise in dryland surface albedo may represent a previously unidentified feedback to future climate.

  13. Calibration of an ALBEDO termoluminiscent dosimeter for its use in personal dosimetry

    International Nuclear Information System (INIS)

    Diaz Bernal, E.; Molina Perez, D.; Cornejo Diaz, N.; Carrazana Gonzalez, J.

    1996-01-01

    The dosimetric studies began after the Radiological Individuals Surveillance Department from the Radiation Protection and Hygiene Center acquired the albedo thermoluminescent dosimeters model JR1104. This paper reviews the response of those dosimeters to the different spectrums and incidence angles of neutronic radiation

  14. Extensive computation of albedo contrast between martian dust devil tracks and their neighboring regions

    Science.gov (United States)

    Statella, Thiago; Pina, Pedro; da Silva, Erivaldo Antônio

    2015-04-01

    We have developed a method to compute the albedo contrast between dust devil tracks and their surrounding regions on Mars. It is mainly based on Mathematical Morphology operators and uses all the points of the edges of the tracks to compute the values of the albedo contrast. It permits the extraction of more accurate and complete information, when compared to traditional point sampling, not only providing better statistics but also permitting the analysis of local variations along the entirety of the tracks. This measure of contrast, based on relative quantities, is much more adequate to establish comparisons at regional scales and in multi-temporal basis using imagery acquired in rather different environmental and operational conditions. Also, the substantial increase in the details extracted may permit quantifying differential depositions of dust by computing local temporal fading of the tracks with consequences on a better estimation of the thickness of the top most layer of dust and the minimum value needed to create dust devils tracks. The developed tool is tested on 110 HiRISE images depicting regions in the Aeolis, Argyre, Eridania, Noachis and Hellas quadrangles. As a complementary evaluation, we also performed a temporal analysis of the albedo in a region of Russell crater, where high seasonal dust devil activity was already observed before, comprising the years 2007-2012. The mean albedo of the Russell crater is in this case indicative of dust devil tracks presence and, therefore, can be used to quantify dust devil activity.

  15. Slab albedo for linearly and quadratically anisotropic scattering kernel with modified F{sub N} method

    Energy Technology Data Exchange (ETDEWEB)

    Tuereci, R. Goekhan [Kirikkale Univ. (Turkey). Kirikkale Vocational School; Tuereci, D. [Ministry of Education, Ankara (Turkey). 75th year Anatolia High School

    2017-11-15

    One speed, time independent and homogeneous medium neutron transport equation is solved with the anisotropic scattering which includes both the linearly and the quadratically anisotropic scattering kernel. Having written Case's eigenfunctions and the orthogonality relations among of these eigenfunctions, slab albedo problem is investigated as numerically by using Modified F{sub N} method. Selected numerical results are presented in tables.

  16. Monitoring NEON terrestrial sites phenology with daily MODIS BRDF/albedo product and landsat data

    Science.gov (United States)

    The MODerate resolution Imaging Spectroradiometer (MODIS) Bidirectional Reflectance Distribution Function (BRDF) and albedo products (MCD43) have already been in production for more than a decade. The standard product makes use of a linear “kernel-driven” RossThick-LiSparse Reciprocal (RTLSR) BRDF m...

  17. An Improved Method For Retrieving Land Surface Albedo Over Rugged Terrain

    NARCIS (Netherlands)

    Gao, B.; Jia, L.; Menenti, M.

    2014-01-01

    Land surface albedo is a very important parameter, which can be derived from a bidirectional reflectance distribution function (BRDF) model with angular integration of BRDF in a particular distribution of downward solar irradiance. The Algorithm for MODIS Bidirectional Reflectance Anisotropic of

  18. Sunlight, Sea Ice, and the Ice Albedo Feedback in a Changing Arctic Sea Ice Cover

    Science.gov (United States)

    2015-09-30

    fraction product and the remotely sensed albedo product in the context of understanding the surface radiation budget. Particular attention is paid to...Stamnes, Chapter 2 The Polar Environment: Sun, Clouds, and Ice, in Ocean Colour Remote Sensing in Polar Seas, p 5-25, in press. Istomina, L, G

  19. Sunlight, Sea Ice, and the Ice Albedo Feedback in a Changing Artic Sea Ice Cover

    Science.gov (United States)

    2015-11-30

    the remotely sensed albedo product in the context of understanding the surface radiation budget. Particular attention is paid to the infrequent...Chapter 2 The Polar Environment: Sun, Clouds, and Ice, in Ocean Colour Remote Sensing in Polar Seas, p 5-25, in press. Istomina, L, G. Heygster, M

  20. Early Spring Post-Fire Snow Albedo Dynamics in High Latitude Boreal Forests Using Landsat-8 OLI Data

    Science.gov (United States)

    Wang, Zhuosen; Erb, Angela M.; Schaaf, Crystal B.; Sun, Qingsong; Liu, Yan; Yang, Yun; Shuai, Yanmin; Casey, Kimberly A.; Roman, Miguel O.

    2016-01-01

    Taking advantage of the improved radiometric resolution of Landsat-8 OLI which, unlike previous Landsat sensors, does not saturate over snow, the progress of fire recovery progress at the landscape scale (less than 100 m) is examined. High quality Landsat-8 albedo retrievals can now capture the true reflective and layered character of snow cover over a full range of land surface conditions and vegetation densities. This new capability particularly improves the assessment of post-fire vegetation dynamics across low- to high-burn severity gradients in Arctic and boreal regions in the early spring, when the albedos during recovery show the greatest variation. We use 30 m resolution Landsat-8 surface reflectances with concurrent coarser resolution (500 m) MODIS high quality full inversion surface Bidirectional Reflectance Distribution Functions (BRDF) products to produce higher resolution values of surface albedo. The high resolution full expression shortwave blue sky albedo product performs well with an overall RMSE of 0.0267 between tower and satellite measures under both snow-free and snow-covered conditions. While the importance of post-fire albedo recovery can be discerned from the MODIS albedo product at regional and global scales, our study addresses the particular importance of early spring post-fire albedo recovery at the landscape scale by considering the significant spatial heterogeneity of burn severity, and the impact of snow on the early spring albedo of various vegetation recovery types. We found that variations in early spring albedo within a single MODIS gridded pixel can be larger than 0.6. Since the frequency and severity of wildfires in Arctic and boreal systems is expected to increase in the coming decades, the dynamics of albedo in response to these rapid surface changes will increasingly impact the energy balance and contribute to other climate processes and physical feedback mechanisms. Surface radiation products derived from Landsat-8 data will

  1. MODIS-Derived 1.64 micron white-sky albedo on a global, 1-minute equal angle grid (Collection 004 and 005)

    Data.gov (United States)

    National Aeronautics and Space Administration — The Filled Land Surface Albedo Product is a global data set of spatially complete albedo maps. It was derived from the MODIS MOD43B3 Land product and includes both...

  2. Near-ground cooling efficacies of trees and high-albedo surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Levinson, Ronnen Michael [Univ. of California, Berkeley, CA (United States)

    1997-05-01

    Daytime summer urban heat islands arise when the prevalence of dark-colored surfaces and lack of vegetation make a city warmer than neighboring countryside. Two frequentlyproposed summer heat island mitigation measures are to plant trees and to increase the albedo (solar reflectivity) of ground surfaces. This dissertation examines the effects of these measures on the surface temperature of an object near the ground, and on solar heating of air near the ground. Near-ground objects include people, vehicles, and buildings. The variation of the surface temperature of a near-ground object with ground albedo indicates that a rise in ground albedo will cool a near-ground object only if the object’s albedo exceeds a critical value. This critical value of object albedo depends on wind speed, object geometry, and the height of the atmospheric thermal boundary layer. It ranges from 0.15 to 0.37 for a person. If an object has typical albedo of 0.3, increasing the ground albedo by 0.25 perturbs the object’s surface temperature by -1 to +2 K. Comparing a tree’s canopy-to-air convection to the reduction in ground-to-air convection induced by tree shading of the ground indicates that the presence of a tree can either increase or decrease solar heating of ground-level air. The tree’s net effect depends on the extent to which solar heating of the canopy is dissipated by evaporation, and on the fraction of air heated by the canopy that flows downward and mixes with the ground-level air. A two-month lysimeter (plant-weighing) experiment was conducted to measure instantaneous rates of water loss from a tree under various conditions of weather and soil-moisture. Calculations of canopy-to-air convection and the reduction of ground-to-air convection based on this data indicate that canopy-induced heating would negate shadowinduced cooling if approximately 45% of the canopy-heated air mixed with ground level air. This critical fraction is comparable to typical downward mixing

  3. Analysis of coupled neutron-gamma radiations, applied to shieldings in multigroup albedo method

    International Nuclear Information System (INIS)

    Dunley, Leonardo Souza

    2002-01-01

    The principal mathematical tools frequently available for calculations in Nuclear Engineering, including coupled neutron-gamma radiations shielding problems, involve the full Transport Theory or the Monte Carlo techniques. The Multigroup Albedo Method applied to shieldings is characterized by following the radiations through distinct layers of materials, allowing the determination of the neutron and gamma fractions reflected from, transmitted through and absorbed in the irradiated media when a neutronic stream hits the first layer of material, independently of flux calculations. Then, the method is a complementary tool of great didactic value due to its clarity and simplicity in solving neutron and/or gamma shielding problems. The outstanding results achieved in previous works motivated the elaboration and the development of this study that is presented in this dissertation. The radiation balance resulting from the incidence of a neutronic stream into a shielding composed by 'm' non-multiplying slab layers for neutrons was determined by the Albedo method, considering 'n' energy groups for neutrons and 'g' energy groups for gammas. It was taken into account there is no upscattering of neutrons and gammas. However, it was considered that neutrons from any energy groups are able to produce gammas of all energy groups. The ANISN code, for an angular quadrature order S 2 , was used as a standard for comparison of the results obtained by the Albedo method. So, it was necessary to choose an identical system configuration, both for ANISN and Albedo methods. This configuration was six neutron energy groups and eight gamma energy groups, using three slab layers (iron aluminum - manganese). The excellent results expressed in comparative tables show great agreement between the values determined by the deterministic code adopted as standard and, the values determined by the computational program created using the Albedo method and the algorithm developed for coupled neutron

  4. Potential decadal predictability and its sensitivity to sea ice albedo parameterization in a global coupled model

    Energy Technology Data Exchange (ETDEWEB)

    Koenigk, Torben; Caian, Mihaela; Doescher, Ralf; Wyser, Klaus [Swedish Meteorological and Hydrological Institute, Rossby Centre, Norrkoeping (Sweden); Koenig Beatty, Christof [Universite Catholique de Louvain, Louvain-la-Neuve (Belgium)

    2012-06-15

    Decadal prediction is one focus of the upcoming 5th IPCC Assessment report. To be able to interpret the results and to further improve the decadal predictions it is important to investigate the potential predictability in the participating climate models. This study analyzes the upper limit of climate predictability on decadal time scales and its dependency on sea ice albedo parameterization by performing two perfect ensemble experiments with the global coupled climate model EC-Earth. In the first experiment, the standard albedo formulation of EC-Earth is used, in the second experiment sea ice albedo is reduced. The potential prognostic predictability is analyzed for a set of oceanic and atmospheric parameters. The decadal predictability of the atmospheric circulation is small. The highest potential predictability was found in air temperature at 2 m height over the northern North Atlantic and the southern South Atlantic. Over land, only a few areas are significantly predictable. The predictability for continental size averages of air temperature is relatively good in all northern hemisphere regions. Sea ice thickness is highly predictable along the ice edges in the North Atlantic Arctic Sector. The meridional overturning circulation is highly predictable in both experiments and governs most of the decadal climate predictability in the northern hemisphere. The experiments using reduced sea ice albedo show some important differences like a generally higher predictability of atmospheric variables in the Arctic or higher predictability of air temperature in Europe. Furthermore, decadal variations are substantially smaller in the simulations with reduced ice albedo, which can be explained by reduced sea ice thickness in these simulations. (orig.)

  5. Photometric Modeling and VIS-IR Albedo Maps of Dione From Cassini-VIMS

    Science.gov (United States)

    Filacchione, G.; Ciarniello, M.; D'Aversa, E.; Capaccioni, F.; Cerroni, P.; Buratti, B. J.; Clark, R. N.; Stephan, K.; Plainaki, C.

    2018-03-01

    We report about visible and infrared albedo maps and spectral indicators of Dione's surface derived from the complete Visual and Infrared Mapping Spectrometer (VIMS) data set acquired between 2004 and 2017 during the Cassini tour in Saturn's system. Maps are derived by applying a photometric correction necessary to disentangle the intrinsic albedo of the surface from illumination and viewing geometry occurring at the time of the observation. The photometric correction is based on the Shkuratov et al. (2011, https://doi.org/10.1016/j.pss.2011.06.011) method which yields values of the surface equigonal albedo. Dione's surface albedo maps are rendered at five visible (VIS: 0.35, 0.44, 0.55, 0.7, and 0.95 μm) and five infrared (IR: 1.046, 1.540, 1.822, 2.050, and 2.200 μm) wavelengths in cylindrical projection with a 0.5° × 0.5° angular resolution in latitude and longitude, corresponding to a spatial resolution of 4.5 km/bin. Apart from visible and infrared albedo maps, we report about the distribution of the two visible spectral slopes (0.35-0.55 and 0.55-0.95 μm) and water ice 2.050 μm band depth computed after having applied the photometric correction. The derived spectral indicators are employed to trace Dione's composition variability on both global and local scales allowing to study the dichotomy between the bright‐leading and dark‐trailing hemispheres, the distribution of fresh material on the impact craters and surrounding ejecta, and the resurfacing of the bright material within the chasmata caused by tectonism.

  6. Impacto do desmatamento de uma área de mangue no albedo superficial

    Directory of Open Access Journals (Sweden)

    Carlos Alexandre Santos Querino

    2013-12-01

    Full Text Available Manguezais são ecossistemas peculiares encontrados nas regiões tropicais. A degradação dos manguezais altera o balanço superficial de radiação, e por consequência o albedo. Para avaliar e comparar o albedo, nesse ambiente foram instaladas duas plataformas de coletas de dados micrometeorológicos no município de Marechal Deodoro, Alagoas, Brasil, no período de outubro de 2004 a outubro de 2005. No mangue nativo (9º42' 18"S; 35º 48' 32" W foram instalados dois piranômetros acima da copa das árvores, e em outubro de 2005, um terceiro dentro do mangue. Na área degradada (9º 36' 38" S; 35º 46' 03" W, os sensores foram posicionados a uma altura de dois metros em relação ao solo. Observou-se que o albedo sobre a floresta de mangue, em geral, é maior em média, 5 pontos percentuais superior em relação à outras florestas tropicais, como por exemplo, a Amazônia. Internamente notou-se que o mesmo não ultrapassou os 13% e seu valor máximo ocorre no horário de menor albedo da copa ≈ 20%, evidenciando a influência da maré. Já na área degradada, o albedo médio foi de 35%, o que implica em uma elevação aproximada de 49% quando substituída a cobertura de floresta natural.

  7. Incorporating changes in albedo in estimating the climate mitigation benefits of land use change projects

    Science.gov (United States)

    Bird, D. N.; Kunda, M.; Mayer, A.; Schlamadinger, B.; Canella, L.; Johnston, M.

    2008-04-01

    Some climate scientists are questioning whether the practice of converting of non-forest lands to forest land (afforestation or reforestation) is an effective climate change mitigation option. The discussion focuses particularly on areas where the new forest is primarily coniferous and there is significant amount of snow since the increased climate forcing due to the change in albedo may counteract the decreased climate forcing due to carbon dioxide removal. In this paper, we develop a stand-based model that combines changes in surface albedo, solar radiation, latitude, cloud cover and carbon sequestration. As well, we develop a procedure to convert carbon stock changes to equivalent climatic forcing or climatic forcing to equivalent carbon stock changes. Using the model, we investigate the sensitivity of combined affects of changes in surface albedo and carbon stock changes to model parameters. The model is sensitive to amount of cloud, atmospheric absorption, timing of canopy closure, carbon sequestration rate among other factors. The sensitivity of the model is investigated at one Canadian site, and then the model is tested at numerous sites across Canada. In general, we find that the change in albedo reduces the carbon sequestration benefits by approximately 30% over 100 years, but this is not drastic enough to suggest that one should not use afforestation or reforestation as a climate change mitigation option. This occurs because the forests grow in places where there is significant amount of cloud in winter. As well, variations in sequestration rate seem to be counterbalanced by the amount and timing of canopy closure. We close by speculating that the effects of albedo may also be significant in locations at lower latitudes, where there are less clouds, and where there are extended dry seasons. These conditions make grasses light coloured and when irrigated crops, dark forests or other vegetation such as biofuels replace the grasses, the change in carbon

  8. Ultraviolet radiation (UVR) induces cell-surface Ro/SSA antigen expression by human keratinocytes in vitro: a possible mechanism for the UVR induction of cutaneous lupus lesions

    International Nuclear Information System (INIS)

    Jones, S.K.

    1992-01-01

    Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author)

  9. Evaluation of MODIS albedo product (MCD43A) over grassland, agriculture and forest surface types during dormant and snow-covered periods

    Science.gov (United States)

    Zhuosen Wang; Crystal B. Schaaf; Alan H. Strahler; Mark J. Chopping; Miguel O. Román; Yanmin Shuai; Curtis E. Woodcock; David Y. Hollinger; David R. Fitzjarrald

    2014-01-01

    This study assesses the Moderate-resolution Imaging Spectroradiometer (MODIS) BRDF/albedo 8 day standard product and products from the daily Direct Broadcast BRDF/albedo algorithm, and shows that these products agree well with ground-based albedo measurements during the more difficult periods of vegetation dormancy and snow cover. Cropland, grassland, deciduous and...

  10. Derivation of Land Surface Albedo at High Resolution by Combining HJ-1A/B Reflectance Observations with MODIS BRDF Products

    NARCIS (Netherlands)

    Gao, B.; Jia, L.; Wang, T.X.

    2014-01-01

    Land surface albedo is an essential parameter for monitoring global/regional climate and land surface energy balance. Although many studies have been conducted on global or regional land surface albedo using various remote sensing data over the past few decades, land surface albedo product with a

  11. An analysis of the potential for achieving the fourth millennium development goal in SSA with domestic resources.

    Science.gov (United States)

    O'Hare, Bernadette; Makuta, Innocent

    2015-02-25

    The importance of good health is reflected in the fact that more than half of the eight Millennium Development Goals (MDGs) are aimed at improving health status. Goal 4 (MDG4) aims to reduce child mortality. The progress indicator for goal 4 is the under-five mortality rate (U5M), with a targeted reduction of two thirds by 2015 from 1990 levels. This paper seeks to compare the time (in years) Sub Saharan African (SSA) countries will take to reach their MDG4 target at the current rate of decline, and the time it could have taken to reach their target if domestic resources had not been lost through illicit financial flows, corruption and servicing of debt since 2000. We estimate the amount by which the Gross Domestic Product (GDP) per capita would increase (in percentage terms) if losses of resource through illicit financial flows, corruption and debt servicing, were reduced. Using the income elasticity of U5M, a metric which reports the percentage change in U5M for a one percent change in GDP per capita, we estimate the potential gains in the annual reduction of the under-five mortality if these resource losses were reduced. At the current rate of reduction in U5M, nine countries out of this sample of 36 SSA countries (25%) will achieve their MDG4 target by 2015. In the absence of the leakages (IFF, corruption and debt service) 30 out of 36 (83%) would reach their MDG4 target by 2015 and all except one country, Zimbabwe would have achieved their MDG4 by 2017 (97%). In view of the uncertainty of the legitimacy of African debts we have also provided results where we excluded debt repayment from our analysis. Most countries would have met MDG4 target by curtailing these outflows. In order to release latent resources in SSA for development, action will be needed both by African countries and internationally. We consider that stemming these outflows, and thereby reducing the need for aid, can be achieved with a more transparent global financial system.

  12. Application of Laplace transform for determination of albedo type boundary conditions for neutronic calculations; Aplicacao da transformada de Laplace para determinacao de condicoes de contorno tipo albedo para calculos neutronicos

    Energy Technology Data Exchange (ETDEWEB)

    Petersen, Claudio Zen

    2008-07-01

    In this dissertation we use the Laplace transform to derive expressions for nonstandard albedo boundary conditions for one and two non-multiplying regions at the ends of one dimensional domains. In practice, the fuel regions of reactor cores are surrounded by reflector regions that reduce neutron leakage. In order to exclude the reflector regions from the calculations, we introduce a reflection coefficient or albedo. We use the present albedo boundary conditions to solve numerically slab-geometry monoenergetic and multigroup diffusion equations using the conventional finite difference method. Numerical results are generated for fixed source and eigenvalue diffusion problems in slab geometry(author)

  13. Modelling Mean Albedo of Individual Roofs in Complex Urban Areas Using Satellite Images and Airborne Laser Scanning Point Clouds

    Science.gov (United States)

    Kalantar, B.; Mansor, S.; Khuzaimah, Z.; Sameen, M. Ibrahim; Pradhan, B.

