Perim de Faria, Julia; Bundke, Ulrich; Onasch, Timothy B.; Freedman, Andrew; Petzold, Andreas
2016-04-01
The necessity to quantify the direct impact of aerosol particles on climate forcing is already well known; assessing this impact requires continuous and systematic measurements of the aerosol optical properties. Two of the main parameters that need to be accurately measured are the aerosol optical depth and single scattering albedo (SSA, defined as the ratio of particulate scattering to extinction). The measurement of single scattering albedo commonly involves the measurement of two optical parameters, the scattering and the absorption coefficients. Although there are well established technologies to measure both of these parameters, the use of two separate instruments with different principles and uncertainties represents potential sources of significant errors and biases. Based on the recently developed cavity attenuated phase shift particle extinction monitor (CAPS PM_{ex) instrument, the CAPS PM_{ssa instrument combines the CAPS technology to measure particle extinction with an integrating sphere capable of simultaneously measuring the scattering coefficient of the same sample. The scattering channel is calibrated to the extinction channel, such that the accuracy of the single scattering albedo measurement is only a function of the accuracy of the extinction measurement and the nephelometer truncation losses. This gives the instrument an accurate and direct measurement of the single scattering albedo. In this study, we assess the measurements of both the extinction and scattering channels of the CAPS PM_{ssa through intercomparisons with Mie theory, as a fundamental comparison, and with proven technologies, such as integrating nephelometers and filter-based absorption monitors. For comparison, we use two nephelometers, a TSI 3563 and an Aurora 4000, and two measurements of the absorption coefficient, using a Particulate Soot Absorption Photometer (PSAP) and a Multi Angle Absorption Photometer (MAAP). We also assess the indirect absorption coefficient
Comparisons of spectral aerosol single scattering albedo in Seoul, South Korea
Mok, Jungbin; Krotkov, Nickolay A.; Torres, Omar; Jethva, Hiren; Li, Zhanqing; Kim, Jhoon; Koo, Ja-Ho; Go, Sujung; Irie, Hitoshi; Labow, Gordon; Eck, Thomas F.; Holben, Brent N.; Herman, Jay; Loughman, Robert P.; Spinei, Elena; Lee, Seoung Soo; Khatri, Pradeep; Campanelli, Monica
2018-04-01
Quantifying aerosol absorption at ultraviolet (UV) wavelengths is important for monitoring air pollution and aerosol amounts using current (e.g., Aura/OMI) and future (e.g., TROPOMI, TEMPO, GEMS, and Sentinel-4) satellite measurements. Measurements of column average atmospheric aerosol single scattering albedo (SSA) are performed on the ground by the NASA AERONET in the visible (VIS) and near-infrared (NIR) wavelengths and in the UV-VIS-NIR by the SKYNET networks. Previous comparison studies have focused on VIS and NIR wavelengths due to the lack of co-incident measurements of aerosol and gaseous absorption properties in the UV. This study compares the SKYNET-retrieved SSA in the UV with the SSA derived from a combination of AERONET, MFRSR, and Pandora (AMP) retrievals in Seoul, South Korea, in spring and summer 2016. The results show that the spectrally invariant surface albedo assumed in the SKYNET SSA retrievals leads to underestimated SSA compared to AMP values at near UV wavelengths. Re-processed SKYNET inversions using spectrally varying surface albedo, consistent with the AERONET retrieval improve agreement with AMP SSA. The combined AMP inversions allow for separating aerosol and gaseous (NO2 and O3) absorption and provide aerosol retrievals from the shortest UVB (305 nm) through VIS to NIR wavelengths (870 nm).
Retrievals and uncertainty analysis of aerosol single scattering albedo from MFRSR measurements
International Nuclear Information System (INIS)
Yin, Bangsheng; Min, Qilong; Joseph, Everette
2015-01-01
Aerosol single scattering albedo (SSA) can be retrieved from the ratio of diffuse horizontal and direct normal fluxes measured from multifilter rotating shadowband radiometer (MFRSR). In this study, the measurement channels at 415 nm and 870 nm are selected for aerosol optical depth (AOD) and Angstrom coefficient retrievals, and the measurements at 415 nm are used for aerosol SSA retrievals with the constraint of retrieved Angstrom coefficient. We extensively assessed various issues impacting on the accuracy of SSA retrieval from measurements to input parameters and assumptions. For cloud-free days with mean aerosol loading of 0.13–0.60, our sensitivity study indicated that: (1) 1% calibration uncertainty can result in 0.8–3.7% changes in retrieved SSA; (2) without considering the cosine respond correction and/or forward scattering correction will result in underestimation of 1.1–3.3% and/or 0.73% in retrieved SSA; (3) an overestimation of 0.1 in asymmetry factor can result in an underestimation of 2.54–3.4% in retrieved SSA; (4) for small aerosol loading (e.g., 0.13), the uncertainty associated with the choice of Rayleigh optical depth value can result in non-negligible change in retrieved SSA (e.g., 0.015); (5) an uncertainty of 0.05 for surface albedo can result in changes of 1.49–5.4% in retrieved SSA. We applied the retrieval algorithm to the MFRSR measurements at the Atmospheric Radiation Measurements (ARM) Southern Great Plains (SGP) site. The retrieved results of AOD, Angstrom coefficient, and SSA are basically consistent with other independent measurements from co-located instruments at the site. - Highlights: • Aerosol SSA is derived from MFRSR measured diffuse to direct normal irradiance ratio. • We extensively assessed various issues impacting on the accuracy of SSA retrieval. • The issues are mainly from measurements and model input parameters and assumptions. • We applied the retrieval algorithm to the MFRSR measurements at ARM SGP
Freedman, A.; Onasch, T. B.; Renbaum-Wollf, L.; Lambe, A. T.; Davidovits, P.; Kebabian, P. L.
2015-12-01
Accurate, as compared to precise, measurement of aerosol absorption has always posed a significant problem for the particle radiative properties community. Filter-based instruments do not actually measure absorption but rather light transmission through the filter; absorption must be derived from this data using multiple corrections. The potential for matrix-induced effects is also great for organic-laden aerosols. The introduction of true in situ measurement instruments using photoacoustic or photothermal interferometric techniques represents a significant advance in the state-of-the-art. However, measurement artifacts caused by changes in humidity still represent a significant hurdle as does the lack of a good calibration standard at most measurement wavelengths. And, in the absence of any particle-based absorption standard, there is no way to demonstrate any real level of accuracy. We, along with others, have proposed that under the circumstance of low single scattering albedo (SSA), absorption is best determined by difference using measurement of total extinction and scattering. We discuss a robust, compact, field deployable instrument (the CAPS PMssa) that simultaneously measures airborne particle light extinction and scattering coefficients and thus the single scattering albedo (SSA) on the same sample volume. The extinction measurement is based on cavity attenuated phase shift (CAPS) techniques as employed in the CAPS PMex particle extinction monitor; scattering is measured using integrating nephelometry by incorporating a Lambertian integrating sphere within the sample cell. The scattering measurement is calibrated using the extinction measurement of non-absorbing particles. For small particles and low SSA, absorption can be measured with an accuracy of 6-8% at absorption levels as low as a few Mm-1. We present new results of the measurement of the mass absorption coefficient (MAC) of soot generated by an inverted methane diffusion flame at 630 nm. A value
Seasonal variation of the single scattering albedo of the Jungfraujoch aerosol
Energy Technology Data Exchange (ETDEWEB)
Collaud Coen, M.; Weingartner, E.; Corrigan, C.; Baltensperger, U.
2003-03-01
The single scattering albedo ({omega}{sub 0}) represents the fraction of the light extinction due to scattering. It is there-fore a key parameter to estimate the aerosol direct radiative forcing. The seasonal and diurnal variation of the single scattering albedo was calculated for the Jungfraujoch dry aerosol, which is representative for clean remote continental conditions. The values of {omega}{sub 0} vary between 0.7 and 0.9 depending on the season and on the wavelength. (author)
Resmini, Ronald G.; Graver, William R.; Kappus, Mary E.; Anderson, Mark E.
1996-11-01
Constrained energy minimization (CEM) has been applied to the mapping of the quantitative areal distribution of the mineral alunite in an approximately 1.8 km2 area of the Cuprite mining district, Nevada. CEM is a powerful technique for rapid quantitative mineral mapping which requires only the spectrum of the mineral to be mapped. A priori knowledge of background spectral signatures is not required. Our investigation applies CEM to calibrated radiance data converted to apparent reflectance (AR) and to single scattering albedo (SSA) spectra. The radiance data were acquired by the 210 channel, 0.4 micrometers to 2.5 micrometers airborne Hyperspectral Digital Imagery Collection Experiment sensor. CEM applied to AR spectra assumes linear mixing of the spectra of the materials exposed at the surface. This assumption is likely invalid as surface materials, which are often mixtures of particulates of different substances, are more properly modeled as intimate mixtures and thus spectral mixing analyses must take account of nonlinear effects. One technique for approximating nonlinear mixing requires the conversion of AR spectra to SSA spectra. The results of CEM applied to SSA spectra are compared to those of CEM applied to AR spectra. The occurrence of alunite is similar though not identical to mineral maps produced with both the SSA and AR spectra. Alunite is slightly more widespread based on processing with the SSA spectra. Further, fractional abundances derived from the SSA spectra are, in general, higher than those derived from AR spectra. Implications for the interpretation of quantitative mineral mapping with hyperspectral remote sensing data are discussed.