    2017-09-01

    Knowledge of surface albedo at individual roof scale is important for mitigating urban heat islands and understanding urban climate change. This study presents a method for quantifying surface albedo of individual roofs in a complex urban area using the integration of Landsat 8 and airborne LiDAR data. First, individual roofs were extracted from airborne LiDAR data and orthophotos using optimized segmentation and supervised object based image analysis (OBIA). Support vector machine (SVM) was used as a classifier in OBIA process for extracting individual roofs. The user-defined parameters required in SVM classifier were selected using v-fold cross validation method. After that, surface albedo was calculated for each individual roof from Landsat images. Finally, thematic maps of mean surface albedo of individual roofs were generated in GIS and the results were discussed. Results showed that the study area is covered by 35% of buildings varying in roofing material types and conditions. The calculated surface albedo of buildings ranged from 0.16 to 0.65 in the study area. More importantly, the results indicated that the types and conditions of roofing materials significantly effect on the mean value of surface albedo. Mean albedo of new concrete, old concrete, new steel, and old steel were found to be equal to 0.38, 0.26, 0.51, and 0.44 respectively. Replacing old roofing materials with new ones should highly prioritized.

  14. MODELLING MEAN ALBEDO OF INDIVIDUAL ROOFS IN COMPLEX URBAN AREAS USING SATELLITE IMAGES AND AIRBORNE LASER SCANNING POINT CLOUDS

    Directory of Open Access Journals (Sweden)

    B. Kalantar

    2017-09-01

    Full Text Available Knowledge of surface albedo at individual roof scale is important for mitigating urban heat islands and understanding urban climate change. This study presents a method for quantifying surface albedo of individual roofs in a complex urban area using the integration of Landsat 8 and airborne LiDAR data. First, individual roofs were extracted from airborne LiDAR data and orthophotos using optimized segmentation and supervised object based image analysis (OBIA. Support vector machine (SVM was used as a classifier in OBIA process for extracting individual roofs. The user-defined parameters required in SVM classifier were selected using v-fold cross validation method. After that, surface albedo was calculated for each individual roof from Landsat images. Finally, thematic maps of mean surface albedo of individual roofs were generated in GIS and the results were discussed. Results showed that the study area is covered by 35% of buildings varying in roofing material types and conditions. The calculated surface albedo of buildings ranged from 0.16 to 0.65 in the study area. More importantly, the results indicated that the types and conditions of roofing materials significantly effect on the mean value of surface albedo. Mean albedo of new concrete, old concrete, new steel, and old steel were found to be equal to 0.38, 0.26, 0.51, and 0.44 respectively. Replacing old roofing materials with new ones should highly prioritized.

  15. BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection

    Science.gov (United States)

    Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)

    2000-01-01

    The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).

  16. The response of Arctic vegetation to the summer climate: relation between shrub cover, NDVI, surface albedo and temperature

    Energy Technology Data Exchange (ETDEWEB)

    Blok, Daan; Heijmans, Monique M P D; Berendse, Frank [Nature Conservation and Plant Ecology Group, Wageningen University, PO Box 47, 6700 AA, Wageningen (Netherlands); Schaepman-Strub, Gabriela [Institute of Evolutionary Biology and Environmental Studies, University of Zuerich, Winterthurerstrasse 190, 8057 Zuerich (Switzerland); Bartholomeus, Harm [Centre for Geo-Information, Wageningen University, PO Box 47, 6700 AA, Wageningen (Netherlands); Maximov, Trofim C, E-mail: daan.blok@wur.nl [Biological Problems of the Cryolithozone, Russian Academy of Sciences, Siberian Division, 41, Lenin Prospekt, Yakutsk, The Republic of Sakha, Yakutia 677980 (Russian Federation)

    2011-07-15

    Recently observed Arctic greening trends from normalized difference vegetation index (NDVI) data suggest that shrub growth is increasing in response to increasing summer temperature. An increase in shrub cover is expected to decrease summer albedo and thus positively feed back to climate warming. However, it is unknown how albedo and NDVI are affected by shrub cover and inter-annual variations in the summer climate. Here, we examine the relationship between deciduous shrub fractional cover, NDVI and albedo using field data collected at a tundra site in NE Siberia. Field data showed that NDVI increased and albedo decreased with increasing deciduous shrub cover. We then selected four Arctic tundra study areas and compiled annual growing season maximum NDVI and minimum albedo maps from MODIS satellite data (2000-10) and related these satellite products to tundra vegetation types (shrub, graminoid, barren and wetland tundra) and regional summer temperature. We observed that maximum NDVI was greatest in shrub tundra and that inter-annual variation was negatively related to summer minimum albedo but showed no consistent relationship with summer temperature. Shrub tundra showed higher albedo than wetland and barren tundra in all four study areas. These results suggest that a northwards shift of shrub tundra might not lead to a decrease in summer minimum albedo during the snow-free season when replacing wetland tundra. A fully integrative study is however needed to link results from satellite data with in situ observations across the Arctic to test the effect of increasing shrub cover on summer albedo in different tundra vegetation types.

  17. Spectral albedo of seasonal snow during intensive melt period at Sodankylä, beyond the Arctic Circle

    Directory of Open Access Journals (Sweden)

    O. Meinander

    2013-04-01

    Full Text Available We have measured spectral albedo, as well as ancillary parameters, of seasonal European Arctic snow at Sodankylä, Finland (67°22' N, 26°39' E. The springtime intensive melt period was observed during the Snow Reflectance Transition Experiment (SNORTEX in April 2009. The upwelling and downwelling spectral irradiance, measured at 290–550 nm with a double monochromator spectroradiometer, revealed albedo values of ~0.5–0.7 for the ultraviolet and visible range, both under clear sky and variable cloudiness. During the most intensive snowmelt period of four days, albedo decreased from 0.65 to 0.45 at 330 nm, and from 0.72 to 0.53 at 450 nm. In the literature, the UV and VIS albedo for clean snow are ~0.97–0.99, consistent with the extremely small absorption coefficient of ice in this spectral region. Our low albedo values were supported by two independent simultaneous broadband albedo measurements, and simulated albedo data. We explain the low albedo values to be due to (i large snow grain sizes up to ~3 mm in diameter; (ii meltwater surrounding the grains and increasing the effective grain size; (iii absorption caused by impurities in the snow, with concentration of elemental carbon (black carbon in snow of 87 ppb, and organic carbon 2894 ppb, at the time of albedo measurements. The high concentrations of carbon, detected by the thermal–optical method, were due to air masses originating from the Kola Peninsula, Russia, where mining and refining industries are located.

  18. On the importance of the albedo parameterization for the mass balance of the Greenland ice sheet in EC-Earth

    Directory of Open Access Journals (Sweden)

    M. M. Helsen

    2017-08-01

    Full Text Available The albedo of the surface of ice sheets changes as a function of time due to the effects of deposition of new snow, ageing of dry snow, bare ice exposure, melting and run-off. Currently, the calculation of the albedo of ice sheets is highly parameterized within the earth system model EC-Earth by taking a constant value for areas with thick perennial snow cover. This is an important reason why the surface mass balance (SMB of the Greenland ice sheet (GrIS is poorly resolved in the model. The purpose of this study is to improve the SMB forcing of the GrIS by evaluating different parameter settings within a snow albedo scheme. By allowing ice-sheet albedo to vary as a function of wet and dry conditions, the spatial distribution of albedo and melt rate improves. Nevertheless, the spatial distribution of SMB in EC-Earth is not significantly improved. As a reason for this, we identify omissions in the current snow albedo scheme, such as separate treatment of snow and ice and the effect of refreezing. The resulting SMB is downscaled from the lower-resolution global climate model topography to the higher-resolution ice-sheet topography of the GrIS, such that the influence of these different SMB climatologies on the long-term evolution of the GrIS is tested by ice-sheet model simulations. From these ice-sheet simulations we conclude that an albedo scheme with a short response time of decaying albedo during wet conditions performs best with respect to long-term simulated ice-sheet volume. This results in an optimized albedo parameterization that can be used in future EC-Earth simulations with an interactive ice-sheet component.

  19. The response of Arctic vegetation to the summer climate: relation between shrub cover, NDVI, surface albedo and temperature

    International Nuclear Information System (INIS)

    Blok, Daan; Heijmans, Monique M P D; Berendse, Frank; Schaepman-Strub, Gabriela; Bartholomeus, Harm; Maximov, Trofim C

    2011-01-01

    Recently observed Arctic greening trends from normalized difference vegetation index (NDVI) data suggest that shrub growth is increasing in response to increasing summer temperature. An increase in shrub cover is expected to decrease summer albedo and thus positively feed back to climate warming. However, it is unknown how albedo and NDVI are affected by shrub cover and inter-annual variations in the summer climate. Here, we examine the relationship between deciduous shrub fractional cover, NDVI and albedo using field data collected at a tundra site in NE Siberia. Field data showed that NDVI increased and albedo decreased with increasing deciduous shrub cover. We then selected four Arctic tundra study areas and compiled annual growing season maximum NDVI and minimum albedo maps from MODIS satellite data (2000-10) and related these satellite products to tundra vegetation types (shrub, graminoid, barren and wetland tundra) and regional summer temperature. We observed that maximum NDVI was greatest in shrub tundra and that inter-annual variation was negatively related to summer minimum albedo but showed no consistent relationship with summer temperature. Shrub tundra showed higher albedo than wetland and barren tundra in all four study areas. These results suggest that a northwards shift of shrub tundra might not lead to a decrease in summer minimum albedo during the snow-free season when replacing wetland tundra. A fully integrative study is however needed to link results from satellite data with in situ observations across the Arctic to test the effect of increasing shrub cover on summer albedo in different tundra vegetation types.

  20. Preliminary Modelling of Mass Flux at the Surface of Plant Leaves within the MELiSSA Higher Plant Compartments

    Science.gov (United States)

    Holmberg, Madeleine; Paille, Christel; Lasseur, Christophe

    The ESA project Micro Ecological Life Support System Alternative (MELiSSA) is an ecosystem of micro-organisms and higher plants, constructed with the objective of being operated as a tool to understand artificial ecosystems to be used for a long-term or permanent manned planetary base (e.g. Moon or Mars). The purpose of such a system is to provide for generation of food, water recycling, atmospheric regeneration and waste management within defined standards of quality and reliability. As MELiSSA consists of individual compartments which are connected to each other, the robustness of the system is fully dependent on the control of each compartment, as well as the flow management between them. Quality of consumables and reliability of the ecosystem rely on the knowledge, understanding and control of each of the components. This includes the full understanding of all processes related to the higher plants. To progress in that direction, this paper focuses on the mechanical processes driving the gas and liquid exchanges between the plant leaf and its environment. The process responsible for the mass transfer on the surface of plant leaves is diffusion. The diffusion flux is dependent on the behaviour of the stoma of the leaf and also on the leaf boundary layer (BL). In this paper, the physiology of the leaf is briefly examined in order to relate parameters such as light quality, light quantity, CO2 concentration, temperature, leaf water potential, humidity, vapour pressure deficit (VPD) gradients and pollutants to the opening or closing of stomata. The diffusion process is described theoretically and the description is compared to empirical approaches. The variables of the BL are examined and the effect airflow in the compartment has on the BL is investigated. Also presented is the impact changes in different environmental parameters may have on the fluid exchanges. Finally, some tests, to evaluate the accuracy of the concluded model, are suggested.

  1. Application of indirect immunofluorescent test with an improved HEp-2 substrate tranfected with human Ro60/SSA autoantigens

    International Nuclear Information System (INIS)

    Lv Liangjing; Chen Shunle; Gu Yueying; Shen Nan; Bao Chunde; Wang Yuan; Xue Feng; Ye Peng; Yu Chongzhao

    2006-01-01

    To develop an improved substrate for indirect immunofluorescent test (IIF) to detect anti-Ro/SSA autoantibodies, the human 60-kDa Ro/SSA autoantigens (Ro60) cDNAs were obtained from placental cDNA library using PCR and were cloned into the mammalian expression vectorpEGFP-C1. Then the recombinant plasmids were transfected into HEp-2 cells. We con- firmed the overexpression, localization and antigenicity of fusion proteins in transfected cells by means of fluorescence microscopy, immunoblotting and IIF. HEp-2 and HEp-Ro60 was analyzed by IIF using a panel of 10 precipitinpositive anti-Ro human sera simultaneously. Stable expression of Ro60-GFP (green fluorescent protein) fusion proteins maintained ten more generations. And Ro60-GFP kept the antigenicity of Ro and had its own characteristic immunofluorescent pattern in HEp-Ro60 cells. The transfectants dramatically increased the sensitivity of IIF testing (a mean increase of 6.7-fold in endpoint titer, P<0.01). Eight (8/10) positive an- ti-Ro sera showed characteristic immunofluorescent pattern on HEp-Ro60, including two sera which were antinuclear antibodies (ANA) negative on untransfected HEp-2. IIF-ANA in all healthy sera were negative on HEp-Ro60. As a kind of new substrate of IIF, the Ro60 transfectants can be used to detect anti-Ro antibodies. In addition, transfected HEp-2 cells kept the immunofluorescent property of HEp-2 cells in IIF-ANA tests and could be employed as substrate for the routine IIF-ANA detection. The method improved the sensitivity of IIF-ANA. (authors)

  2. Surface photometric properties and albedo changes in the central equatorial region of Mars

    Science.gov (United States)

    Strickland, Edwin L., III

    1992-12-01

    Comparison of the Viking Orbiter 2 Approach mosaic taken 11 Mars months later provides qualitative information on the photometric properties of the martian albedo features, and the distribution of dust and sand deposits responsible for the atmosphere near the northern summer solstice. The approach mosaic was taken at L s 106 degrees (early N. summer), phase angle 106 degrees; and airmasses varying from 4.6 at 30 degrees N to 3.3 near 10 degrees S. The apoapsis mosaic was taken in four sequences between L s 72 degrees and 76 degrees (late N. spring), near phase angles of 47 degrees, and at airmasses near 2.5. Systematic differences in the photometric decalibrations used to generate these mosaics may induce multiplicative errors of 5-10 percent of the observed albedos in comparisons of the mosaics, but they are probably nearer 3 percent of the albedos. In the study area (30 degrees N to 20 degrees S, 57 degrees E to 75 degrees W), scene-average approach Minnaert albedos were about 10 percent greater than apoapsis albedos and slightly less 'red'. The preferred explanation for the observed approach-apoapsis albedo difference is that both Arabia and Meridiani materials are smoother on millimeter and larger scales than other units in the study area. This is in good agreement with preliminary conclusions of Thorpe and (for dark intracrater Meridiani splotches) Regner et al. This is also consistent with reasonable models of these surfaces. 'Dark Blue' Meridiani surfaces are interpreted as consisting of sand dunes and sand sheets, which would be expected to have macroscopically smooth, nonshadowing surfaces. Viking Lander images of the surfaces at both landing sites show that smooth drift area's brightnesses are close to those of adjacent rough soil areas at low phase angles, but drifts become much brighter than rough soils when looking up-sun at high phase angles. Smooth patches of duricrust at both landing sites, interpreted by Strickland as eolian deposits (regardless of

  3. Surface photometric properties and albedo changes in the central equatorial region of Mars

    Science.gov (United States)

    Strickland, Edwin L., III

    1992-01-01

    Comparison of the Viking Orbiter 2 Approach mosaic taken 11 Mars months later provides qualitative information on the photometric properties of the martian albedo features, and the distribution of dust and sand deposits responsible for the atmosphere near the northern summer solstice. The approach mosaic was taken at L (sub s) 106 degrees (early N. summer), phase angle 106 degrees; and airmasses varying from 4.6 at 30 degrees N to 3.3 near 10 degrees S. The apoapsis mosaic was taken in four sequences between L (sub s) 72 degrees and 76 degrees (late N. spring), near phase angles of 47 degrees, and at airmasses near 2.5. Systematic differences in the photometric decalibrations used to generate these mosaics may induce multiplicative errors of 5-10 percent of the observed albedos in comparisons of the mosaics, but they are probably nearer 3 percent of the albedos. In the study area (30 degrees N to 20 degrees S, 57 degrees E to 75 degrees W), scene-average approach Minnaert albedos were about 10 percent greater than apoapsis albedos and slightly less 'red'. The preferred explanation for the observed approach-apoapsis albedo difference is that both Arabia and Meridiani materials are smoother on millimeter and larger scales than other units in the study area. This is in good agreement with preliminary conclusions of Thorpe and (for dark intracrater Meridiani splotches) Regner et al. This is also consistent with reasonable models of these surfaces. 'Dark Blue' Meridiani surfaces are interpreted as consisting of sand dunes and sand sheets, which would be expected to have macroscopically smooth, nonshadowing surfaces. Viking Lander images of the surfaces at both landing sites show that smooth drift area's brightnesses are close to those of adjacent rough soil areas at low phase angles, but drifts become much brighter than rough soils when looking up-sun at high phase angles. Smooth patches of duricrust at both landing sites, interpreted by Strickland as eolian deposits

  4. The price of snow: albedo valuation and a case study for forest management

    International Nuclear Information System (INIS)

    Lutz, David A; Howarth, Richard B

    2015-01-01

    Several climate frameworks have included the role of carbon storage in natural landscapes as a potential mechanism for climate change mitigation. This has resulted in an incentive to grow and maintain intact long-lived forest ecosystems. However, recent research has suggested that the influence of albedo-related radiative forcing can impart equal and in some cases greater magnitudes of climate mitigation compared to carbon storage in forests where snowfall is common and biomass is slow-growing. While several methodologies exist for relating albedo-associated radiative forcing to carbon storage for the analysis of the tradeoffs of these ecosystem services, they are varied, and they have yet to be contrasted in a case study with implications for future forest management. Here we utilize four methodologies for calculating a shadow price for albedo radiative forcing and apply the resulting eight prices to an ecological and economic forest model to examine the effects on optimal rotation periods on two different forest stands in the White Mountain National Forest in New Hampshire, USA. These pricing methodologies produce distinctly different shadow prices of albedo, varying from a high of 9.36 × 10 −4 and a low of 1.75 × 10 −5 $w −1 yr −1 in the initial year, to a high of 0.019 and a low of 3.55 × 10 −4 $w −1 yr −1 in year 200 of the simulation. When implemented in the forest model, optimal rotation periods also varied considerably, from a low of 2 to a high of 107 years for a spruce-fir stand and from 35 to 80 years for a maple-beech-birch stand. Our results suggest that the choice of climate metrics and pricing methodologies for use with forest albedo alter albedo prices considerably, may substantially adjust optimal rotation period length, and therefore may have consequences with respect to forest land cover change. (letter)

  5. Changes in Snow Albedo Resulting from Snow Darkening Caused by Black Carbon

    Science.gov (United States)

    Engels, J.; Kloster, S.; Bourgeois, Q.

    2014-12-01

    We investigate the potential impact of snow darkening caused by pre-industrial and present-day black carbon (BC) emissions on snow albedo and subsequently climate. To assess this impact, we implemented the effect of snow darkening caused by BC emitted from natural as well as anthropogenic sources into the Max Planck Institute for Meteorology Earth System Model (MPI-M ESM). Considerable amounts of BC are emitted e.g. from fires and are transported through the atmosphere for several days before being removed by rain or snow precipitation in snow covered regions. Already very small quantities of BC reduce the snow reflectance significantly, with consequences for snow melting and snow spatial coverage. We implemented the snow albedo reduction caused by BC contamination and snow aging in the one layer land surface component (JSBACH) of the atmospheric general circulation model ECHAM6, developed at MPI-M. For this we used the single-layer simulator of the SNow, Ice, and Aerosol Radiation (SNICAR-Online (Flanner et al., 2007); http://snow.engin.umich.edu) model to derive snow albedo values for BC in snow concentrations ranging between 0 and 1500 ng(BC)/g(snow) for different snow grain sizes for the visible (0.3 - 0.7 μm) and near infrared range (0.7 - 1.5 μm). As snow grains grow over time, we assign different snow ages to different snow grain sizes (50, 150, 500, and 1000 μm). Here, a radius of 50 μm corresponds to new snow, whereas a radius of 1000 μm corresponds to old snow. The deposition rates of BC on snow are prescribed from previous ECHAM6-HAM simulations for two time periods, pre-industrial (1880-1889) and present-day (2000-2009), respectively. We perform a sensitivity study regarding the scavenging of BC by snow melt. To evaluate the newly implemented albedo scheme we will compare the modeled black carbon in snow concentrations to observed ones. Moreover, we will show the impact of the BC contamination and snow aging on the simulated snow albedo. The

  6. Global warming related transient albedo feedback in the Arctic and its relation to the seasonality of sea ice

    Science.gov (United States)

    Andry, Olivier; Bintanja, Richard; Hazeleger, Wilco

    2015-04-01

    The Arctic is warming two to three times faster than the global average. Arctic sea ice cover is very sensitive to this warming and has reached historic minima in late summer in recent years (i.e. 2007, 2012). Considering that the Arctic Ocean is mainly ice-covered and that the albedo of sea ice is very high compared to that of open water, the change in sea ice cover is very likely to have a strong impact on the local surface albedo feedback. Here we quantify the temporal changes in surface albedo feedback in response to global warming. Usually feedbacks are evaluated as being representative and constant for long time periods, but we show here that the strength of climate feedbacks in fact varies strongly with time. For instance, time series of the amplitude of the surface albedo feedback, derived from future climate simulations (CIMP5, RCP8.5 up to year 2300) using a kernel method, peaks around the year 2100. This maximum is likely caused by an increased seasonality in sea-ice cover that is inherently associated with sea ice retreat. We demonstrate that the Arctic average surface albedo has a strong seasonal signature with a maximum in spring and a minimum in late summer/autumn. In winter when incoming solar radiation is minimal the surface albedo doesn't have an important effect on the energy balance of the climate system. The annual mean surface albedo is thus determined by the seasonality of both downwelling shortwave radiation and sea ice cover. As sea ice cover reduces the seasonal signature is modified, the transient part from maximum sea ice cover to its minimum is shortened and sharpened. The sea ice cover is reduced when downwelling shortwave radiation is maximum and thus the annual surface albedo is drastically smaller. Consequently the change in annual surface albedo with time will become larger and so will the surface albedo feedback. We conclude that a stronger seasonality in sea ice leads to a stronger surface albedo feedback, which accelerates

  7. Using MERRA-2 analysis fields to simulate limb scattered radiance profiles for inhomogeneous atmospheric lines of sight: Preparation for data assimilation of OMPS LP radiances through 2D single-scattering GSLS radiative transfer model development

    Science.gov (United States)

    Loughman, R. P.; Bhartia, P. K.; Moy, L.; Kramarova, N. A.; Wargan, K.

    2016-12-01

    Many remote sensing techniques used to monitor the Earth's upper atmosphere fall into the broad category of "limb viewing" (LV) measurements, which includes any method for which the line of sight (LOS) fails to intersect the surface. Occultation, limb emission and limb scattering (LS) measurements are all LV methods that offer strong sensitivity to changes in the atmosphere near the tangent point of the LOS, due to the enhanced geometric path through the tangent layer (where the concentration also typically peaks, for most atmospheric species). But many of the retrieval algorithms used to interpret LV measurements assume that the atmosphere consists of "spherical shells", in which the atmospheric properties vary only with altitude (creating a 1D atmosphere). This assumption simplifies the analysis, but at the possible price of misinterpreting measurements made in the real atmosphere. In this presentation, we focus on the problem of LOS inhomogeneity for LS measurements made by the OMPS Limb Profiler (LP) instrument during the 2015 ozone hole period. The GSLS radiative transfer model (RTM) used in the default OMPS LP algorithms assumes a spherical-shell atmosphere defined at levels spaced 1 km apart, with extinction coefficients assumed to vary linearly with height between levels. Several recent improvements enable an updated single-scattering version of the GSLS RTM to ingest 3D MERRA-2 analysis fields (including temperature, pressure, and ozone concentration) when creating the model atmosphere, by introducing flexible altitude grids, flexible atmospheric specification along the LOS, and improved treatment of the radiative transfer within each atmospheric layer. As a result, the effect of LOS inhomogeneity on the current (1D) OMPS LP retrieval algorithm can now be studied theoretically, using realistic 3D atmospheric profiles. This work also represents a step towards enabling OMPS LP data to be ingested as part of future data assimilation efforts.

  8. 75 FR 30839 - Privacy Act of 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer...

    Science.gov (United States)

    2010-06-02

    ... 1974; CMS Computer Match No. 2010-03, HHS Computer Match No. 1003, SSA Computer Match No. 1048, IRS... Services (CMS). ACTION: Notice of renewal of an existing computer matching program (CMP) that has an...'' section below for comment period. DATES: Effective Dates: CMS filed a report of the Computer Matching...

  9. TiSSA pleenum "Sotsiaaltöö kriisi ajal" : mida on sotsiaaltööl pakkuda ja kes saab sellest kasu? / Regina Lind

    Index Scriptorium Estoniae

    Lind, Regina

    2010-01-01

    22.-27. aug. 2010 toimus Tallinna Ülikoolis TiSSA doktorantide eelkonverents ja pleenum. Pleenumil peetud sotsiaalteadlaste ettekannetest. Esinesid: Holger Ziegler, Karin Böllert, Catrin Heite, Hans van Ewijk, Walter Lorenz, Mikko Mäntysaari, Heinz Sünker, Synnöve Karvinen-Niinikoski, Olga Borodkina

  10. Universal dependence of the total number albedo of photons on the mean number of photon scatterings

    Directory of Open Access Journals (Sweden)

    Ljubenov Vladan L.

    2011-01-01

    Full Text Available This paper presents the results of research on photon reflection from plane targets based on Monte Carlo simulations performed by the MCNP code. Five materials (water, concrete, aluminum, iron, and copper are examined in the area of initial photon energies of up to 200 keV. The values of the total number albedo for photons dependent on the initial photon energy or the mean number of photon scatterings are calculated and graphically presented. We have shown that the values of the total number albedo for different target materials, expressed as a function of the mean number of photon scatterings, are in good agreement with each other and can be approximated by simple, universal analytic functions obtained by the least squares method. The accuracy of these analytic appoximations is confirmed by their comparison with the results of PENELOPE and FOTELP Monte Carlo codes.

  11. Albedo of X-ray through the region of rarefaction wave

    International Nuclear Information System (INIS)

    Zhang Jun

    2001-01-01

    In the process of implosion indirectly driven by laser, the high temperature and low density plasma produced by X-ray ablation is in the state of non-local thermodynamic equilibrium. And the propagation of X-ray needs to be treated by transportation method. X-ray energy flow reflected by plasma depends on the density, temperature of radiation and electrons, and their space profiles if the plasma produced by ablation is fully ionized. In addition, the plasma parameters in the region of rarefaction wave is determined by means of a simplified model. The approach to compute X-ray albedo is presented and the analytical formulae of the albedo are given

  12. Characterization of a two-component thermoluminescent albedo dosemeter according to ISO 21909

    Energy Technology Data Exchange (ETDEWEB)

    Martins, M.M., E-mail: marcelo@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN), Av. Salvador Allende s/n, CEP 22780-160, Rio de Janeiro, RJ (Brazil); Mauricio, C.L.P., E-mail: claudia@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN), Av. Salvador Allende s/n, CEP 22780-160, Rio de Janeiro, RJ (Brazil); Pereira, W.W., E-mail: walsan@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN), Av. Salvador Allende s/n, CEP 22780-160, Rio de Janeiro, RJ (Brazil); Silva, A.X. da, E-mail: ademir@con.ufrj.b [Coordenacao dos Programas de Pos-Graduacao em Engenharia, COPPE/PEN Caixa Postal 68509, CEP 21941-972, Rio de Janeiro, RJ (Brazil)

    2011-05-15

    A two-component thermoluminescent albedo neutron monitoring system was developed at Instituto de Radioprotecao e Dosimetria, Brazil. As there is no Brazilian regulation for neutron individual monitoring service, the system was tested according to the ISO 21909 standard. This standard provides performance and test requirements for determining the acceptability of personal neutron dosemeters to be used for the measurement of personal dose equivalent, H{sub p}(10), in neutron fields with energies ranging from thermal to 20 MeV. Up to 40 dosemeters were used in order to accomplish satisfactorily the requirements of some tests. Despite operational difficulties, this albedo system passed all ISO 21909 performance requirements. The results and problems throughout this characterization are discussed in this paper.

  13. Measure of the albedo of a warm plasma in the XUV range

    Science.gov (United States)

    Busquet, Michel; Thais, Frederic; Geoffroy, Ghita; Raffestin, Didier

    2009-11-01

    It has been shown in a recent experience at PALS [1] that the radiative precursor celerity in front of a strong radiative shock is sensitive to the lateral radiative losses, thus to the albedo of the wall of a ``radiative shock tube.'' In the experiment presented here, we measure the albedo of various materials (Al, Cu, Au) heated by a Xenon gaz at temperature around 30 eV. The Xenon gas was heated by the ALISE laser in CESTA in Bordeaux (France). The emission of Xenon with and without the reflecting samples is measured with a spatially resolving XUV spectrograph in the 30-250 eV range. [4pt] [1] M. Busquet et al, HEDP 3, 8 (2007)

  14. Radioisotope albedo method for measuring thickness of polymers coatings on metal basis

    International Nuclear Information System (INIS)

    Kapranov, B.I.; Myakin'kova, L.V.; Shaverin, V.A.

    1986-01-01

    Theoretical analysis of albedo thickness measuring of polymer coating-metal composite has been made and experimental studies of the range of tested thicknesses of polymer coating when different metal bases and radiation sources are used have been conducted. It is shown that the thickness of polymer coating on metal can be measured using backscattered γ-radiation in the energy range of 20-120 keV at the error 0.15-0.8 mm, at that, for thickness up to 23 mm the use of 147 Pm isotope can be defined as the optimum one; for thicknesses up to 40 mm 241 Am should be used; at thicknesses up to 60 mm - 57 Co. The AGAT-1 albedo gamma thickness gage, designed for measuring thickness of fiber glass coating up to 20 mm on metal base, is described

  15. A semi empirical formula for the angular differential number albedo of low-energy photons

    Directory of Open Access Journals (Sweden)

    Marković Srpko

    2005-01-01

    Full Text Available Low-energy photon reflection from water, aluminum, and iron is simulated by the MCNP code and results are com pared with similar Monte Carlo calculations. For the energy range from 60 to 150 keV and for the normal incidence of initial photons, a universal shape of the normalized angular differential number albedo is observed and after that fitted by the curve fit ting procedure in form of a second order polynomial over the polar angle. Finally, a one-parameter formula for the angular differential number albedo is developed and verified for water through the comparison of results with the semi empirical formulae and Monte Carlo calculations of other authors.

  16. The evaluation of cutoff rigidities and reentrant albedo calculations for Palestine, Dallas, and Midland, Texas

    International Nuclear Information System (INIS)

    Shea, M.A.; Smart, D.F.

    1975-01-01

    By using the trajectory-tracing technique, cutoff rigidities for Palestine, Dallas, and Midland, Texas, have been calculated as a function of various zenith and azimuth angles. Extensive analysis of the trajectory calculations shows that there is a systematic uncertainty involved in computing the lowest allowed rigidity, and this uncertainty may be a significant fraction of the penumbral width. Continuation of the trajectory-tracing process below the Stormer cutoff allows an evaluation of the reentrant albedo, showing that the average invariant latitude of the guiding center of the trajectory at the albedo origin is the same as the average invariant latitude of the guiding center of the particle trajectory at the detection point. No significant difference in the cutoff rigidities for these locations is found when the external magnetic fields present in the magnetosphere are added to the geomagnetic field of internal origin

  17. A framework for consistent estimation of leaf area index, fraction of absorbed photosynthetically active radiation, and surface albedo from MODIS time-series data

    DEFF Research Database (Denmark)

    Xiao, Zhiqiang; Liang, Shunlin; Wang, Jindi

    2015-01-01

    -series MODerate Resolution Imaging Spectroradiometer (MODIS) surface reflectance data. If the reflectance data showed snow-free areas, an ensemble Kalman filter (EnKF) technique was used to estimate leaf area index (LAI) for a two-layer canopy reflectance model (ACRM) by combining predictions from a phenology...... model and the MODIS surface reflectance data. The estimated LAI values were then input into the ACRM to calculate the surface albedo and the fraction of absorbed photosynthetically active radiation (FAPAR). For snow-covered areas, the surface albedo was calculated as the underlying vegetation canopy...... albedo plus the weighted distance between the underlying vegetation canopy albedo and the albedo over deep snow. The LAI/FAPAR and surface albedo values estimated using this framework were compared with MODIS collection 5 eight-day 1-km LAI/FAPAR products (MOD15A2) and 500-m surface albedo product (MCD43...

  18. Accurate top of the atmosphere albedo determination from multiple views of the Multi-angle Imaging Spectro-Radiometer (MISR) instrument

    Energy Technology Data Exchange (ETDEWEB)

    Borel, C.C.; Gerstl, S.A.W. [Los Alamos National Lab., NM (United States); Tornow, C. [German Aerospace Research Establishment, Berlin (Germany)

    1996-05-01

    Changes in the Earth`s surface albedo impact the atmospheric and global energy budget and contribute to the global climate change. It is now recognized that multispectral and multiangular views of the Earth`s top of the atmosphere (TOA) albedo are necessary to provide information on albedo changes. In this paper we describe four semi- empirical bidirectional reflectance factor (BRF) models which are inverted for two and three unknowns. The retrieved BRF parameters are then used to compute the TOA spectral albedo for clear sky conditions. Using this approach we find that the albedo can be computed with better than one percent error in the visible and one and a half percent in the near infrared (NIR) for most surface types. Global monitoring of the earth radiation budget is one of the main goals in global change research programs. Thus global measurements of the TOA albedo are important. Our goals is to compute the TOA spectral albedo for clear sky conditions.

  19. The melt pond fraction and spectral sea ice albedo retrieval from MERIS data: validation and trends of sea ice albedo and melt pond fraction in the Arctic for years 2002–2011

    OpenAIRE

    L. Istomina; G. Heygster; M. Huntemann; P. Schwarz; G. Birnbaum; R. Scharien; C. Polashenski; D. Perovich; E. Zege; A. Malinka; A. Prikhach; I. Katsev

    2014-01-01

    The presence of melt ponds on the Arctic sea ice strongly affects the energy balance of the Arctic Ocean in summer. It affects albedo as well as transmittance through the sea ice, which has consequences on the heat balance and mass balance of sea ice. An algorithm to retrieve melt pond fraction and sea ice albedo (Zege et al., 2014) from the MEdium Resolution Imaging Spectrometer (MERIS) data is validated against aerial, ship borne and in situ campaign data. The result sho...

  20. Baring high-albedo soils by overgrazing - A hypothesized desertification mechanism

    Science.gov (United States)

    Otterman, J.

    1974-01-01

    Observations are reported of high-albedo soils denuded by overgrazing which appear bright, in high contrast to regions covered by natural vegetation. Measurements and modeling show that the denuded surfaces are cooler, when compared under sunlit conditions. This observed 'thermal depression' effect should, on theoretical grounds, result in a decreased lifting of air necessary for cloud formation and precipitation, and thus lead to regional climatic desertification.

  1. A FALSE POSITIVE FOR OCEAN GLINT ON EXOPLANETS: THE LATITUDE-ALBEDO EFFECT

    International Nuclear Information System (INIS)

    Cowan, Nicolas B.; Abbot, Dorian S.; Voigt, Aiko

    2012-01-01

    Identifying liquid water on the surface of planets is a high priority, as this traditionally defines habitability. One proposed signature of oceans is specular reflection ('glint'), which increases the apparent albedo of a planet at crescent phases. We post-process a global climate model of an Earth-like planet to simulate reflected light curves. Significantly, we obtain glint-like phase variations even though we do not include specular reflection in our model. This false positive is the product of two generic properties: (1) for modest obliquities, a planet's poles receive less orbit-averaged stellar flux than its equator, so the poles are more likely to be covered in highly reflective snow and ice; and (2) we show that reflected light from a modest-obliquity planet at crescent phases probes higher latitudes than at gibbous phases, therefore a planet's apparent albedo will naturally increase at crescent phase. We suggest that this 'latitude-albedo effect' will operate even for large obliquities: in that case the equator receives less orbit-averaged flux than the poles, and the equator is preferentially sampled at crescent phase. Using rotational and orbital color variations to map the surfaces of directly imaged planets and estimate their obliquity will therefore be a necessary pre-condition for properly interpreting their reflected phase variations. The latitude-albedo effect is a particularly convincing glint false positive for zero-obliquity planets, and such worlds are not amenable to latitudinal mapping. This effect severely limits the utility of specular reflection for detecting oceans on exoplanets.

  2. Quantifying the climate impacts of albedo changes due to biofuel production: a comparison with biogeochemical effects

    International Nuclear Information System (INIS)

    Caiazzo, Fabio; Malina, Robert; Staples, Mark D; Wolfe, Philip J; Yim, Steve H L; Barrett, Steven R H

    2014-01-01

    Lifecycle analysis is a tool widely used to evaluate the climate impact of greenhouse gas emissions attributable to the production and use of biofuels. In this paper we employ an augmented lifecycle framework that includes climate impacts from changes in surface albedo due to land use change. We consider eleven land-use change scenarios for the cultivation of biomass for middle distillate fuel production, and compare our results to previous estimates of lifecycle greenhouse gas emissions for the same set of land-use change scenarios in terms of CO 2 e per unit of fuel energy. We find that two of the land-use change scenarios considered demonstrate a warming effect due to changes in surface albedo, compared to conventional fuel, the largest of which is for replacement of desert land with salicornia cultivation. This corresponds to 222 gCO 2 e/MJ, equivalent to 3890% and 247% of the lifecycle GHG emissions of fuels derived from salicornia and crude oil, respectively. Nine of the land-use change scenarios considered demonstrate a cooling effect, the largest of which is for the replacement of tropical rainforests with soybean cultivation. This corresponds to − 161 gCO 2 e/MJ, or − 28% and − 178% of the lifecycle greenhouse gas emissions of fuels derived from soybean and crude oil, respectively. These results indicate that changes in surface albedo have the potential to dominate the climate impact of biofuels, and we conclude that accounting for changes in surface albedo is necessary for a complete assessment of the aggregate climate impacts of biofuel production and use. (paper)

  3. Measurement of spectral sea ice albedo at Qaanaaq fjord in northwest Greenland

    Science.gov (United States)

    Tanikawa, T.

    2017-12-01

    The spectral albedos of sea ice were measured at Qaanaaq fjord in northwest Greenland. Spectral measurements were conducted for sea ice covered with snow and sea ice without snow where snow was artificially removed around measurement point. Thickness of the sea ice was approximately 1.3 m with 5 cm of snow over the sea ice. The measurements show that the spectral albedos of the sea ice with snow were lower than those of natural pure snow especially in the visible regions though the spectral shapes were similar to each other. This is because the spectral albedos in the visible region have information of not only the snow but also the sea ice under the snow. The spectral albedos of the sea ice without the snow were approximately 0.4 - 0.5 in the visible region, 0.05-0.25 in the near-infrared region and almost constant of approximately 0.05 in the region of 1500 - 2500 nm. In the visible region, it would be due to multiple scattering by an air bubble within the sea ice. In contrast, in the near-infrared and shortwave infrared wavelengths, surface reflection at the sea ice surface would be dominant. Since a light absorption by the ice in these regions is relatively strong comparing to the visible region, the light could not be penetrated deeply within the sea ice, resulting that surface reflection based on Fresnel reflection would be dominant. In this presentation we also show the results of comparison between the radiative transfer calculation and spectral measurement data.

  4. Climate warming feedback from mountain birch forest expansion: reduced albedo dominates carbon uptake.

    Science.gov (United States)

    de Wit, Heleen A; Bryn, Anders; Hofgaard, Annika; Karstensen, Jonas; Kvalevåg, Maria M; Peters, Glen P

    2014-07-01

    Expanding high-elevation and high-latitude forest has contrasting climate feedbacks through carbon sequestration (cooling) and reduced surface reflectance (warming), which are yet poorly quantified. Here, we present an empirically based projection of mountain birch forest expansion in south-central Norway under climate change and absence of land use. Climate effects of carbon sequestration and albedo change are compared using four emission metrics. Forest expansion was modeled for a projected 2.6 °C increase in summer temperature in 2100, with associated reduced snow cover. We find that the current (year 2000) forest line of the region is circa 100 m lower than its climatic potential due to land-use history. In the future scenarios, forest cover increased from 12% to 27% between 2000 and 2100, resulting in a 59% increase in biomass carbon storage and an albedo change from 0.46 to 0.30. Forest expansion in 2100 was behind its climatic potential, forest migration rates being the primary limiting factor. In 2100, the warming caused by lower albedo from expanding forest was 10 to 17 times stronger than the cooling effect from carbon sequestration for all emission metrics considered. Reduced snow cover further exacerbated the net warming feedback. The warming effect is considerably stronger than previously reported for boreal forest cover, because of the typically low biomass density in mountain forests and the large changes in albedo of snow-covered tundra areas. The positive climate feedback of high-latitude and high-elevation expanding forests with seasonal snow cover exceeds those of afforestation at lower elevation, and calls for further attention of both modelers and empiricists. The inclusion and upscaling of these climate feedbacks from mountain forests into global models is warranted to assess the potential global impacts. © 2013 John Wiley & Sons Ltd.

  5. Quantifying the climate impacts of albedo changes due to biofuel production: a comparison with biogeochemical effects

    Science.gov (United States)

    Caiazzo, Fabio; Malina, Robert; Staples, Mark D.; Wolfe, Philip J.; Yim, Steve H. L.; Barrett, Steven R. H.

    2014-01-01

    Lifecycle analysis is a tool widely used to evaluate the climate impact of greenhouse gas emissions attributable to the production and use of biofuels. In this paper we employ an augmented lifecycle framework that includes climate impacts from changes in surface albedo due to land use change. We consider eleven land-use change scenarios for the cultivation of biomass for middle distillate fuel production, and compare our results to previous estimates of lifecycle greenhouse gas emissions for the same set of land-use change scenarios in terms of CO2e per unit of fuel energy. We find that two of the land-use change scenarios considered demonstrate a warming effect due to changes in surface albedo, compared to conventional fuel, the largest of which is for replacement of desert land with salicornia cultivation. This corresponds to 222 gCO2e/MJ, equivalent to 3890% and 247% of the lifecycle GHG emissions of fuels derived from salicornia and crude oil, respectively. Nine of the land-use change scenarios considered demonstrate a cooling effect, the largest of which is for the replacement of tropical rainforests with soybean cultivation. This corresponds to - 161 gCO2e/MJ, or - 28% and - 178% of the lifecycle greenhouse gas emissions of fuels derived from soybean and crude oil, respectively. These results indicate that changes in surface albedo have the potential to dominate the climate impact of biofuels, and we conclude that accounting for changes in surface albedo is necessary for a complete assessment of the aggregate climate impacts of biofuel production and use.