An algorithm to determine backscattering ratio and single scattering albedo
Digital Repository Service at National Institute of Oceanography (India)
Suresh, T.; Desa, E.; Matondkar, S.G.P.; Mascarenhas, A.A.M.Q.; Nayak, S.R.; Naik, P.
Algorithms to determine the inherent optical properties of water, backscattering probability and single scattering albedo at 490 and 676 nm from the apparent optical property, remote sensing reflectance are presented here. The measured scattering...
Effective single scattering albedo estimation using regional climate model
CSIR Research Space (South Africa)
Tesfaye, M
2011-09-01
Full Text Available In this study, by modifying the optical parameterization of Regional Climate model (RegCM), the authors have computed and compared the Effective Single-Scattering Albedo (ESSA) which is a representative of VIS spectral region. The arid, semi...
Bergstrom, Robert W.; Pilewskie, Peter; Schmid, Beat; Russell, Philip B.
2003-01-01
Using measurements of the spectral solar radiative flux and optical depth for 2 days (24 August and 6 September 2000) during the SAFARI 2000 intensive field experiment and a detailed radiative transfer model, we estimate the spectral single scattering albedo of the aerosol layer. The single scattering albedo is similar on the 2 days even though the optical depth for the aerosol layer was quite different. The aerosol single scattering albedo was between 0.85 and 0.90 at 350 nm, decreasing to 0.6 in the near infrared. The magnitude and decrease with wavelength of the single scattering albedo are consistent with the absorption properties of small black carbon particles. We estimate the uncertainty in the single scattering albedo due to the uncertainty in the measured fractional absorption and optical depths. The uncertainty in the single scattering albedo is significantly less on the high-optical-depth day (6 September) than on the low-optical-depth day (24 August). On the high-optical-depth day, the uncertainty in the single scattering albedo is 0.02 in the midvisible whereas on the low-optical-depth day the uncertainty is 0.08 in the midvisible. On both days, the uncertainty becomes larger in the near infrared. We compute the radiative effect of the aerosol by comparing calculations with and without the aerosol. The effect at the top of the atmosphere (TOA) is to cool the atmosphere by 13 W/sq m on 24 August and 17 W/sq m on 6 September. The effect on the downward flux at the surface is a reduction of 57 W/sq m on 24 August and 200 W/sq m on 6 September. The aerosol effect on the downward flux at the surface is in good agreement with the results reported from the Indian Ocean Experiment (INDOEX).
Andrews, Elisabeth; Ogren, John A.; Kinne, Stefan; Samset, Bjorn
2017-05-01
Here we present new results comparing aerosol optical depth (AOD), aerosol absorption optical depth (AAOD) and column single scattering albedo (SSA) obtained from in situ vertical profile measurements with AERONET ground-based remote sensing from two rural, continental sites in the US. The profiles are closely matched in time (within ±3 h) and space (within 15 km) with the AERONET retrievals. We have used Level 1.5 inversion retrievals when there was a valid Level 2 almucantar retrieval in order to be able to compare AAOD and column SSA below AERONET's recommended loading constraint (AOD > 0.4 at 440 nm). While there is reasonable agreement for the AOD comparisons, the direct comparisons of in situ-derived to AERONET-retrieved AAOD (or SSA) reveal that AERONET retrievals yield higher aerosol absorption than obtained from the in situ profiles for the low aerosol optical depth conditions prevalent at the two study sites. However, it should be noted that the majority of SSA comparisons for AOD440 > 0.2 are, nonetheless, within the reported SSA uncertainty bounds. The observation that, relative to in situ measurements, AERONET inversions exhibit increased absorption potential at low AOD values is generally consistent with other published AERONET-in situ comparisons across a range of locations, atmospheric conditions and AOD values. This systematic difference in the comparisons suggests a bias in one or both of the methods, but we cannot assess whether the AERONET retrievals are biased towards high absorption or the in situ measurements are biased low. Based on the discrepancy between the AERONET and in situ values, we conclude that scaling modeled black carbon concentrations upwards to match AERONET retrievals of AAOD should be approached with caution as it may lead to aerosol absorption overestimates in regions of low AOD. Both AERONET retrievals and in situ measurements suggest there is a systematic relationship between SSA and aerosol amount (AOD or aerosol light
Han, Tingting; Xu, Weiqi; Li, Jie; Freedman, Andrew; Zhao, Jian; Wang, Qingqing; Chen, Chen; Zhang, Yingjie; Wang, Zifa; Fu, Pingqing; Liu, Xingang; Sun, Yele
2017-02-01
Aerosol optical properties were measured in Beijing in summer and winter using a state-of-the-art cavity attenuated phase shift single scattering albedo monitor (CAPS PMssa) along with aerosol composition measurements by aerosol mass spectrometers and aethalometers. The SSA directly measured by the CAPS PMssa showed overall agreements with those derived from colocated measurements. However, substantial differences were observed during periods with low SSA values in both summer and winter, suggesting that interpretation of low SSA values needs to be cautious. The average (±σ) extinction coefficient (bext) and absorption coefficient (bap) were 336 (±343) Mm-1 and 44 (±41) Mm-1, respectively, during wintertime, which were approximately twice those observed in summer, while the average SSA was relatively similar, 0.86 (±0.06) and 0.85 (±0.04) in summer and winter, respectively. Further analysis showed that the variations in SSA can be approximately parameterized as a function of mass fraction of secondary particulate matter (fSPM), which is SSA = 0.74 + 0.19 × fSPM (fSPM > 0.3, r2 = 0.85). The contributions of aerosol species to extinction coefficients during the two seasons were also estimated. Our results showed that the light extinction was dominantly contributed by ammonium sulfate (30%) and secondary organic aerosol (22%) in summer, while organic aerosol was the largest contributor (51%) in winter. Consistently, SPM played the major role in visibility degradation in both seasons by contributing 70% of the total extinction.