  6. Response of TLD-albedo and nuclear track dosimeters exposed to plutonium sources

    International Nuclear Information System (INIS)

    Brackenbush, L.W.; Baumgartner, W.V.; Fix, J.J.

    1991-12-01

    Neutron dosimetry has been extensively studied at Hanford since the mid-1940s. At the present time, Hanford contractors use thermoluminescent dosimeter (TLD)-albedo dosimeters to record the neutron dose equivalent received by workers. The energy dependence of the TLD-albedo dosimeter has been recognized and documented since introduced at Hanford in 1964 and numerous studies have helped assure the accuracy of dosimeters. With the recent change in Hanford's mission, there has been a significant decrease in the handling of plutonium tetrafluoride, and an increase in the handling of plutonium metal and plutonium oxide sources. This study was initiated to document the performance of the current Hanford TLD-albedo dosimeter under the low scatter conditions of the calibration laboratory and under the high scatter conditions in the work place under carefully controlled conditions at the Plutonium Finishing Plant (PFP). The neutron fields at the PFP facility were measured using a variety of instruments, including a multisphere spectrometer, tissue equivalent proportional counters, and specially calibrated rem meters. Various algorithms were used to evaluate the TLD-albedo dosimeters, and the results are given in this report. Using current algorithms, the dose equivalents evaluated for bare sources and sources with less than 2.5 cm (1 in.) of acrylic plastic shielding in high scatter conditions typical of glove box operations are reasonably accurate. Recently developed CR-39 track etch dosimeters (TEDs) were also exposed in the calibration laboratory and at the PFP. The results indicate that the TED dosimeters are quite accurate for both bare and moderated neutron sources. Until personnel dosimeter is available that incorporates a direct measure of the neutron dose to a person, technical uncertainties in the accuracy of the recorded data will continue

  7. Response of TLD-albedo and nuclear track dosimeters exposed to plutonium sources

    Energy Technology Data Exchange (ETDEWEB)

    Brackenbush, L.W.; Baumgartner, W.V.; Fix, J.J.

    1991-12-01

    Neutron dosimetry has been extensively studied at Hanford since the mid-1940s. At the present time, Hanford contractors use thermoluminescent dosimeter (TLD)-albedo dosimeters to record the neutron dose equivalent received by workers. The energy dependence of the TLD-albedo dosimeter has been recognized and documented since introduced at Hanford in 1964 and numerous studies have helped assure the accuracy of dosimeters. With the recent change in Hanford`s mission, there has been a significant decrease in the handling of plutonium tetrafluoride, and an increase in the handling of plutonium metal and plutonium oxide sources. This study was initiated to document the performance of the current Hanford TLD-albedo dosimeter under the low scatter conditions of the calibration laboratory and under the high scatter conditions in the work place under carefully controlled conditions at the Plutonium Finishing Plant (PFP). The neutron fields at the PFP facility were measured using a variety of instruments, including a multisphere spectrometer, tissue equivalent proportional counters, and specially calibrated rem meters. Various algorithms were used to evaluate the TLD-albedo dosimeters, and the results are given in this report. Using current algorithms, the dose equivalents evaluated for bare sources and sources with less than 2.5 cm (1 in.) of acrylic plastic shielding in high scatter conditions typical of glove box operations are reasonably accurate. Recently developed CR-39 track etch dosimeters (TEDs) were also exposed in the calibration laboratory and at the PFP. The results indicate that the TED dosimeters are quite accurate for both bare and moderated neutron sources. Until personnel dosimeter is available that incorporates a direct measure of the neutron dose to a person, technical uncertainties in the accuracy of the recorded data will continue.

  8. Response of TLD-albedo and nuclear track dosimeters exposed to plutonium sources

    Energy Technology Data Exchange (ETDEWEB)

    Brackenbush, L.W.; Baumgartner, W.V.; Fix, J.J.

    1991-12-01

    Neutron dosimetry has been extensively studied at Hanford since the mid-1940s. At the present time, Hanford contractors use thermoluminescent dosimeter (TLD)-albedo dosimeters to record the neutron dose equivalent received by workers. The energy dependence of the TLD-albedo dosimeter has been recognized and documented since introduced at Hanford in 1964 and numerous studies have helped assure the accuracy of dosimeters. With the recent change in Hanford's mission, there has been a significant decrease in the handling of plutonium tetrafluoride, and an increase in the handling of plutonium metal and plutonium oxide sources. This study was initiated to document the performance of the current Hanford TLD-albedo dosimeter under the low scatter conditions of the calibration laboratory and under the high scatter conditions in the work place under carefully controlled conditions at the Plutonium Finishing Plant (PFP). The neutron fields at the PFP facility were measured using a variety of instruments, including a multisphere spectrometer, tissue equivalent proportional counters, and specially calibrated rem meters. Various algorithms were used to evaluate the TLD-albedo dosimeters, and the results are given in this report. Using current algorithms, the dose equivalents evaluated for bare sources and sources with less than 2.5 cm (1 in.) of acrylic plastic shielding in high scatter conditions typical of glove box operations are reasonably accurate. Recently developed CR-39 track etch dosimeters (TEDs) were also exposed in the calibration laboratory and at the PFP. The results indicate that the TED dosimeters are quite accurate for both bare and moderated neutron sources. Until personnel dosimeter is available that incorporates a direct measure of the neutron dose to a person, technical uncertainties in the accuracy of the recorded data will continue.

  9. Spatiotemporal variability of Canadian High Arctic glacier surface albedo from MODIS data, 2001-2016

    Science.gov (United States)

    Mortimer, Colleen A.; Sharp, Martin

    2018-02-01

    Inter-annual variations and longer-term trends in the annual mass balance of glaciers in Canada's Queen Elizabeth Islands (QEI) are largely attributable to changes in summer melt. The largest source of melt energy in the QEI in summer is net shortwave radiation, which is modulated by changes in glacier surface albedo. We used measurements from the Moderate Resolution Imaging Spectroradiometer (MODIS) sensors to investigate large-scale spatial patterns, temporal trends, and variability in the summer surface albedo of QEI glaciers from 2001 to 2016. Mean summer black-sky shortwave broadband albedo (BSA) decreased at a rate of 0.029±0.025 decade-1 over that period. Larger reductions in BSA occurred in July (-0.050±0.031 decade-1). No change in BSA was observed in either June or August. Most of the decrease in BSA, which was greatest at lower elevations around the margins of the ice masses, occurred between 2007 and 2012, when mean summer BSA was anomalously low. The first principal component of the 16-year record of mean summer BSA was well correlated with the mean summer North Atlantic Oscillation index, except in 2006, 2010, and 2016, when the mean summer BSA appears to have been dominated by the August BSA. During the period 2001-2016, the mean summer land surface temperature (LST) over the QEI glaciers and ice caps increased by 0.049±0.038 °C yr-1, and the BSA record was negatively correlated (r: -0.86) with the LST record, indicative of a positive ice-albedo feedback that would increase rates of mass loss from the QEI glaciers.

  10. Pleistocene Park: the restoration of steppes as a tool to mitigate climate change through albedo effect

    Science.gov (United States)

    Zimov, N.; Loranty, M. M.; Edgar, C.; Kropp, H.; Zimov, S. A.

    2017-12-01

    In the late Pleistocene, the world largest ecosystem was the mammoth steppe. It stretched from the Iberian Peninsula to Canada and from the New Siberian Islands to China. It was a highly productive steppe ecosystem with numerous predators and herbivores that maintained the dominance of grasslands. With the end of the Pleistocene, the climate warmed and humans entered Siberia and the Americas. The introduction of humans as predators in these regions led to the extinction of most large animals, and the further degradation of the steppes. Mosses, shrubs and larch forest soon replaced grasses and herbs. Pleistocene Park is an experiment conducted in the far north of Siberia; its main goal is to revive the extinct steppe ecosystem in the Arctic. This would increase the richness of the northern ecosystems and, bioproductivity, and through a series of ecological mechanisms help to mitigate climate change. To conduct the experiment, was fenced 2000 hectares of land, and continue the ongoing process of introducing animals that either lived on this territory in the past or that can adapt to the modern northern environment. Through grazing, animals slowly transform the vegetation, replacing mosses, shrubs, and trees with grasses and herbs. Here we present the effects grazing animals have on the albedo of the landscape. Several years of year-round measurement of albedo and incoming and reflected radiation conducted in the grasslands in the park indicate substantially higher albedo compared with most modern ecosystems like larch forest and shrublands. Since grasses are lighter than forest, they reflect a higher portion of energy back to space. Results indicate the most dramatic difference in reflected solar radiation is in April and early May. Grasslands covered with snow reflect most of the sun's energy, while dark stems of forests and shrubs absorb that energy and promote warming. We argue that large-scale promotion of highly productive steppes in the Arctic will

  11. Clear-Sky Narrowband Albedo Variations Derived from VIRS and MODIS Data

    Science.gov (United States)

    Sun-Mack, Sunny; Chen, Yan; Arduini, Robert F.; Minnis, Patrick

    2004-01-01

    A critical parameter for detecting clouds and aerosols and for retrieving their microphysical properties is the clear-sky radiance. The Clouds and the Earth's Radiant Energy System (CERES) Project uses the visible (VIS; 0.63 m) and near-infrared (NIR; 1.6 or 2.13 m) channels available on same satellites as the CERES scanners. Another channel often used for cloud and aerosol, and vegetation cover retrievals is the vegetation (VEG; 0.86- m) channel that has been available on the Advanced Very High Resolution Radiometer (AVHRR) for many years. Generally, clear-sky albedo for a given surface type is determined for conditions when the vegetation is either thriving or dormant and free of snow. Snow albedo is typically estimated without considering the underlying surface type. The albedo for a surface blanketed by snow, however, should vary with surface type because the vegetation often emerges from the snow to varying degrees depending on the vertical dimensions of the vegetation. For example, a snowcovered prairie will probably be brighter than a snowcovered forest because the snow typically falls off the trees exposing the darker surfaces while the snow on a grassland at the same temperatures will likely be continuous and, therefore, more reflective. Accounting for the vegetation-induced differences should improve the capabilities for distinguishing snow and clouds over different surface types and facilitate improvements in the accuracy of radiative transfer calculations between the snow-covered surface and the atmosphere, eventually leading to improvements in models of the energy budgets over land. This paper presents a more complete analysis of the CERES spectral clear-sky reflectances to determine the variations in clear-sky top-of-atmosphere (TOA) albedos for both snow-free and snow-covered surfaces for four spectral channels using data from Terra and Aqua.. The results should be valuable for improved cloud retrievals and for modeling radiation fields.

  12. Accounting for radiative forcing from albedo change in future global land-use scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Jones, Andrew D. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Calvin, Katherine V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Collins, William D. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Univ. of California, Berkeley, CA (United States); Edmonds, James A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2015-08-01

    We demonstrate the effectiveness of a new method for quantifying radiative forcing from land use and land cover change (LULCC) within an integrated assessment model, the Global Change Assessment Model (GCAM). The method relies on geographically differentiated estimates of radiative forcing from albedo change associated with major land cover transitions derived from the Community Earth System Model. We find that conversion of 1 km² of woody vegetation (forest and shrublands) to non-woody vegetation (crops and grassland) yields between 0 and –0.71 nW/m² of globally averaged radiative forcing determined by the vegetation characteristics, snow dynamics, and atmospheric radiation environment characteristic within each of 151 regions we consider globally. Across a set of scenarios designed to span a range of potential future LULCC, we find LULCC forcing ranging from –0.06 to –0.29 W/m² by 2070 depending on assumptions regarding future crop yield growth and whether climate policy favors afforestation or bioenergy crops. Inclusion of this previously uncounted forcing in the policy targets driving future climate mitigation efforts leads to changes in fossil fuel emissions on the order of 1.5 PgC/yr by 2070 for a climate forcing limit of 4.5 Wm–2, corresponding to a 12–67 % change in fossil fuel emissions depending on the scenario. Scenarios with significant afforestation must compensate for albedo-induced warming through additional emissions reductions, and scenarios with significant deforestation need not mitigate as aggressively due to albedo-induced cooling. In all scenarios considered, inclusion of albedo forcing in policy targets increases forest and shrub cover globally.

  13. Land surface albedo and vegetation feedbacks enhanced the millennium drought in south-east Australia

    KAUST Repository

    Evans, Jason P.; Meng, Xianhong; McCabe, Matthew

    2017-01-01

    In this study, we have examined the ability of a regional climate model (RCM) to simulate the extended drought that occurred throughout the period of 2002 through 2007 in south-east Australia. In particular, the ability to reproduce the two drought peaks in 2002 and 2006 was investigated. Overall, the RCM was found to reproduce both the temporal and the spatial structure of the drought-related precipitation anomalies quite well, despite using climatological seasonal surface characteristics such as vegetation fraction and albedo. This result concurs with previous studies that found that about two-thirds of the precipitation decline can be attributed to the El Ninõ–Southern Oscillation (ENSO). Simulation experiments that allowed the vegetation fraction and albedo to vary as observed illustrated that the intensity of the drought was underestimated by about 10ĝ% when using climatological surface characteristics. These results suggest that in terms of drought development, capturing the feedbacks related to vegetation and albedo changes may be as important as capturing the soil moisture–precipitation feedback. In order to improve our modelling of multi-year droughts, the challenge is to capture all these related surface changes simultaneously, and provide a comprehensive description of land surface–precipitation feedback during the droughts development.

  14. Cellulose nanocrystal from pomelo (C. Grandis osbeck) albedo: Chemical, morphology and crystallinity evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Zain, Nor Fazelin Mat; Yusop, Salma Mohamad [Food Science Program, School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, Selangor (Malaysia); Ahmad, Ishak [Polymer Research Centre (PORCE), School of Chemical Sciences and Food Technology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, Selangor (Malaysia)

    2013-11-27

    Citrus peel is one of the under-utilized waste materials that have potential in producing a valuable fibre, which are cellulose and cellulose nanocrystal. Cellulose was first isolated from pomelo (C. Grandis Osbeck) albedo by combination of alkali treatment and bleaching process, followed by acid hydrolysis (65% H{sub 2}SO{sub 4}, 45 °C, 45min) to produce cellulose nanocrystal. The crystalline, structural, morphological and chemical properties of both materials were studied. Result reveals the crystallinity index obtained from X-ray diffraction for cellulose nanocrystal was found higher than extracted cellulose with the value of 60.27% and 57.47%, respectively. Fourier transform infrared showed that the chemical treatments removed most of the hemicellulose and lignin from the pomelo albedo fibre. This has been confirmed further by SEM and TEM for their morphological studies. These results showed that cellulose and cellulose nanocrystal were successfully obtained from pomelo albedo and might be potentially used in producing functional fibres for food application.

  15. Design characteristics of a three-component AEOI Neutriran Albedo Neutron Personnel Dosimeter

    International Nuclear Information System (INIS)

    Sohrabi, M.; Katouzi, M.

    1991-01-01

    In establishing a national personnel neutron dosimetry service in Iran, different parameters of the AEOI Neutriran Albedo Neutron Personnel Dosimeter (NANPD) have been optimized. A NANPD was designed with three dosimetry components to measure (a) direct thermal neutrons, (b) direct fast neutrons and (C) direct neutrons by the detection of the albedo neutrons reflected from the body. The dosimeter consists of one or more Lexan polycarbonate and/or CR-39 foils and two 10 B (n,α) 7 Li converters in a cadmium cover so arranged as to efficiently measure the three neutron dose components separately. The boron converter thickness, its position relative to the beam direction and its distance from the PC foil were studied and the results were incorporated into the design. The dose response of the dosimeter, its lower detection limit as well as the correction factors related to the field neutrons and albedo neutrons were also determined for a 238 Pu-Be, an 241 Am-Be and a 252 Cf sources. In this paper, the dosimeter design and its dosimetric characteristics are presented and discussed. (author)

  16. RECTIFIED ASTEROID ALBEDOS AND DIAMETERS FROM IRAS AND MSX PHOTOMETRY CATALOGS

    International Nuclear Information System (INIS)

    Ryan, Erin Lee; Woodward, Charles E.

    2010-01-01

    Rectified diameters and albedo estimates of 1517 main-belt asteroids selected from IRAS and the Mid-Course Space Experiment asteroid photometry catalogs are derived from updated infrared thermal models, the Standard Thermal Model and the Near-Earth Asteroid Thermal Model (NEATM), and Monte Carlo simulations, using new Minor Planet Center compilations of absolute magnitudes (H values) constrained by occultation- and radar-derived parameters. The NEATM approach produces a more robust estimate of albedos and diameters, yielding albedos of p v (NEATM mean) =0.081 ± 0.064. The asteroid beaming parameter (η) for the selected asteroids has a mean value of 1.07 ± 0.27, and the smooth distribution of η suggests that this parameter is independent of asteroid properties such as composition. No trends in η due to size-dependent rotation rates are evident. Comparison of derived values of η as a function of taxonomic type indicates that the beaming parameter values for S- and C-type asteroids are identical within the standard deviation of the population of beaming parameters.

  17. Factors affecting projected Arctic surface shortwave heating and albedo change in coupled climate models.

    Science.gov (United States)

    Holland, Marika M; Landrum, Laura

    2015-07-13

    We use a large ensemble of simulations from the Community Earth System Model to quantify simulated changes in the twentieth and twenty-first century Arctic surface shortwave heating associated with changing incoming solar radiation and changing ice conditions. For increases in shortwave absorption associated with albedo reductions, the relative influence of changing sea ice surface properties and changing sea ice areal coverage is assessed. Changes in the surface sea ice properties are associated with an earlier melt season onset, a longer snow-free season and enhanced surface ponding. Because many of these changes occur during peak solar insolation, they have a considerable influence on Arctic surface shortwave heating that is comparable to the influence of ice area loss in the early twenty-first century. As ice area loss continues through the twenty-first century, it overwhelms the influence of changes in the sea ice surface state, and is responsible for a majority of the net shortwave increases by the mid-twenty-first century. A comparison with the Arctic surface albedo and shortwave heating in CMIP5 models indicates a large spread in projected twenty-first century change. This is in part related to different ice loss rates among the models and different representations of the late twentieth century ice albedo and associated sea ice surface state. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  18. Effect of land albedo, CO2, orography, and oceanic heat transport on extreme climates

    Directory of Open Access Journals (Sweden)

    V. Romanova

    2006-01-01

    Full Text Available Using an atmospheric general circulation model of intermediate complexity coupled to a sea ice – slab ocean model, we perform a number of sensitivity experiments under present-day orbital conditions and geographical distribution to assess the possibility that land albedo, atmospheric CO2, orography and oceanic heat transport may cause an ice-covered Earth. Changing only one boundary or initial condition, the model produces solutions with at least some ice-free oceans in the low latitudes. Using some combination of these forcing parameters, a full Earth's glaciation is obtained. We find that the most significant factor leading to an ice-covered Earth is the high land albedo in combination with initial temperatures set equal to the freezing point. Oceanic heat transport and orography play only a minor role for the climate state. Extremely low concentrations of CO2 also appear to be insufficient to provoke a runaway ice-albedo feedback, but the strong deviations in surface air temperatures in the Northern Hemisphere point to the existence of a strong nonlinearity in the system. Finally, we argue that the initial condition determines whether the system can go into a completely ice covered state, indicating multiple equilibria, a feature known from simple energy balance models.

  19. Modulation of ice ages via precession and dust-albedo feedbacks

    Directory of Open Access Journals (Sweden)

    Ralph Ellis

    2016-11-01

    Full Text Available We present here a simple and novel proposal for the modulation and rhythm of ice-ages and interglacials during the late Pleistocene. While the standard Milankovitch-precession theory fails to explain the long intervals between interglacials, these can be accounted for by a novel forcing and feedback system involving CO2, dust and albedo. During the glacial period, the high albedo of the northern ice sheets drives down global temperatures and CO2 concentrations, despite subsequent precessional forcing maxima. Over the following millennia more CO2 is sequestered in the oceans and atmospheric concentrations eventually reach a critical minima of about 200 ppm, which combined with arid conditions, causes a die-back of temperate and boreal forests and grasslands, especially at high altitude. The ensuing soil erosion generates dust storms, resulting in increased dust deposition and lower albedo on the northern ice sheets. As northern hemisphere insolation increases during the next Milankovitch cycle, the dust-laden ice-sheets absorb considerably more insolation and undergo rapid melting, which forces the climate into an interglacial period. The proposed mechanism is simple, robust, and comprehensive in its scope, and its key elements are well supported by empirical evidence.

  20. BREESE-II: auxiliary routines for implementing the albedo option in the MORSE Monte Carlo code

    International Nuclear Information System (INIS)

    Cain, V.R.; Emmett, M.B.

    1979-07-01

    The routines in the BREESE package implement the albedo option in the MORSE Monte Carlo Code by providing (1) replacements for the default routines ALBIN and ALBDO in the MORSE Code, (2) an estimating routine ALBDOE compatible with the SAMBO package in MORSE, and (3) a separate program that writes a tape of albedo data in the proper format for ALBIN. These extensions of the package initially reported in 1974 were performed jointly by ORNL, Bechtel Power Corporation, and Science Applications, Inc. The first version of BREESE had a fixed number of outgoing polar angles and the number of outgoing azimuthal angles was a function of the value of the outgoing polar angle only. An examination of differential albedo data led to this modified version which allows the number of outgoing polar angles to be dependent upon the value of the incoming polar angle and the number of outgoing azimuthal angles to be a function of the value of both incoming and outgoing polar angles

  1. Derivation of High Spatial Resolution Albedo from UAV Digital Imagery: Application over the Greenland Ice Sheet

    Directory of Open Access Journals (Sweden)

    Jonathan C. Ryan

    2017-05-01

    Full Text Available Measurements of albedo are a prerequisite for modeling surface melt across the Earth's cryosphere, yet available satellite products are limited in spatial and/or temporal resolution. Here, we present a practical methodology to obtain centimeter resolution albedo products with accuracies of ±5% using consumer-grade digital camera and unmanned aerial vehicle (UAV technologies. Our method comprises a workflow for processing, correcting and calibrating raw digital images using a white reference target, and upward and downward shortwave radiation measurements from broadband silicon pyranometers. We demonstrate the method with a set of UAV sorties over the western, K-sector of the Greenland Ice Sheet. The resulting albedo product, UAV10A1, covers 280 km2, at a resolution of 20 cm per pixel and has a root-mean-square difference of 3.7% compared to MOD10A1 and 4.9% compared to ground-based broadband pyranometer measurements. By continuously measuring downward solar irradiance, the technique overcomes previous limitations due to variable illumination conditions during and between surveys over glaciated terrain. The current miniaturization of multispectral sensors and incorporation of upward facing radiation sensors on UAV packages means that this technique could become increasingly common in field studies and used for a wide range of applications. These include the mapping of debris, dust, cryoconite and bioalbedo, and directly constraining surface energy balance models.

  2. Derivation of high spatial resolution albedo from UAV digital imagery: application over the Greenland Ice Sheet

    Science.gov (United States)

    Ryan, Jonathan C.; Hubbard, Alun; Box, Jason E.; Brough, Stephen; Cameron, Karen; Cook, Joseph M.; Cooper, Matthew; Doyle, Samuel H.; Edwards, Arwyn; Holt, Tom; Irvine-Fynn, Tristram; Jones, Christine; Pitcher, Lincoln H.; Rennermalm, Asa K.; Smith, Laurence C.; Stibal, Marek; Snooke, Neal

    2017-05-01

    Measurements of albedo are a prerequisite for modelling surface melt across the Earth's cryosphere, yet available satellite products are limited in spatial and/or temporal resolution. Here, we present a practical methodology to obtain centimetre resolution albedo products with accuracies of 5% using consumer-grade digital camera and unmanned aerial vehicle (UAV) technologies. Our method comprises a workflow for processing, correcting and calibrating raw digital images using a white reference target, and upward and downward shortwave radiation measurements from broadband silicon pyranometers. We demonstrate the method with a set of UAV sorties over the western, K-sector of the Greenland Ice Sheet. The resulting albedo product, UAV10A1, covers 280 km2, at a resolution of 20 cm per pixel and has a root-mean-square difference of 3.7% compared to MOD10A1 and 4.9% compared to ground-based broadband pyranometer measurements. By continuously measuring downward solar irradiance, the technique overcomes previous limitations due to variable illumination conditions during and between surveys over glaciated terrain. The current miniaturization of multispectral sensors and incorporation of upward facing radiation sensors on UAV packages means that this technique will likely become increasingly attractive in field studies and used in a wide range of applications for high temporal and spatial resolution surface mapping of debris, dust, cryoconite and bioalbedo and for directly constraining surface energy balance models.

  3. Electron energy and charge albedos - calorimetric measurement vs Monte Carlo theory

    International Nuclear Information System (INIS)

    Lockwood, G.J.; Ruggles, L.E.; Miller, G.H.; Halbleib, J.A.

    1981-11-01

    A new calorimetric method has been employed to obtain saturated electron energy albedos for Be, C, Al, Ti, Mo, Ta, U, and UO 2 over the range of incident energies from 0.1 to 1.0 MeV. The technique was so designed to permit the simultaneous measurement of saturated charge albedos. In the cases of C, Al, Ta, and U the measurements were extended down to about 0.025 MeV. The angle of incidence was varied from 0 0 (normal) to 75 0 in steps of 15 0 , with selected measurements at 82.5 0 in Be and C. In each case, state-of-the-art predictions were obtained from a Monte Carlo model. The generally good agreement between theory and experiment over this extensive parameter space represents a strong validation of both the theoretical model and the new experimental method. Nevertheless, certain discrepancies at low incident energies, especially in high-atomic-number materials, and at all energies in the case of the U energy albedos are not completely understood

  4. The impact of short-term heat storage on the ice-albedo feedback loop

    Science.gov (United States)

    Polashenski, C.; Wright, N.; Perovich, D. K.; Song, A.; Deeb, E. J.

    2016-12-01

    The partitioning of solar energy in the ice-ocean-atmosphere environment is a powerful control over Arctic sea ice mass balance. Ongoing transitions of the sea ice toward a younger, thinner state are enhancing absorption of solar energy and contributing to further declines in sea ice in a classic ice-albedo feedback. Here we investigate the solar energy balance over shorter timescales. In particular, we are concerned with short term delays in the transfer of absorbed solar energy to the ice caused by heat storage in the upper ocean. By delaying the realization of ice melt, and hence albedo decline, heat storage processes effectively retard the intra-season ice-albedo feedback. We seek to quantify the impact and variability of such intra-season storage delays on full season energy absorption. We use in-situ data collected from Arctic Observing Network (AON) sea ice sites, synthesized with the results of imagery processed from high resolution optical satellites, and basin-scale remote sensing products to approach the topic. AON buoys are used to monitor the storage and flux of heat, while satellite imagery allows us to quantify the evolution of surrounding ice conditions and predict the aggregate scale solar absorption. We use several test sites as illustrative cases and demonstrate that temporary heat storage can have substantial impacts on seasonal energy absorption and ice loss. A companion to this work is presented by N. Wright at this meeting.

  5. The role of sea-ice albedo in the climate of slowly rotating aquaplanets

    Science.gov (United States)

    Salameh, Josiane; Popp, Max; Marotzke, Jochem

    2018-04-01

    We investigate the influence of the rotation period (P_{rot}) on the mean climate of an aquaplanet, with a focus on the role of sea-ice albedo. We perform aquaplanet simulations with the atmospheric general circulation model ECHAM6 for various rotation periods from one Earth-day to 365 Earth-days in which case the planet is synchronously rotating. The global-mean surface temperature decreases with increasing P_{rot} and sea ice expands equatorwards. The cooling of the mean climate with increasing P_{rot} is caused partly by the high surface albedo of sea ice on the dayside and partly by the high albedo of the deep convective clouds over the substellar region. The cooling caused by these deep convective clouds is weak for non-synchronous rotations compared to synchronous rotation. Sensitivity simulations with the sea-ice model switched off show that the global-mean surface temperature is up to 27 K higher than in our main simulations with sea ice and thus highlight the large influence of sea ice on the climate. We present the first estimates of the influence of the rotation period on the transition of an Earth-like climate to global glaciation. Our results suggest that global glaciation of planets with synchronous rotation occurs at substantially lower incoming solar irradiation than for planets with slow but non-synchronous rotation.

  6. Process-model simulations of cloud albedo enhancement by aerosols in the Arctic

    Science.gov (United States)

    Kravitz, Ben; Wang, Hailong; Rasch, Philip J.; Morrison, Hugh; Solomon, Amy B.

    2014-01-01

    A cloud-resolving model is used to simulate the effectiveness of Arctic marine cloud brightening via injection of cloud condensation nuclei (CCN), either through geoengineering or other increased sources of Arctic aerosols. An updated cloud microphysical scheme is employed, with prognostic CCN and cloud particle numbers in both liquid and mixed-phase marine low clouds. Injection of CCN into the marine boundary layer can delay the collapse of the boundary layer and increase low-cloud albedo. Albedo increases are stronger for pure liquid clouds than mixed-phase clouds. Liquid precipitation can be suppressed by CCN injection, whereas ice precipitation (snow) is affected less; thus, the effectiveness of brightening mixed-phase clouds is lower than for liquid-only clouds. CCN injection into a clean regime results in a greater albedo increase than injection into a polluted regime, consistent with current knowledge about aerosol–cloud interactions. Unlike previous studies investigating warm clouds, dynamical changes in circulation owing to precipitation changes are small. According to these results, which are dependent upon the representation of ice nucleation processes in the employed microphysical scheme, Arctic geoengineering is unlikely to be effective as the sole means of altering the global radiation budget but could have substantial local radiative effects. PMID:25404677

  7. Protein changes in the albedo of citrus fruits on postharvesting storage.

    Science.gov (United States)

    Lliso, Ignacio; Tadeo, Francisco R; Phinney, Brett S; Wilkerson, Curtis G; Talón, Manuel

    2007-10-31

    In this work, major protein changes in the albedo of the fruit peel of Murcott tangor (tangerine x sweet orange) during postharvest ageing were studied through 2D PAGE. Protein content in matured on-tree fruits and in fruits stored in nonstressing [99% relative humidity (RH) and 25 degrees C], cold (99% RH and 4 degrees C), and drought (60% RH and 25 degrees C) conditions was initially determined. Protein identification through MS/MS determinations revealed in all samples analyzed the occurrence of manganese superoxide dismutase (Mn SOD), actin, ATP synthase beta subunit (ATPase), citrus salt-stress associated protein (CitSap), ascorbate peroxidase (APX), translationally controlled tumor protein (TCTP), and a cysteine proteinase (CP) of the papain family. The latter protein was identified in two different gel spots, with different molecular mass, suggesting the simultaneous presence of the proteinase precursor and its active form. While Mn SOD, actin, ATPase, and CitSap were unchanged in the assayed conditions, TCTP and APX were downregulated during the postharvest ageing process. Ageing-induced APX repression was also reversed by drought. CP contents in albedo, which were similar in on- and off-tree fruits, were strongly dependent upon cold storage. The active/total CP protein ratio significantly increased after cold exposure. This proteomic survey indicates that major changes in protein content in the albedo of the peel of postharvest stored citrus fruits are apparently related to the activation of programmed cell death (PCD).

  8. Cellulose nanocrystal from pomelo (C. Grandis osbeck) albedo: Chemical, morphology and crystallinity evaluation

    International Nuclear Information System (INIS)

    Zain, Nor Fazelin Mat; Yusop, Salma Mohamad; Ahmad, Ishak

    2013-01-01

    Citrus peel is one of the under-utilized waste materials that have potential in producing a valuable fibre, which are cellulose and cellulose nanocrystal. Cellulose was first isolated from pomelo (C. Grandis Osbeck) albedo by combination of alkali treatment and bleaching process, followed by acid hydrolysis (65% H 2 SO 4 , 45 °C, 45min) to produce cellulose nanocrystal. The crystalline, structural, morphological and chemical properties of both materials were studied. Result reveals the crystallinity index obtained from X-ray diffraction for cellulose nanocrystal was found higher than extracted cellulose with the value of 60.27% and 57.47%, respectively. Fourier transform infrared showed that the chemical treatments removed most of the hemicellulose and lignin from the pomelo albedo fibre. This has been confirmed further by SEM and TEM for their morphological studies. These results showed that cellulose and cellulose nanocrystal were successfully obtained from pomelo albedo and might be potentially used in producing functional fibres for food application

  9. Land surface albedo and vegetation feedbacks enhanced the millennium drought in south-east Australia

    KAUST Repository

    Evans, Jason P.

    2017-01-24

    In this study, we have examined the ability of a regional climate model (RCM) to simulate the extended drought that occurred throughout the period of 2002 through 2007 in south-east Australia. In particular, the ability to reproduce the two drought peaks in 2002 and 2006 was investigated. Overall, the RCM was found to reproduce both the temporal and the spatial structure of the drought-related precipitation anomalies quite well, despite using climatological seasonal surface characteristics such as vegetation fraction and albedo. This result concurs with previous studies that found that about two-thirds of the precipitation decline can be attributed to the El Ninõ–Southern Oscillation (ENSO). Simulation experiments that allowed the vegetation fraction and albedo to vary as observed illustrated that the intensity of the drought was underestimated by about 10ĝ% when using climatological surface characteristics. These results suggest that in terms of drought development, capturing the feedbacks related to vegetation and albedo changes may be as important as capturing the soil moisture–precipitation feedback. In order to improve our modelling of multi-year droughts, the challenge is to capture all these related surface changes simultaneously, and provide a comprehensive description of land surface–precipitation feedback during the droughts development.

  10. Iron alteration minerals in the visible and near-infrared spectra of low-albedo asteroids

    Science.gov (United States)

    Vilas, Faith; Jarvis, Kandy S.; Gaffey, Michael J.

    1994-01-01

    Absorption features centered near 0.60-0.65 and 0.80-0.90 micrometers have been identified in the spectra of five low-albedo main-belt and outer-belt asteroids. These absorption features are attributed respectively to the (6)A(sub 1) goes to (4)T(sub 2)(G) and (6)A(sub 1) goes to (4)T(sub 1)(G) charge transfer transitions in minerals such as goethite, hematite, and jarosite that are products of the aqueous alteration of anhydrous silicates. A shoulder near 0.63 micrometers has also been identified in the absorption feature centered near 0.7 micrometers attributed to oxidized iron in phyllosilicates found predominantly in C- and G-class asteroids reflectance spectra. The coexistence of iron oxides with phyllosilicates in asteroids believed to have undergone aqueous alteration would be expected based upon analogy with terrestrial aqueous alteration and the observed mineralogy of carbonaceous chondrites. The number of low-albedo asteroids having only iron alteration absorption features compared to the number of low-albedo asteroids having spectral characteristics indicative of phyllosilicates is small. Either the conditions under which these asteroids formed are rare, or the iron alteration minerals could be formed in the interiors of objects where phyllosilicates dominate the surface mineralogy.

  11. Determination of the double angular and energy differential gamma-ray albedo by using the Monte Carlo method; Contribution a la determination de l`albedo doublement differentiel en angle et en energie des rayonnements gamma

    Energy Technology Data Exchange (ETDEWEB)

    Miss, J

    1998-06-01

    The goal of this thesis was to study comprehensively photons energy and angular distributions of backscattered radiations. In general, this relation is described by the concept to the backscattered factor or doubly differential albedo. This concept is useful to study the particle propagation into the air space by simple or multiple reflections on materials There are two principal treatments to solve numerically this problem: the deterministic and probabilistic methods. We showed that deterministic methods furnish unsatisfactory results: that`s why we choice to develop a new gamma ray albedo estimator in the code TRIPOLI14 (three dimensional Monte Carlo code). So, we have been able to compute an important data base of doubly differential albedos. A physical analysis of these data showed that albedos can be simply described by parameter functions. These parameters were obtained by fitting the albedos of the data base over a complete range of incident and reflected energy and direction. So, we produced a very smaller data base of functions coefficients, instead of storing all the values of the doubly differential spectrum. It is so easy to make every albedo by linear interpolations on the coefficient of the new library. (author) 63 refs.

  12. MODIS/Terra+Aqua BRDF/Albedo Model Parameters 16-Day L3 Global 1km SIN Grid V005

    Data.gov (United States)

    National Aeronautics and Space Administration — The MODerate-resolution Imaging Spectroradiometer (MODIS) BRDF/Albedo Model Parameters product (MCD43B1) contains three-dimensional (3D) data sets providing users...

  13. Snow driven Radiative Forcing in High Latitude Areas of Disturbance Using Higher Resolution Albedo Products from Landsat and Sentinel-2

    Science.gov (United States)

    Erb, A.; Li, Z.; Schaaf, C.; Wang, Z.; Rogers, B. M.

    2017-12-01

    Land surface albedo plays an important role in the surface energy budget and radiative forcing by determining the proportion of absorbed incoming solar radiation available to drive photosynthesis and surface heating. In Arctic regions, albedo is particularly sensitive to land cover and land use change (LCLUC) and modeling efforts have shown it to be the primary driver of effective radiative forcing from the biogeophysical effects of LCLUC. In boreal forests, the effects of these changes are complicated during snow covered periods when newly exposed, highly reflective snow can serve as the primary driver of radiative forcing. In Arctic biomes disturbance scars from fire, pest and harvest can remain in the landscape for long periods of time. As such, understanding the magnitude and persistence of these disturbances, especially in the shoulder seasons, is critical. The Landsat and Sentinel-2 Albedo Products couple 30m and 20m surface reflectances with concurrent 500m BRDF Products from the MODerate resolution Imaging Spectroradiometer (MODIS). The 12 bit radiometric fidelity of Sentinel-2 and Landsat-8 allow for the inclusion of high-quality, unsaturated albedo calculations over snow covered surfaces at scales more compatible with fragmented landscapes. Recent work on the early spring albedo of fire scars has illustrated significant post-fire spatial heterogeneity of burn severity at the landscape scale and highlights the need for a finer spatial resolution albedo record. The increased temporal resolution provided by multiple satellite instruments also allows for a better understanding of albedo dynamics during the dynamic shoulder seasons and in historically difficult high latitude locations where persistent cloud cover limits high quality retrievals. Here we present how changes in the early spring albedo of recent boreal forest disturbance in Alaska and central Canada affects landscape-scale radiative forcing. We take advantage of the long historical Landsat record

  14. The effects of additional black carbon on Arctic sea ice surface albedo: variation with sea ice type and snow cover

    OpenAIRE

    A. A. Marks; M. D. King

    2013-01-01

    Black carbon in sea ice will decrease sea ice surface albedo through increased absorption of incident solar radiation, exacerbating sea ice melting. Previous literature has reported different albedo responses to additions of black carbon in sea ice and has not considered how a snow cover may mitigate the effect of black carbon in sea ice. Sea ice is predominately snow covered. Visible light absorption and light scattering coefficients are calculated for a typical first year and multi-y...

  15. Algorithm to retrieve the melt pond fraction and the spectral albedo of Arctic summer ice from satellite optical data

    OpenAIRE

    Zege, E.; Malinka, A.; Katsev, I.; Prikhach, A.; Heygster, Georg; Istomina, L.; Birnbaum, Gerit; Schwarz, Pascal

    2015-01-01

    A new algorithmto retrieve characteristics (albedo and melt pond fraction) of summer ice in the Arctic fromoptical satellite data is described. In contrast to other algorithms this algorithm does not use a priori values of the spectral albedo of the sea-ice constituents (such asmelt ponds,white ice etc.). Instead, it is based on an analytical solution for the reflection from sea ice surface. The algorithm includes the correction of the sought-for ice and ponds characteristics with...

  16. Cloud albedo changes in response to anthropogenic sulfate and non-sulfate aerosol forcings in CMIP5 models

    Directory of Open Access Journals (Sweden)

    L. Frey

    2017-07-01

    Full Text Available The effects of different aerosol types on cloud albedo are analysed using the linear relation between total albedo and cloud fraction found on a monthly mean scale in regions of subtropical marine stratocumulus clouds and the influence of simulated aerosol variations on this relation. Model experiments from the Coupled Model Intercomparison Project phase 5 (CMIP5 are used to separately study the responses to increases in sulfate, non-sulfate and all anthropogenic aerosols. A cloud brightening on the month-to-month scale due to variability in the background aerosol is found to dominate even in the cases where anthropogenic aerosols are added. The aerosol composition is of importance for this cloud brightening, that is thereby region dependent. There is indication that absorbing aerosols to some extent counteract the cloud brightening but scene darkening with increasing aerosol burden is generally not supported, even in regions where absorbing aerosols dominate. Month-to-month cloud albedo variability also confirms the importance of liquid water content for cloud albedo. Regional, monthly mean cloud albedo is found to increase with the addition of anthropogenic aerosols and more so with sulfate than non-sulfate. Changes in cloud albedo between experiments are related to changes in cloud water content as well as droplet size distribution changes, so that models with large increases in liquid water path and/or cloud droplet number show large cloud albedo increases with increasing aerosol. However, no clear relation between model sensitivities to aerosol variations on the month-to-month scale and changes in cloud albedo due to changed aerosol burden is found.

  17. Parameterizations for narrowband and broadband albedo of pure snow and snow containing mineral dust and black carbon

    Science.gov (United States)

    Dang, Cheng; Brandt, Richard E.; Warren, Stephen G.

    2015-06-01

    The reduction of snow spectral albedo by black carbon (BC) and mineral dust, both alone and in combination, is computed using radiative transfer modeling. Broadband albedo is shown for mass fractions covering the full range from pure snow to pure BC and pure dust, and for snow grain radii from 5 µm to 2500 µm, to cover the range of possible grain sizes on planetary surfaces. Parameterizations are developed for opaque homogeneous snowpacks for three broad bands used in general circulation models and several narrower bands. They are functions of snow grain radius and the mass fraction of BC and/or dust and are valid up to BC content of 10 ppm, needed for highly polluted snow. A change of solar zenith angle can be mimicked by changing grain radius. A given mass fraction of BC causes greater albedo reduction in coarse-grained snow; BC and grain radius can be combined into a single variable to compute the reduction of albedo relative to pure snow. The albedo reduction by BC is less if the snow contains dust, a common situation on mountain glaciers and in agricultural and grazing lands. Measured absorption spectra of mineral dust are critically reviewed as a basis for specifying dust properties for modeling. The effect of dust on snow albedo at visible wavelengths can be represented by an "equivalent BC" amount, scaled down by a factor of about 200. Dust has little effect on the near-IR albedo because the near-IR albedo of pure dust is similar to that of pure snow.

  18. Sensitivity of Greenland Ice Sheet surface mass balance to surface albedo parameterization: a study with a regional climate model

    OpenAIRE

    Angelen, J. H.; Lenaerts, J. T. M.; Lhermitte, S.; Fettweis, X.; Kuipers Munneke, P.; Broeke, M. R.; Meijgaard, E.; Smeets, C. J. P. P.

    2012-01-01

    We present a sensitivity study of the surface mass balance (SMB) of the Greenland Ice Sheet, as modeled using a regional atmospheric climate model, to various parameter settings in the albedo scheme. The snow albedo scheme uses grain size as a prognostic variable and further depends on cloud cover, solar zenith angle and black carbon concentration. For the control experiment the overestimation of absorbed shortwave radiation (+6%) at the K-transect (west Greenland) for the period 2004–2009 is...

  19. The effect of a dynamic background albedo scheme on Sahel/Sahara precipitation during the mid-Holocene

    Directory of Open Access Journals (Sweden)

    F. S. E. Vamborg

    2011-02-01

    Full Text Available We have implemented a new albedo scheme that takes the dynamic behaviour of the surface below the canopy into account, into the land-surface scheme of the MPI-ESM. The standard (static scheme calculates the seasonal canopy albedo as a function of leaf area index, whereas the background albedo is a gridbox constant derived from satellite measurements. The new (dynamic scheme additionally models the background albedo as a slowly changing function of organic matter in the ground and of litter and standing dead biomass covering the ground. We use the two schemes to investigate the interactions between vegetation, albedo and precipitation in the Sahel/Sahara for two time-slices: pre-industrial and mid-Holocene. The dynamic scheme represents the seasonal cycle of albedo and the correspondence between annual mean albedo and vegetation cover in a more consistent way than the static scheme. It thus gives a better estimate of albedo change between the two time periods. With the introduction of the dynamic scheme, precipitation is increased by 30 mm yr−1 for the pre-industrial simulation and by about 80 mm yr−1 for the mid-Holocene simulation. The present-day dry bias in the Sahel of standard ECHAM5 is thus reduced and the sensitivity of precipitation to mid-Holocene external forcing is increased by around one third. The locations of mid-Holocene lakes, as estimated from reconstructions, lie south of the modelled desert border in both mid-Holocene simulations. The magnitude of simulated rainfall in this area is too low to fully sustain lakes, however it is captured better with the dynamic scheme. The dynamic scheme leads to increased vegetation variability in the remaining desert region, indicating a higher frequency of green spells, thus reaching a better agreement with the vegetation distribution as derived from pollen records.

  20. Monitoring glacier albedo as a proxy to derive summer and annual surface mass balances from optical remote-sensing data

    Science.gov (United States)

    Davaze, Lucas; Rabatel, Antoine; Arnaud, Yves; Sirguey, Pascal; Six, Delphine; Letreguilly, Anne; Dumont, Marie

    2018-01-01

    Less than 0.25 % of the 250 000 glaciers inventoried in the Randolph Glacier Inventory (RGI V.5) are currently monitored with in situ measurements of surface mass balance. Increasing this archive is very challenging, especially using time-consuming methods based on in situ measurements, and complementary methods are required to quantify the surface mass balance of unmonitored glaciers. The current study relies on the so-called albedo method, based on the analysis of albedo maps retrieved from optical satellite imagery acquired since 2000 by the MODIS sensor, on board the TERRA satellite. Recent studies revealed substantial relationships between summer minimum glacier-wide surface albedo and annual surface mass balance, because this minimum surface albedo is directly related to the accumulation-area ratio and the equilibrium-line altitude. On the basis of 30 glaciers located in the French Alps where annual surface mass balance data are available, our study conducted on the period 2000-2015 confirms the robustness and reliability of the relationship between the summer minimum surface albedo and the annual surface mass balance. For the ablation season, the integrated summer surface albedo is significantly correlated with the summer surface mass balance of the six glaciers seasonally monitored. These results are promising to monitor both annual and summer glacier-wide surface mass balances of individual glaciers at a regional scale using optical satellite images. A sensitivity study on the computed cloud masks revealed a high confidence in the retrieved albedo maps, restricting the number of omission errors. Albedo retrieval artifacts have been detected for topographically incised glaciers, highlighting limitations in the shadow correction algorithm, although inter-annual comparisons are not affected by systematic errors.

  1. Bright is the New Black - Multi-Year Performance of Generic High-Albedo Roofs in an Urban Climate

    Science.gov (United States)

    Gaffin, S. R.; Imhoff, M.; Rosenzweig, C.; Khanbilvardi, R.; Pasqualini, A.; Kong, A. Y. Y.; Grillo, D.; Freed, A.; Hillel, D.; Hartung, E.

    2012-01-01

    High-albedo white and cool roofing membranes are recognized as a fundamental strategy that dense urban areas can deploy on a large scale, at low cost, to mitigate the urban heat island effect. We are monitoring three generic white membranes within New York City that represent a cross-section of the dominant white membrane options for U.S. flat roofs: (1) an ethylene propylene diene monomer (EPDM) rubber membrane; (2) a thermoplastic polyolefin (TPO) membrane and; (3) an asphaltic multi-ply built-up membrane coated with white elastomeric acrylic paint. The paint product is being used by New York City s government for the first major urban albedo enhancement program in its history. We report on the temperature and related albedo performance of these three membranes at three different sites over a multi-year period. The results indicate that the professionally installed white membranes are maintaining their temperature control effectively and are meeting the Energy Star Cool Roofing performance standards requiring a three-year aged albedo above 0.50. The EPDM membrane however shows evidence of low emissivity. The painted asphaltic surface shows high emissivity but lost about half of its initial albedo within two years after installation. Given that the acrylic approach is an important "do-it-yourself," low-cost, retrofit technique, and, as such, offers the most rapid technique for increasing urban albedo, further product performance research is recommended to identify conditions that optimize its long-term albedo control. Even so, its current multi-year performance still represents a significant albedo enhancement for urban heat island mitigation.

  2. The Influence of a Sandy Substrate, Seagrass, or Highly Turbid Water on Albedo and Surface Heat Flux

    Science.gov (United States)

    Fogarty, M. C.; Fewings, M. R.; Paget, A. C.; Dierssen, H. M.

    2018-01-01

    Sea-surface albedo is a combination of surface-reflected and water-leaving irradiance, but water-leaving irradiance typically contributes less than 15% of the total albedo in open-ocean conditions. In coastal systems, however, the bottom substrate or suspended particulate matter can increase the amount of backscattered light, thereby increasing albedo and decreasing net shortwave surface heat flux. Here a sensitivity analysis using observations and models predicts the effect of light scattering on albedo and the net shortwave heat flux for three test cases: a bright sand bottom, a seagrass canopy, and turbid water. After scaling to the full solar shortwave spectrum, daytime average albedo for the test cases is up to 0.20 and exceeds the value of 0.05 predicted using a commonly applied parameterization. Daytime net shortwave heat flux into the water is significantly reduced, particularly for waters with bright sediments, dense horizontal seagrass canopies waters with suspended particulate matter concentration ≥ 50 g m-3. Observations of a more vertical seagrass canopy within 0.2 and 1 m of the surface indicate the increase in albedo compared to the common parameterization is negligible. Therefore, we suggest that the commonly applied albedo lookup table can be used in coastal heat flux estimates in water as shallow as 1 m unless the bottom substrate is highly reflective or the water is highly turbid. Our model results provide guidance to researchers who need to determine albedo in highly reflective or highly turbid conditions but have no direct observations.

  3. Global Climate Forcing from Albedo Change Caused by Large-scale Deforestation and Reforestation: Quantification and Attribution of Geographic Variation

    Science.gov (United States)

    Jiao, Tong; Williams, Christopher A.; Ghimire, Bardan; Masek, Jeffrey; Gao, Feng; Schaaf, Crystal

    2017-01-01

    Large-scale deforestation and reforestation have contributed substantially to historical and contemporary global climate change in part through albedo-induced radiative forcing, with meaningful implications for forest management aiming to mitigate climate change. Associated warming or cooling varies widely across the globe due to a range of factors including forest type, snow cover, and insolation, but resulting geographic variation remain spoorly described and has been largely based on model assessments. This study provides an observation-based approach to quantify local and global radiative forcings from large-scale deforestation and reforestation and further examines mechanisms that result in the spatial heterogeneity of radiative forcing. We incorporate a new spatially and temporally explicit land cover-specific albedo product derived from Moderate Resolution Imaging Spectroradiometer with a historical land use data set (Land Use Harmonization product). Spatial variation in radiative forcing was attributed to four mechanisms, including the change in snow-covered albedo, change in snow-free albedo, snow cover fraction, and incoming solar radiation. We find an albedo-only radiative forcing (RF) of -0.819 W m(exp -2) if year 2000 forests were completely deforested and converted to croplands. Albedo RF from global reforestation of present-day croplands to recover year 1700 forests is estimated to be 0.161 W m)exp -2). Snow-cover fraction is identified as the primary factor in determining the spatial variation of radiative forcing in winter, while the magnitude of the change in snow-free albedo is the primary factor determining variations in summertime RF. Findings reinforce the notion that, for conifers at the snowier high latitudes, albedo RF diminishes the warming from forest loss and the cooling from forest gain more so than for other forest types, latitudes, and climate settings.

  4. Application of the Laplace transform method for the albedo boundary conditions in multigroup neutron diffusion eigenvalue problems in slab geometry

    International Nuclear Information System (INIS)

    Petersen, Claudio Zen; Vilhena, Marco T.; Barros, Ricardo C.

    2009-01-01

    In this paper the application of the Laplace transform method is described in order to determine the energy-dependent albedo matrix that is used in the boundary conditions multigroup neutron diffusion eigenvalue problems in slab geometry for nuclear reactor global calculations. In slab geometry, the diffusion albedo substitutes without approximation the baffle-reflector system around the active domain. Numerical results to typical test problems are shown to illustrate the accuracy and the efficiency of the Chebysheff acceleration scheme. (orig.)

  5. An Algorithm for the Retrieval of 30-m Snow-Free Albedo from Landsat Surface Reflectance and MODIS BRDF

    Science.gov (United States)

    Shuai, Yanmin; Masek, Jeffrey G.; Gao, Feng; Schaaf, Crystal B.

    2011-01-01

    We present a new methodology to generate 30-m resolution land surface albedo using Landsat surface reflectance and anisotropy information from concurrent MODIS 500-m observations. Albedo information at fine spatial resolution is particularly useful for quantifying climate impacts associated with land use change and ecosystem disturbance. The derived white-sky and black-sky spectral albedos maybe used to estimate actual spectral albedos by taking into account the proportion of direct and diffuse solar radiation arriving at the ground. A further spectral-to-broadband conversion based on extensive radiative transfer simulations is applied to produce the broadband albedos at visible, near infrared, and shortwave regimes. The accuracy of this approach has been evaluated using 270 Landsat scenes covering six field stations supported by the SURFace RADiation Budget Network (SURFRAD) and Atmospheric Radiation Measurement Southern Great Plains (ARM/SGP) network. Comparison with field measurements shows that Landsat 30-m snow-free shortwave albedos from all seasons generally achieve an absolute accuracy of +/-0.02 - 0.05 for these validation sites during available clear days in 2003-2005,with a root mean square error less than 0.03 and a bias less than 0.02. This level of accuracy has been regarded as sufficient for driving global and regional climate models. The Landsat-based retrievals have also been compared to the operational 16-day MODIS albedo produced every 8-days from MODIS on Terra and Aqua (MCD43A). The Landsat albedo provides more detailed landscape texture, and achieves better agreement (correlation and dynamic range) with in-situ data at the validation stations, particularly when the stations include a heterogeneous mix of surface covers.

  6. The global albedo of the Moon at 1064 nm from LOLA

    Science.gov (United States)

    Lucey, P. G.; Neumann, G. A.; Riner, M. A.; Mazarico, E.; Smith, D. E.; Zuber, M. T.; Paige, D. A.; Bussey, D. B.; Cahill, J. T.; McGovern, A.; Isaacson, P.; Corley, L. M.; Torrence, M. H.; Melosh, H. J.; Head, J. W.; Song, E.

    2014-07-01

    The Lunar Orbiter Laser Altimeter (LOLA) measures the backscattered energy of the returning altimetric laser pulse at its wavelength of 1064 nm, and these data are used to map the reflectivity of the Moon at zero-phase angle with a photometrically uniform data set. Global maps have been produced at 4 pixels per degree (about 8 km at the equator) and 2 km resolution within 20° latitude of each pole. The zero-phase geometry is insensitive to lunar topography, so these data enable characterization of subtle variations in lunar albedo, even at high latitudes where such measurements are not possible with the Sun as the illumination source. The geometric albedo of the Moon at 1064 nm was estimated from these data with absolute calibration derived from the Kaguya Multiband Imager and extrapolated to visual wavelengths. The LOLA estimates are within 2σ of historical measurements of geometric albedo. No consistent latitude-dependent variations in reflectance are observed, suggesting that solar wind does not dominate space weathering processes that modify lunar reflectance. The average normal albedo of the Moon is found to be much higher than that of Mercury consistent with prior measurements, but the normal albedo of the lunar maria is similar to that of Mercury suggesting a similar abundance of space weathering products. Regions within permanent shadow in the polar regions are found to be more reflective than polar surfaces that are sometimes illuminated. Limiting analysis to data with slopes less than 10° eliminates variations in reflectance due to mass wasting and shows a similar increased reflectivity within permanent polar shadow. Steep slopes within permanent shadow are also more reflective than similar slopes that experience at least some illumination. Water frost and a reduction in effectiveness of space weathering are offered as possible explanations for the increased reflectivity of permanent shadow; porosity is largely ruled out as the sole explanation. The

  7. Contribution to the determination of the double angular and energy differential neutron albedo. Application to the propagation in lacunar medium

    International Nuclear Information System (INIS)

    Litaize, O.

    2000-01-01

    The goal of this thesis is to study the neutron propagation by reflection from lacunar medium interfaces. The most efficient method to calculate this type of propagation is to use the concept of albedo. Actual version of NARCISSE code uses a simple formulation of angular differential albedos and so, can only treat single reflections. Multiple reflections treatment needs the knowledge of neutron spectrum after reflection. This energetic information is contained in double angular and energy differential albedos. The first step of this study consists to generate these albedos for various materials. Several methods have been tested and the Monte Carlo method was retained. A new estimator has been developed and validated in the Mote Carlo transport code TRIPOLI-4. It computes, during the simulation of the neutron history, the angular and energy reflection probability at each collision site. The second step consists to generate an interpolation scheme and albedo libraries for various materials. A new version of NARCISSE was developed to use these libraries and the interpolation module. Spectrum and dose rates comparisons were made between codes to validate these albedos. The neutron propagation by multiple reflections can be studied now, by using this new version of Narcisse. (author)

  8. Determination of the double angular and energy differential gamma-ray albedo by using the Monte Carlo method

    International Nuclear Information System (INIS)

    Miss, J.

    1998-06-01

    The goal of this thesis was to study comprehensively photons energy and angular distributions of backscattered radiations. In general, this relation is described by the concept to the backscattered factor or doubly differential albedo. This concept is useful to study the particle propagation into the air space by simple or multiple reflections on materials There are two principal treatments to solve numerically this problem: the deterministic and probabilistic methods. We showed that deterministic methods furnish unsatisfactory results: that's why we choice to develop a new gamma ray albedo estimator in the code TRIPOLI14 (three dimensional Monte Carlo code). So, we have been able to compute an important data base of doubly differential albedos. A physical analysis of these data showed that albedos can be simply described by parameter functions. These parameters were obtained by fitting the albedos of the data base over a complete range of incident and reflected energy and direction. So, we produced a very smaller data base of functions coefficients, instead of storing all the values of the doubly differential spectrum. It is so easy to make every albedo by linear interpolations on the coefficient of the new library. (author)

  9. Widespread albedo decreasing and induced melting of Himalayan snow and ice in the early 21st century.

    Science.gov (United States)

    Ming, Jing; Wang, Yaqiang; Du, Zhencai; Zhang, Tong; Guo, Wanqin; Xiao, Cunde; Xu, Xiaobin; Ding, Minghu; Zhang, Dongqi; Yang, Wen

    2015-01-01

    The widely distributed glaciers in the greater Himalayan region have generally experienced rapid shrinkage since the 1850s. As invaluable sources of water and because of their scarcity, these glaciers are extremely important. Beginning in the twenty-first century, new methods have been applied to measure the mass budget of these glaciers. Investigations have shown that the albedo is an important parameter that affects the melting of Himalayan glaciers. The surface albedo based on the Moderate Resolution Imaging Spectroradiometer (MODIS) data over the Hindu Kush, Karakoram and Himalaya (HKH) glaciers is surveyed in this study for the period 2000-2011. The general albedo trend shows that the glaciers have been darkening since 2000. The most rapid decrease in the surface albedo has occurred in the glacial area above 6000 m, which implies that melting will likely extend to snow accumulation areas. The mass-loss equivalent (MLE) of the HKH glacial area caused by surface shortwave radiation absorption is estimated to be 10.4 Gt yr-1, which may contribute to 1.2% of the global sea level rise on annual average (2003-2009). This work probably presents a first scene depicting the albedo variations over the whole HKH glacial area during the period 2000-2011. Most rapidly decreasing in albedo has been detected in the highest area, which deserves to be especially concerned.

  10. Widespread albedo decreasing and induced melting of Himalayan snow and ice in the early 21st century.

    Directory of Open Access Journals (Sweden)

    Jing Ming

    Full Text Available The widely distributed glaciers in the greater Himalayan region have generally experienced rapid shrinkage since the 1850s. As invaluable sources of water and because of their scarcity, these glaciers are extremely important. Beginning in the twenty-first century, new methods have been applied to measure the mass budget of these glaciers. Investigations have shown that the albedo is an important parameter that affects the melting of Himalayan glaciers.The surface albedo based on the Moderate Resolution Imaging Spectroradiometer (MODIS data over the Hindu Kush, Karakoram and Himalaya (HKH glaciers is surveyed in this study for the period 2000-2011. The general albedo trend shows that the glaciers have been darkening since 2000. The most rapid decrease in the surface albedo has occurred in the glacial area above 6000 m, which implies that melting will likely extend to snow accumulation areas. The mass-loss equivalent (MLE of the HKH glacial area caused by surface shortwave radiation absorption is estimated to be 10.4 Gt yr-1, which may contribute to 1.2% of the global sea level rise on annual average (2003-2009.This work probably presents a first scene depicting the albedo variations over the whole HKH glacial area during the period 2000-2011. Most rapidly decreasing in albedo has been detected in the highest area, which deserves to be especially concerned.

  11. How Does the Shape of the Stellar Spectrum Affect the Raman Scattering Features in the Albedo of Exoplanets?

    Energy Technology Data Exchange (ETDEWEB)

    Oklopčić, Antonija [California Institute of Technology, 1200 East California Boulevard, MC 249-17, Pasadena, CA 91125 (United States); Hirata, Christopher M. [Center for Cosmology and Astroparticle Physics, Ohio State University, 191 West Woodruff Avenue, Columbus, OH 43210 (United States); Heng, Kevin, E-mail: oklopcic@astro.caltech.edu [Center for Space and Habitability, University of Bern, Sidlerstrasse 5, CH-3012, Bern (Switzerland)

    2017-09-10

    The diagnostic potential of the spectral signatures of Raman scattering, imprinted in planetary albedo spectra at short optical wavelengths, has been demonstrated in research on planets in the solar system, and has recently been proposed as a probe of exoplanet atmospheres, complementary to albedo studies at longer wavelengths. Spectral features caused by Raman scattering offer insight into the properties of planetary atmospheres, such as the atmospheric depth, composition, and temperature, as well as the possibility of detecting and spectroscopically identifying spectrally inactive species, such as H{sub 2} and N{sub 2}, in the visible wavelength range. Raman albedo features, however, depend on both the properties of the atmosphere and the shape of the incident stellar spectrum. Identical planetary atmospheres can produce very different albedo spectra depending on the spectral properties of the host star. Here we present a set of geometric albedo spectra calculated for atmospheres with H{sub 2}/He, N{sub 2}, and CO{sub 2} composition, irradiated by different stellar types ranging from late A to late K stars. Prominent albedo features caused by Raman scattering appear at different wavelengths for different types of host stars. We investigate how absorption due to the alkali elements sodium and potassium may affect the intensity of Raman features, and we discuss the preferred strategies for detecting Raman features in future observations.

  12. Preparation and characterization of PVA/SSA membranes with Al{sub 2}O{sub 3} nanoparticles for fuel cell applications; Preparacao de caracterizacao de membranas de PVAL/SSA na presenca de nanoparticulas de Al{sub 2}O{sub 3} para aplicacao em celulas de combustivel

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Paula N.; Pires, Alfredo T.N. [Grupo de Estudo em Materiais Polimericos - POLIMAT - UFSC, Florianopolis, SC (Brazil); Catarino, Margarida; Brandao, Lucia; Tanaka, Alfredo; Mendes, Adelio [Faculdade de Engenharia da Universidade do Porto, Porto (Portugal)

    2011-07-01

    In the present study, PVA/SSA membranes were prepared with and without the addition of Al{sub 2}O{sub 3} nanoparticles. Sulfosuccinic acid (SSA) was used as the crosslinking agent. Membranes were prepared with different amounts of SSA (26, 43 and 55 wt.%) and with 5 and 10 wt.% of nanoparticles. Crosslinking was performed at 90 degree C during 1.5 h. Membranes were analyzed by infrared spectroscopy, thermal analysis, water absorption, ion exchange capacity (IEC) and proton conductivity. The results showed that control of the crosslinking conditions, IEC value, water absorption and polymer structure are of significant importance to obtain a set of properties suitable for application in proton exchange membrane fuel cells. (author)

  13. Scatter Correction with Combined Single-Scatter Simulation and Monte Carlo Simulation Scaling Improved the Visual Artifacts and Quantification in 3-Dimensional Brain PET/CT Imaging with 15O-Gas Inhalation.

    Science.gov (United States)

    Magota, Keiichi; Shiga, Tohru; Asano, Yukari; Shinyama, Daiki; Ye, Jinghan; Perkins, Amy E; Maniawski, Piotr J; Toyonaga, Takuya; Kobayashi, Kentaro; Hirata, Kenji; Katoh, Chietsugu; Hattori, Naoya; Tamaki, Nagara

    2017-12-01

    In 3-dimensional PET/CT imaging of the brain with 15 O-gas inhalation, high radioactivity in the face mask creates cold artifacts and affects the quantitative accuracy when scatter is corrected by conventional methods (e.g., single-scatter simulation [SSS] with tail-fitting scaling [TFS-SSS]). Here we examined the validity of a newly developed scatter-correction method that combines SSS with a scaling factor calculated by Monte Carlo simulation (MCS-SSS). Methods: We performed phantom experiments and patient studies. In the phantom experiments, a plastic bottle simulating a face mask was attached to a cylindric phantom simulating the brain. The cylindric phantom was filled with 18 F-FDG solution (3.8-7.0 kBq/mL). The bottle was filled with nonradioactive air or various levels of 18 F-FDG (0-170 kBq/mL). Images were corrected either by TFS-SSS or MCS-SSS using the CT data of the bottle filled with nonradioactive air. We compared the image activity concentration in the cylindric phantom with the true activity concentration. We also performed 15 O-gas brain PET based on the steady-state method on patients with cerebrovascular disease to obtain quantitative images of cerebral blood flow and oxygen metabolism. Results: In the phantom experiments, a cold artifact was observed immediately next to the bottle on TFS-SSS images, where the image activity concentrations in the cylindric phantom were underestimated by 18%, 36%, and 70% at the bottle radioactivity levels of 2.4, 5.1, and 9.7 kBq/mL, respectively. At higher bottle radioactivity, the image activity concentrations in the cylindric phantom were greater than 98% underestimated. For the MCS-SSS, in contrast, the error was within 5% at each bottle radioactivity level, although the image generated slight high-activity artifacts around the bottle when the bottle contained significantly high radioactivity. In the patient imaging with 15 O 2 and C 15 O 2 inhalation, cold artifacts were observed on TFS-SSS images, whereas

  14. Estimativas do albedo em três ecossistemas da floresta amazônica Estimation of albedo in three ecosystems of the Amazon forest

    Directory of Open Access Journals (Sweden)

    Mário de M. V. B. R. Leitão

    2002-01-01

    Full Text Available Os albedos relativos às radiações de ondas curtas, infravermelho e fotossinteticamente ativa foram estimados para três ecossistemas da floresta amazônica. A pesquisa foi conduzida nas áreas de Campina e Campinarana, na Reserva Biológica de Campina, localizada no quilômetro 46 da rodovia BR-174 (2º 34'S; 60º 02'W, que liga Manaus a Caracaraí e na área de Mata Densa, na Reserva Florestal Ducke (2º 57'S; 59º 57'W. Para obtenção dos dados nos diferentes tipos de vegetação, foi instalado, numa torre metálica, um conjunto de sensores para medir radiações de ondas curtas, infravermelho e fotossinteticamente ativa, incidentes e refletidas sobre os dosséis vegetativos, além de sensores para medir radiações de ondas curtas incidente, de ondas curtas refletida e fotossinteticamente ativa, próximo à superfície do solo dos dosséis. Para a aquisição dos dados foram utilizados quatro microloggers, os quais foram programados para efetuarem, no período das 5 h 51 min às 18 h, leituras a cada segundo e médias a cada minuto. Os resultados mostraram que os albedos de ondas curtas, infravermelho e radiação fotossinteticamente ativa (PAR, nos três tipos de vegetação, podem ser estimados em função do ângulo de elevação do sol, com boa precisão para qualquer instante do dia.The albedos of shortwave, infrared and photosynthetically active radiations (PAR were estimated for three ecosystems of the Amazon forest. The research was conducted in the areas of Campina and Campinarana of the Biological Reserve of Campina, located at km 46, on Highway BR-174 which connects Manaus and Caracarai (2º 34'S; 60º 2'W and in the area of "Mata Densa" in the Ducke Forest Reserve (2º 57'S; 59º 57'W. A metallic tower, with set of sensors for measuring the incident and canopy reflected shortwave, infrared and photosynthetically active radiations was installed over each of the above mentioned canopies. Similar sensors were also installed at

  15. Understanding the drivers of post-fire albedo and radiative forcing across Alaska and Canada: implications for management.

    Science.gov (United States)

    Potter, S.; Solvik, K.; Erb, A.; Goetz, S. J.; Johnstone, J. F.; Mack, M. C.; Randerson, J. T.; Roman, M. O.; Schaaf, C. L.; Turetsky, M. R.; Veraverbeke, S.; Wang, Z.; Rogers, B. M.

    2017-12-01

    Boreal forest dynamics including succession, composition, carbon cycling, and surface-atmosphere energy exchanges are largely driven by fire. In Alaska and Canada, burned area and fire frequency have increased since the 1970s, and are projected to continue increasing into the 21st century. In contrast to other biomes, alterations to surface albedo from fires in North American boreal forests are one of the primary feedbacks to climate. Understanding how altered fire regimes impact vegetation composition and energy budgets is therefore critical to forecasting regional and global climate change. High-severity fires cause winter and spring albedo to increase due to increased snow exposure and replacement of evergreen conifers by deciduous broadleaf trees. Although summer albedo decreases initially due to the deposition of black carbon and charred surfaces, it typically increases for several decades thereafter when younger and brighter deciduous trees dominate. The net effect of these albedo changes is expected to result in substantive radiative cooling, but there has been little research to examine how albedo trajectories differ spatially and temporally as a result of differences in burn severity, species composition, topography, climate and soil properties, and what the associated implications for future energy balances are. Here we investigate drivers of post-fire monthly albedo trajectories across Canada and Alaska using a new Collection V006 500 m MODIS daily blue-sky albedo product and historical fires from the Canadian and Alaskan National Fire Databases. The impacts of varying fuel type, landscape position, soils, climate, and burn severity on monthly albedo trajectories are explored using a Random Forest model. This information is then used to predict long-term monthly albedo and radiative forcing for fires that occurred during the MODIS era (2001-2012). We find that higher severity burns in denser forests and environmental conditions that promote either

  16. Effects of the Extraterrestrial Environment on Plants: Recommendations for Future Space Experiments for the MELiSSA Higher Plant Compartment

    Directory of Open Access Journals (Sweden)

    Silje A. Wolff

    2014-05-01

    Full Text Available Due to logistical challenges, long-term human space exploration missions require a life support system capable of regenerating all the essentials for survival. Higher plants can be utilized to provide a continuous supply of fresh food, atmosphere revitalization, and clean water for humans. Plants can adapt to extreme environments on Earth, and model plants have been shown to grow and develop through a full life cycle in microgravity. However, more knowledge about the long term effects of the extraterrestrial environment on plant growth and development is necessary. The European Space Agency (ESA has developed the Micro-Ecological Life Support System Alternative (MELiSSA program to develop a closed regenerative life support system, based on micro-organisms and higher plant processes, with continuous recycling of resources. In this context, a literature review to analyze the impact of the space environments on higher plants, with focus on gravity levels, magnetic fields and radiation, has been performed. This communication presents a roadmap giving directions for future scientific activities within space plant cultivation. The roadmap aims to identify the research activities required before higher plants can be included in regenerative life support systems in space.

  17. Global Albedo

    Science.gov (United States)

    2002-01-01

    Once home to the powerful Inca Empire, the spectacular vistas and canyons of the South American Andes are now a favorite to mountain bikers, climbers and other tourists looking for an adventure. This true color image of the Central Andes and surrounding landscape was acquired by the Moderate-resolution Imaging Spectroradiometer (MODIS), flying aboard NASA's Terra spacecraft. The dark green area to the right of the brown mountains are the Gran Chaco planes, which consist mostly of alluvial fans and wetlands. To the west is the Pacific Ocean. In the upper half of this image, the Andes are formed by two distinct mountain ranges that appear as darker reddish-brown bands running northwest to southeast. Between the two ranges, shown in a lighter brown, sits the Altiplano plateau, which spans southern Peru and northern Bolivia. The plateau sits at 3660 meters (12,000 feet) and is covered in mazelike canyons, marshlands and lakes. The largest of the lakes-Lake Titticaca-can be seen as the dark blue patch in southern Peru. The two mountain ranges supporting the plateau eventually come together along the border of Argentina and Chile to form one continuous range. The Andes have been forming over the past 170 million years as the Nazca Plate lying under the Pacific Ocean has forced its way under the South American Plate and pushed up its western edge. The subduction of one plate under the other has given rise to a number of volcanoes that dot the western edge of the mountain range. Earthquakes are also very common in this region. Image by NASA GSFC, based on data from the MODIS science team.

  18. The Impact of Albedo Increase to Mitigate the Urban Heat Island in Terni (Italy Using the WRF Model

    Directory of Open Access Journals (Sweden)

    Elena Morini

    2016-10-01

    Full Text Available The impacts of the urban heat island (UHI phenomenon on energy consumption, air quality, and human health have been widely studied and described. Mitigation strategies have been developed to fight the UHI and its detrimental consequences. A potential countermeasure is the increase of urban albedo by using cool materials. Cool materials are highly reflective materials that can maintain lower surface temperatures and thus can present an effective solution to mitigate the UHI. Terni’s proven record of high temperatures along with related environmental and comfort issues in its urban areas have reflected the local consequences of global warming. On the other hand, it promoted integrated actions by the government and research institutes to investigate solutions to mitigate the UHI effects. In this study, the main goal is to investigate the effectiveness of albedo increase as a strategy to tackle the UHI, by using the Weather Research and Forecasting (WRF mesoscale model to simulate the urban climate of Terni (Italy. Three different scenarios through a summer heat wave in the summer of 2015 are analyzed. The Base Scenario, which simulates the actual conditions of the urban area, is the control case. In the Albedo Scenario (ALB Scenario, the albedo of the roof, walls and road of the whole urban area is increased. In the Albedo-Industrial Scenario (ALB-IND Scenario, the albedo of the roof, walls and road of the area occupied by the main industrial site of Terni, located in close proximity to the city center, is increased. The simulation results show that the UHI is decreased up to 2 °C both at daytime and at nighttime in the ALB and in ALB-IND Scenarios. Peak temperatures in the urban area can be decreased by 1 °C at daytime, and by about 2 °C at nighttime. Albedo increase in the area of interest might thus represent an opportunity to decrease the UHI effect and its consequences.

  19. Production of Arctic Sea-ice Albedo by fusion of MISR and MODIS data

    Science.gov (United States)

    Kharbouche, Said; Muller, Jan-Peter

    2017-04-01

    We have combined data from the NASA MISR and MODIS spectro-radiometers to create a cloud-free albedo dataset specifically for sea-ice. The MISR (Multi-Angular Spectro-Radiometer) instrument on board Terra satellite has a unique ability to create high-quality Bidirectional Reflectance (BRF) over a 7 minute time interval per single overpass, thanks to its 9 cameras of different view angles (±70°,±60°,±45°,±26°). However, as MISR is limited to narrow spectral bands (443nm, 555nm, 670nm, 865nm), which is not sufficient to mask cloud effectively and robustly, we have used the sea-ice mask MOD09 product (Collection 6) from MODIS (Moderate resolution Imaging Spectoradiometer) instrument, which is also on board Terra satellite and acquiring data simultaneously. Only We have created a new and consistent sea-ice (for Arctic) albedo product that is daily, from 1st March to 22nd September for each and every year between 2000 to 2016 at two spatial grids, 1km x 1km and 5km x 5km in polar stereographic projection. Their analysis is described in a separate report [1]. References [1] Muller & Kharbouche, Variation of Arctic's Sea-ice Albedo between 2000 and 2016 by fusion of MISR and MODIS data. This conference. Acknowledgements This work was supported by www.QA4ECV.eu, a project of European Union's Seventh Framework Programme (FP7/2007-2013) under grant agreement no. 607405. We thank our colleagues at JPL and NASA LaRC for processing these data, especially Sebastian Val and Steve Protack.

  20. VizieR Online Data Catalog: AKARI IRC asteroid sample diameters & albedos (Ali-Lagoa+, 2018)

    Science.gov (United States)

    Ali-Lagoa, V.; Mueller, T. G.; Usui, F.; Hasegawa, S.

    2017-11-01

    Table 1 contains the best-fitting values of size and beaming parameter and corresponding visible geometric albedos for the full AKARI IRC sample. We fitted the near-Earth asteroid thermal model (NEATM) of Harris (1998Icar..131..291H) to the AKARI IRC thermal infrared data (Murakami et al., 2007PASJ...59S.369M, Onaka et al., 2007PASJ...59S.401O, Ishihara et al., 2010A&A...514A...1I, Cat. II/297, Usui et al., 2011PASJ...63.1117U, Cat. J/PASJ/63/1117, Takita et al., 2012PASJ...64..126T, Hasegawa et al., 2013PASJ...65...34H, Cat. J/PASJ/65/34). The NEATM implementation is described in Ali-Lagoa and Delbo' (2017A&A...603A..55A, cat. J/A+A/603/A55). Minimum relative errors of 10, 15, and 20 percent are given for size, beaming parameter and albedo in those cases where the beaming parameter could be fitted. Otherwise, a default value of the beaming parameter is assumed based on Eq. 1 in the article, and the minimum relative errors in size and albedo increase to 20 and 40 percent (see the discussions in Mainzer et al., 2011ApJ...736..100M, Ali-Lagoa et al., 2016A&A...591A..14A, Cat. J/A+A/591/A14). We also provide the asteroid absolute magnitudes and G12 slope parameters retrieved from Oszkiewicz et al. (2012), the number of observations used in each IRC band (S9W and L18W), plus the heliocentric and geocentric distances and phase angle (r, Delta, alpha) based on the ephemerides taken from the MIRIADE service (http://vo.imcce.fr/webservices/miriade/?ephemph). (1 data file).

  1. Size, Albedo, and Taxonomy of the Don Quijote Space Mission Target

    Science.gov (United States)

    Harris, Alan; Mueller, Michael; Fitzsimmons, Alan

    2006-03-01

    Rendezvous and lander missions are a very effective but very expensive way of investigating Solar-System bodies. The planning, optimization and success of space missions depends crucially on prior remotely-sensed knowledge of target bodies. Near-Earth asteroids (NEAs), which are mainly fragments of main-belt asteroids, are seen as important goals for investigation by space missions, mainly due to the role their forebears played in planet formation and the evolution of the Solar System, but also for the pragmatic reason that these objects can collide with the Earth with potentially devastating consequences. The European Space Agency is currently planning the Don Quijote mission to a NEA, which includes a rendezvous (and perhaps a lander) spacecraft and an impactor vehicle. The aim is to study the physical properties of the target asteroid and the effects of the impact on its dynamical state, as a first step in considering realistic mitigation measures against an eventual hazardous NEA. Two potential targets have been selected for the mission, the preferred one being (10302) 1989 ML, which is energetically easier to reach and is possibly a scientifically interesting primitive asteroid. However, due to the ambiguity of available spectral data, it is currently not possible to confidently determine the taxonomic type and mineralogy of this object. Crucially, the albedo is uncertain by a factor of 10, which leads to large uncertainties in the size and mass and hence the planned near-surface operations of Don Quijote. Thermal-infrared observations are urgently required for accurate size and albedo determination. These observations, which can only be carried out by Spitzer and would require only a modest amount of observing time, would enable an accurate diameter to be derived for the first time and the resulting albedo would remove the taxonomic ambiguity. The proposed Spitzer observations are critical for effective mission planning and would greatly increase our

  2. REFLECTED LIGHT CURVES, SPHERICAL AND BOND ALBEDOS OF JUPITER- AND SATURN-LIKE EXOPLANETS

    Energy Technology Data Exchange (ETDEWEB)

    Dyudina, Ulyana; Kopparla, Pushkar; Ingersoll, Andrew P.; Yung, Yuk L. [Division of Geological and Planetary Sciences, 150-21 California Institute of Technology, Pasadena, CA 91125 (United States); Zhang, Xi [University of California Santa Cruz 1156 High Street, Santa Cruz, CA 95064 (United States); Li, Liming [Department of Physics, University of Houston, Houston, TX 77204 (United States); Dones, Luke [Southwest Research Institute, 1050 Walnut Street, Suite 300, Boulder CO 80302 (United States); Verbiscer, Anne, E-mail: ulyana@gps.caltech.edu [Department of Astronomy, University of Virginia, Charlottesville, VA 22904-4325 (United States)

    2016-05-10

    Reflected light curves observed for exoplanets indicate that a few of them host bright clouds. We estimate how the light curve and total stellar heating of a planet depends on forward and backward scattering in the clouds based on Pioneer and Cassini spacecraft images of Jupiter and Saturn. We fit analytical functions to the local reflected brightnesses of Jupiter and Saturn depending on the planet’s phase. These observations cover broadbands at 0.59–0.72 and 0.39–0.5 μ m, and narrowbands at 0.938 (atmospheric window), 0.889 (CH4 absorption band), and 0.24–0.28 μ m. We simulate the images of the planets with a ray-tracing model, and disk-integrate them to produce the full-orbit light curves. For Jupiter, we also fit the modeled light curves to the observed full-disk brightness. We derive spherical albedos for Jupiter and Saturn, and for planets with Lambertian and Rayleigh-scattering atmospheres. Jupiter-like atmospheres can produce light curves that are a factor of two fainter at half-phase than the Lambertian planet, given the same geometric albedo at transit. The spherical albedo is typically lower than for a Lambertian planet by up to a factor of ∼1.5. The Lambertian assumption will underestimate the absorption of the stellar light and the equilibrium temperature of the planetary atmosphere. We also compare our light curves with the light curves of solid bodies: the moons Enceladus and Callisto. Their strong backscattering peak within a few degrees of opposition (secondary eclipse) can lead to an even stronger underestimate of the stellar heating.

  3. Light-absorbing impurities enhance glacier albedo reduction in the southeastern Tibetan plateau

    Science.gov (United States)

    Zhang, Yulan; Kang, Shichang; Cong, Zhiyuan; Schmale, Julia; Sprenger, Michael; Li, Chaoliu; Yang, Wei; Gao, Tanguang; Sillanpää, Mika; Li, Xiaofei; Liu, Yajun; Chen, Pengfei; Zhang, Xuelei

    2017-07-01

    Light-absorbing impurities (LAIs) in snow of the southeastern Tibetan Plateau (TP) and their climatic impacts are of interest not only because this region borders areas affected by the South Asian atmospheric brown clouds but also because the seasonal snow and glacier melt from this region form important headwaters of large rivers. In this study, we collected surface snow and snowpit samples from four glaciers in the southeastern TP in June 2015 to investigate the comprehensive observational data set of LAIs. Results showed that the LAI concentrations were much higher in the aged snow and granular ice than in the fresh snow and snowpits due to postdepositional processes. Impurity concentrations fluctuated across snowpits, with maximum LAI concentrations frequently occurring toward the bottom of snowpits. Based on the SNow ICe Aerosol Radiative model, the albedo simulation indicated that black carbon and dust account for approximately 20% of the albedo reduction relative to clean snow. The radiative forcing caused by black carbon and dust deposition on the glaciers were between 1.0-141 W m-2 and 1.5-120 W m-2, respectively. Black carbon (BC) played a larger role in albedo reduction and radiative forcing than dust in the study area, enhancing approximately 15% of glacier melt. Analysis based on the Fire INventory from NCAR indicated that nonbiomass-burning sources of BC played an important role in the total BC deposition, especially during the monsoon season. This study suggests that eliminating anthropogenic BC could mitigate glacier melt in the future of the southeastern TP.

  4. Improving ROLO lunar albedo model using PLEIADES-HR satellites extra-terrestrial observations

    Science.gov (United States)

    Meygret, Aimé; Blanchet, Gwendoline; Colzy, Stéphane; Gross-Colzy, Lydwine

    2017-09-01

    The accurate on orbit radiometric calibration of optical sensors has become a challenge for space agencies which have developed different technics involving on-board calibration systems, ground targets or extra-terrestrial targets. The combination of different approaches and targets is recommended whenever possible and necessary to reach or demonstrate a high accuracy. Among these calibration targets, the moon is widely used through the well-known ROLO (RObotic Lunar Observatory) model developed by USGS. A great and worldwide recognized work was done to characterize the moon albedo which is very stable. However the more and more demanding needs for calibration accuracy have reached the limitations of the model. This paper deals with two mains limitations: the residual error when modelling the phase angle dependency and the absolute accuracy of the model which is no more acceptable for the on orbit calibration of radiometers. Thanks to PLEIADES high resolution satellites agility, a significant data base of moon and stars images was acquired, allowing to show the limitations of ROLO model and to characterize the errors. The phase angle residual dependency is modelled using PLEIADES 1B images acquired for different quasi-complete moon cycles with a phase angle varying by less than 1°. The absolute albedo residual error is modelled using PLEIADES 1A images taken over stars and the moon. The accurate knowledge of the stars spectral irradiance is transferred to the moon spectral albedo using the satellite as a transfer radiometer. This paper describes the data set used, the ROLO model residual errors and their modelling, the quality of the proposed correction and show some calibration results using this improved model.

  5. Influence of the atmospheric aerosol and air pollution on solar albedo of the earth. Vol. 4

    International Nuclear Information System (INIS)

    Mayhoub, A.B.; Mohamed, K.S.

    1996-01-01

    The effect of increasing atmospheric aerosol and air pollutant concentration on the solar albedo and consequently upon the heat budget near the earth's surface is studied. The magnitude of aerosol absorption coefficient to back-scattering coefficient B ab /B bs is calculated. This study will be used to estimate atmospheric stability categories and other meteorological parameters which are affected by thermal state radiation balance of the atmosphere as mixing and inversion height of Inshas nuclear reactor site. Consequently, concentration distribution of radioactive release from Inshas can be evaluated.. 4 figs., 5 tabs

  6. CVF spectrophotometry of Pluto - Correlation of composition with albedo. [circularly variable filter

    Science.gov (United States)

    Marcialis, Robert L.; Lebofsky, Larry A.

    1991-01-01

    The present time-resolved, 0.96-2.65-micron spectrophotometry for the Pluto-Charon system indicates night-to-night variations in the depths of the methane absorptions such that the bands' equivalent width is near minimum light. The interpretation of these data in terms of a depletion of methane in dark regions of the planet, relative to bright ones, is consistent with the Buie and Fink (1987) observations. The near-IR spectrum of Pluto seems to be dominated by surface frost. It is suggested that the dark equatorial regions of Pluto are redder than those of moderate albedo.

  7. PHOTOMETRIC STEREO SHAPE-AND-ALBEDO-FROM-SHADING FOR PIXEL-LEVEL RESOLUTION LUNAR SURFACE RECONSTRUCTION

    Directory of Open Access Journals (Sweden)

    W. C. Liu

    2017-07-01

    Full Text Available Shape and Albedo from Shading (SAfS techniques recover pixel-wise surface details based on the relationship between terrain slopes, illumination and imaging geometry, and the energy response (i.e., image intensity captured by the sensing system. Multiple images with different illumination geometries (i.e., photometric stereo can provide better SAfS surface reconstruction due to the increase in observations. Photometric stereo SAfS is suitable for detailed surface reconstruction of the Moon and other extra-terrestrial bodies due to the availability of photometric stereo and the less complex surface reflecting properties (i.e., albedo of the target bodies as compared to the Earth. Considering only one photometric stereo pair (i.e., two images, pixel-variant albedo is still a major obstacle to satisfactory reconstruction and it needs to be regulated by the SAfS algorithm. The illumination directional difference between the two images also becomes an important factor affecting the reconstruction quality. This paper presents a photometric stereo SAfS algorithm for pixel-level resolution lunar surface reconstruction. The algorithm includes a hierarchical optimization architecture for handling pixel-variant albedo and improving performance. With the use of Lunar Reconnaissance Orbiter Camera - Narrow Angle Camera (LROC NAC photometric stereo images, the reconstructed topography (i.e., the DEM is compared with the DEM produced independently by photogrammetric methods. This paper also addresses the effect of illumination directional difference in between one photometric stereo pair on the reconstruction quality of the proposed algorithm by both mathematical and experimental analysis. In this case, LROC NAC images under multiple illumination directions are utilized by the proposed algorithm for experimental comparison. The mathematical derivation suggests an illumination azimuthal difference of 90 degrees between two images is recommended to achieve

  8. Influence of the atmospheric aerosol and air pollution on solar albedo of the earth. Vol. 4

    Energy Technology Data Exchange (ETDEWEB)

    Mayhoub, A B; Mohamed, K S [Mathematics and Theoretical Physics Department, Nuclear Research Center, Atomic Energy Auhtority, Cairo, (Egypt)

    1996-03-01

    The effect of increasing atmospheric aerosol and air pollutant concentration on the solar albedo and consequently upon the heat budget near the earth`s surface is studied. The magnitude of aerosol absorption coefficient to back-scattering coefficient B{sub ab}/B{sub bs} is calculated. This study will be used to estimate atmospheric stability categories and other meteorological parameters which are affected by thermal state radiation balance of the atmosphere as mixing and inversion height of Inshas nuclear reactor site. Consequently, concentration distribution of radioactive release from Inshas can be evaluated.. 4 figs., 5 tabs.

  9. On the nature of the sea ice albedo feedback in simple models

    OpenAIRE

    Moon, Woosok; Wettlaufer, John S.

    2013-01-01

    We examine the nature of the ice-albedo feedback in a long standing approach used in the dynamic-thermodynamic modeling of sea ice. The central issue examined is how the evolution of the ice area is treated when modeling a partial ice cover using a two-category-thickness scheme; thin sea ice and open water in one category and "thick" sea ice in the second. The problem with the scheme is that the area-evolution is handled in a manner that violates the basic rules of calculus, which leads to a ...

  10. Response of combined albedo-track neutron personnel dosimeters behind IHEP proton synchrotron shielding

    International Nuclear Information System (INIS)

    Sannikov, A.V.; Korshunova, E.P.

    1989-01-01

    The method of readings interpretation of combined albedo-track neutron personnel dosemeters based on calculationsl analysis of the detector responses in various neutron spectra is described. The measurements of dose equivalent responses have been performed in various points behind IHEP proton synchrotron shielding. It is shown that CDs with fission track detectors have a small dose equivalent response dispersion behind IHEP proton synchrotron shielding, that shows the promise of their using for neutron personnel monitoring, that shows the promise of their using for neutron personnel monitoring at high energy accelerators. 16 refs.; 7 figs.; 3 tabs

  11. Use of an albedo neutron personnel dosimeter for X- and γ-ray monitoring

    International Nuclear Information System (INIS)

    Gorbics, S.G.; Nash, A.E.; Johnson, T.L.

    1981-01-01

    With a judicious choice of cadmium filter size and thickness, it is possible to use the information from the 7 LiF detectors used in an albedo neutron personnel dosimeter to determine an individual's X-and γ-ray exposure, thus eliminating the need for a separate dosimeter for this purpose. A filter area of 400 mm 2 and a thickness of 0.51 mm is shown to be optimum for a simple, plastic, dosimeter design using detectors held in dental-film size cards. (author)

  12. Testing the Prediction of Iron Alteration Minerals on Low Albedo Asteroids

    Science.gov (United States)

    Jarvis, K. S.; Vilas, Faith; Howell, E.; Kelley, M.; Cochran, A.

    1999-01-01

    Absorption features centered near 0.60 - 0.65 and 0.80 - 0.90 micron were identified in the spectra of three low-albedo main-belt (165, 368, 877) and two low-albedo outer-belt (225, 334) asteroids (Vilas et al., Icarus, v. 109,274,1994). The absorption features were attributed to charge transfer transitions in iron alteration minerals such as goethite, hematite, and jarosite, all products of aqueous alteration. Concurrently, Jarvis et al. (LPSC XXIV, 715, 1993) presented additional spectra of low-albedo asteroids that had absorption features centered near 0.60 - 0.65 micron without the longer wavelength feature. Since these two features in iron oxides originate from the same ground state, and the longer wavelength feature requires less energy to exist, the single shorter wavelength feature cannot be caused by the iron alteration minerals. In addition, spectra of minerals such as hematite and goethite show a rapid increase in reflectance beginning near 0.5 micron absent in the low-albedo asteroid spectra. The absence of this rise has been attributed to its suppresion from opaques in the surface material. Spectra on more than one night were available for only one of these five asteroids, 225 Henrietta, and showed good repeatability of the 0.65-micron feature. We have acquired additional spectra of all five asteroids in order to test the repeatability of the 0.65-micron feature, and the presence and repeatability of the features centered near 0.8 - 0.9 micron. We specifically will test the possibility that longer wavelength features could be caused by incomplete removal of telluric water. Asteroid 877 Walkure is a member of the Nysa-Hertha family, and will be compared to spectra of other members of that family. Data were acquired in 1996 and 1999 on the 2.1-m telescope with a facility cassegrain spectrograph, McDonald Observatory, Univ. Of Texas, and the 1.5-m telescope with facility cassegrain spectrograph at CTIO. This research is supported by the NASA Planetary

  13. Validation of IPS Single-Station Analysis (SSA) Using MEXART Routines in Multi-Station Spectra. Comparison with Cross Correlation Function (CCF) Analysis.

    Science.gov (United States)

    Bisi, M. M.; Chang, O.; Gonzalez-Esparza, A.; Fallows, R. A.; Aguilar-Rodriguez, E.

    2017-12-01

    The phenomenon of Interplanetary Scintillation (IPS) occurs from the scattering of radio waves coming from compact radio sources that cross electron density fluctuations in the interplanetary medium. By analyzing these fluctuations in the measurements of flux intensity of galactic (compact) radio sources in a radio telescope, it is possible to infer some properties of structures in the solar wind. Studies based on observations of IPS have provided valuable information on the physics of the internal heliosphere for over 50 years. There are two techniques that provide IPS results: 1) Single-Station Analysis (SSA), where a theoretical model is fitted to the observed spectrum; and 2) Cross-Correlation Function (CCF), where two antennas separated by a few hundred kilometers simultaneously and independently observe the same radio source. In order to combine and complement solar wind speed determinations, it is important to validate the results of these two IPS techniques. In this work we analyze events from previously studied observations from MERLIN (Multi-Element Radio-Linked Interferometer Network) using the CCF methodology. The SSA model fit is applied to these observations and compared with the previous results to validate the two techniques. The objective is to know the behavior of the parameters in cases studied by CCFs that can be implemented in the SSA model. This work studies the capability of SSA model fit to describe complex events in the interplanetary environment and seeks to improve the adjustment of parameters from individual spectra to the theoretical model. The validation of these two methodologies is important to be able to combine data in real time from different radio telescopes which is necessary for the success of the Worldwide Interplanetary Scintillation Stations (WIPSS) Network to monitor solar wind structures using IPS data.

  14. Function of SSA subfamily of Hsp70 within and across species varies widely in complementing Saccharomyces cerevisiae cell growth and prion propagation.

    Directory of Open Access Journals (Sweden)

    Deepak Sharma

    2009-08-01

    Full Text Available The cytosol of most eukaryotic cells contains multiple highly conserved Hsp70 orthologs that differ mainly by their spatio-temporal expression patterns. Hsp70s play essential roles in protein folding, transport or degradation, and are major players of cellular quality control processes. However, while several reports suggest that specialized functions of Hsp70 orthologs were selected through evolution, few studies addressed systematically this issue.We compared the ability of Ssa1p-Ssa4p from Saccharomyces cerevisiae and Ssa5p-Ssa8p from the evolutionary distant yeast Yarrowia lipolytica to perform Hsp70-dependent tasks when expressed as the sole Hsp70 for S. cerevisiae in vivo. We show that Hsp70 isoforms (i supported yeast viability yet with markedly different growth rates, (ii influenced the propagation and stability of the [PSI(+] and [URE3] prions, but iii did not significantly affect the proteasomal degradation rate of CFTR. Additionally, we show that individual Hsp70 orthologs did not induce the formation of different prion strains, but rather influenced the aggregation properties of Sup35 in vivo. Finally, we show that [URE3] curing by the overexpression of Ydj1p is Hsp70-isoform dependent.Despite very high homology and overlapping functions, the different Hsp70 orthologs have evolved to possess distinct activities that are required to cope with different types of substrates or stress situations. Yeast prions provide a very sensitive model to uncover this functional specialization and to explore the intricate network of chaperone/co-chaperone/substrates interactions.

  15. Albedo and land surface temperature shift in hydrocarbon seepage potential area, case study in Miri Sarawak Malaysia

    Science.gov (United States)

    Suherman, A.; Rahman, M. Z. A.; Busu, I.

    2014-02-01

    The presence of hydrocarbon seepage is generally associated with rock or mineral alteration product exposures, and changes of soil properties which manifest with bare development and stress vegetation. This alters the surface thermodynamic properties, changes the energy balance related to the surface reflection, absorption and emission, and leads to shift in albedo and LST. Those phenomena may provide a guide for seepage detection which can be recognized inexpensively by remote sensing method. District of Miri is used for study area. Available topographic maps of Miri and LANDSAT ETM+ were used for boundary construction and determination albedo and LST. Three land use classification methods, namely fixed, supervised and NDVI base classifications were employed for this study. By the intensive land use classification and corresponding statistical comparison was found a clearly shift on albedo and land surface temperature between internal and external seepage potential area. The shift shows a regular pattern related to vegetation density or NDVI value. In the low vegetation density or low NDVI value, albedo of internal area turned to lower value than external area. Conversely in the high vegetation density or high NDVI value, albedo of internal area turned to higher value than external area. Land surface temperature of internal seepage potential was generally shifted to higher value than external area in all of land use classes. In dense vegetation area tend to shift the temperature more than poor vegetation area.

  16. Recovering the colour-dependent albedo of exoplanets with high-resolution spectroscopy: from ESPRESSO to the ELT.

    Science.gov (United States)

    Martins, J. H. C.; Figueira, P.; Santos, N. C.; Melo, C.; Garcia Muñoz, A.; Faria, J.; Pepe, F.; Lovis, C.

    2018-05-01

    The characterization of planetary atmospheres is a daunting task, pushing current observing facilities to their limits. The next generation of high-resolution spectrographs mounted on large telescopes - such as ESPRESSO@VLT and HIRES@ELT - will allow us to probe and characterize exoplanetary atmospheres in greater detail than possible to this point. We present a method that permits the recovery of the colour-dependent reflectivity of exoplanets from high-resolution spectroscopic observations. Determining the wavelength-dependent albedo will provide insight into the chemical properties and weather of the exoplanet atmospheres. For this work, we simulated ESPRESSO@VLT and HIRES@ELT high-resolution observations of known planetary systems with several albedo configurations. We demonstrate how the cross correlation technique applied to theses simulated observations can be used to successfully recover the geometric albedo of exoplanets over a range of wavelengths. In all cases, we were able to recover the wavelength dependent albedo of the simulated exoplanets and distinguish between several atmospheric models representing different atmospheric configurations. In brief, we demonstrate that the cross correlation technique allows for the recovery of exoplanetary albedo functions from optical observations with the next generation of high-resolution spectrographs that will be mounted on large telescopes with reasonable exposure times. Its recovery will permit the characterization of exoplanetary atmospheres in terms of composition and dynamics and consolidates the cross correlation technique as a powerful tool for exoplanet characterization.

  17. Albedo and land surface temperature shift in hydrocarbon seepage potential area, case study in Miri Sarawak Malaysia

    International Nuclear Information System (INIS)

    Suherman, A; Rahman, M Z A; Busu, I

    2014-01-01

    The presence of hydrocarbon seepage is generally associated with rock or mineral alteration product exposures, and changes of soil properties which manifest with bare development and stress vegetation. This alters the surface thermodynamic properties, changes the energy balance related to the surface reflection, absorption and emission, and leads to shift in albedo and LST. Those phenomena may provide a guide for seepage detection which can be recognized inexpensively by remote sensing method. District of Miri is used for study area. Available topographic maps of Miri and LANDSAT ETM+ were used for boundary construction and determination albedo and LST. Three land use classification methods, namely fixed, supervised and NDVI base classifications were employed for this study. By the intensive land use classification and corresponding statistical comparison was found a clearly shift on albedo and land surface temperature between internal and external seepage potential area. The shift shows a regular pattern related to vegetation density or NDVI value. In the low vegetation density or low NDVI value, albedo of internal area turned to lower value than external area. Conversely in the high vegetation density or high NDVI value, albedo of internal area turned to higher value than external area. Land surface temperature of internal seepage potential was generally shifted to higher value than external area in all of land use classes. In dense vegetation area tend to shift the temperature more than poor vegetation area

  18. Landsat and Sentinel-2A Surface Albedo Estimation and Evaluation Against In Situ Measurements Across the US SURFRAD Network

    Science.gov (United States)

    Franch, B.; Skakun, S.; Vermote, E.; Roger, J. C.

    2017-12-01

    Surface albedo is an essential parameter not only for developing climate models, but also for most energy balance studies. While climate models are usually applied at coarse resolution, the energy balance studies, which are mainly focused on agricultural applications, require a high spatial resolution. The albedo, estimated through the angular integration of the BRDF, requires an appropriate angular sampling of the surface. However, Sentinel-2A sampling characteristics, with nearly constant observation geometry and low illumination variation, prevent from deriving a surface albedo product. In this work, we apply an algorithm developed to derive a Landsat surface albedo to Sentinel-2A. It is based on the BRDF parameters estimated from the MODerate Resolution Imaging Spectroradiometer (MODIS) CMG surface reflectance product (M{O,Y}D09) using the VJB method (Vermote et al., 2009). Sentinel-2A unsupervised classification images are used to disaggregate the BRDF parameters to the Sentinel-2 spatial resolution. We test the results over five different sites of the US SURFRAD network and plot the results versus albedo field measurements. Additionally, we also test this methodology using Landsat-8 images.

  19. Derivation of Land Surface Albedo at High Resolution by Combining HJ-1A/B Reflectance Observations with MODIS BRDF Products

    OpenAIRE

    Gao, Bo; Jia, Li; Wang, Tianxing

    2014-01-01

    Land surface albedo is an essential parameter for monitoring global/regional climate and land surface energy balance. Although many studies have been conducted on global or regional land surface albedo using various remote sensing data over the past few decades, land surface albedo product with a high spatio-temporal resolution is currently very scarce. This paper proposes a method for deriving land surface albedo with a high spatio-temporal resolution (space: 30 m and time: 2-4 days). The pr...

  20. ALMA DEEP FIELD IN SSA22: A CONCENTRATION OF DUSTY STARBURSTS IN A z = 3.09 PROTOCLUSTER CORE

    Energy Technology Data Exchange (ETDEWEB)

    Umehata, H.; Ivison, R. J. [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching (Germany); Tamura, Y.; Kohno, K.; Izumi, T.; Makiya, R. [Institute of Astronomy, School of Science, The University of Tokyo, 2-21-1 Osawa, Mitaka, Tokyo 181-0015 (Japan); Alexander, D. M.; Smail, I. [Centre for Extragalactic Astronomy, Department of Physics, Durham University, South Road, Durham DH1 3LE (United Kingdom); Geach, J. E. [Centre for Astrophysics Research, Science and Technology Research Institute, University of Hertfordshire, Hatfield AL10 9AB (United Kingdom); Hatsukade, B.; Kato, Y.; Kawabe, R.; Lee, M.; Matsuda, Y.; Nakanishi, K.; Saito, T. [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Hughes, D. H. [Department of astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Ikarashi, S. [Kapteyn Astronomical Institute, University of Groningen, P.O. Box 800, 9700AV Groningen (Netherlands); Kubo, M. [Institute for Cosmic Ray Research, University of Tokyo, 5-1-5 Kashiwa-no-Ha, Kashiwa City, Chiba 277-8582 (Japan); Lehmer, B., E-mail: humehata@eso.org [Department of Physics, University of Arkansas, 226 Physics Building, 835 West Dickson Street, Fayetteville, AR 72701 (United States); and others

    2015-12-10

    We report the results of 1.′5 × 3′ mapping at 1.1 mm with the Atacama Large Millimeter/submillimeter Array toward the central region of the z = 3.09 SSA22 protocluster. By combining our source catalog with archival spectroscopic redshifts, we find that eight submillimeter galaxies (SMGs) with flux densities, S{sub 1.1} {sub mm} = 0.7–6.4 mJy (L{sub IR} ∼ 10{sup 12.1}–10{sup 13.1} L{sub ⊙}) are at z = 3.08–3.10. Not only are these SMGs members of the protocluster, but they in fact reside within the node at the junction of the 50 Mpc scale filamentary three-dimensional structure traced by Lyα emitters in this field. The eight SMGs account for a star formation rate density (SFRD) ∼10 M{sub ⊙} yr{sup −1} Mpc{sup −3} in the node, which is two orders of magnitudes higher than the global SFRD at this redshift. We find that four of the eight SMGs host an X-ray-luminous active galactic nucleus. Our results suggest that the vigorous star formation activity and the growth of supermassive black holes (SMBHs) occurred simultaneously in the densest regions at z ∼ 3, which may correspond to the most active historical phase of the massive galaxy population found in the core of the clusters in the present universe. Two SMGs are associated with Lyα blobs, implying that the two populations coexist in high-density environments for a few cases.