Directory of Open Access Journals (Sweden)
S. Singh
2016-11-01
Full Text Available Biomass burning (BB aerosols have a significant effect on regional climate, and represent a significant uncertainty in our understanding of climate change. Using a combination of cavity ring-down spectroscopy and integrating nephelometry, the single scattering albedo (SSA and Ångstrom absorption exponent (AAE were measured for several North American biomass fuels. This was done for several particle diameters for the smoldering and flaming stage of white pine, red oak, and cedar combustion. Measurements were done over a wider wavelength range than any previous direct measurement of BB particles. While the offline sampling system used in this work shows promise, some changes in particle size distribution were observed, and a thorough evaluation of this method is required. The uncertainty of SSA was 6 %, with the truncation angle correction of the nephelometer being the largest contributor to error. While scattering and extinction did show wavelength dependence, SSA did not. SSA values ranged from 0.46 to 0.74, and were not uniformly greater for the smoldering stage than the flaming stage. SSA values changed with particle size, and not systematically so, suggesting the proportion of tar balls to fractal black carbon change with fuel type/state and particle size. SSA differences of 0.15–0.4 or greater can be attributed to fuel type or fuel state for fresh soot. AAE values were quite high (1.59–5.57, despite SSA being lower than is typically observed in wildfires. The SSA and AAE values in this work do not fit well with current schemes that relate these factors to the modified combustion efficiency of a burn. Combustion stage, particle size, fuel type, and fuel condition were found to have the most significant effects on the intrinsic optical properties of fresh soot, though additional factors influence aged soot.
The single scattering properties of the aerosol particles as aggregated spheres
International Nuclear Information System (INIS)
Wu, Y.; Gu, X.; Cheng, T.; Xie, D.; Yu, T.; Chen, H.; Guo, J.
2012-01-01
The light scattering and absorption properties of anthropogenic aerosol particles such as soot aggregates are complicated in the temporal and spatial distribution, which introduce uncertainty of radiative forcing on global climate change. In order to study the single scattering properties of anthorpogenic aerosol particles, the structures of these aerosols such as soot paticles and soot-containing mixtures with the sulfate or organic matter, are simulated using the parallel diffusion limited aggregation algorithm (DLA) based on the transmission electron microscope images (TEM). Then, the single scattering properties of randomly oriented aerosols, such as scattering matrix, single scattering albedo (SSA), and asymmetry parameter (AP), are computed using the superposition T-matrix method. The comparisons of the single scattering properties of these specific types of clusters with different morphological and chemical factors such as fractal parameters, aspect ratio, monomer radius, mixture mode and refractive index, indicate that these different impact factors can respectively generate the significant influences on the single scattering properties of these aerosols. The results show that aspect ratio of circumscribed shape has relatively small effect on single scattering properties, for both differences of SSA and AP are less than 0.1. However, mixture modes of soot clusters with larger sulfate particles have remarkably important effects on the scattering and absorption properties of aggregated spheres, and SSA of those soot-containing mixtures are increased in proportion to the ratio of larger weakly absorbing attachments. Therefore, these complex aerosols come from man made pollution cannot be neglected in the aerosol retrievals. The study of the single scattering properties on these kinds of aggregated spheres is important and helpful in remote sensing observations and atmospheric radiation balance computations.
He, L.; Arvidson, R. E.; O'Sullivan, J. A.
2018-04-01
We use a neural network (NN) approach to simultaneously retrieve surface single scattering albedos and temperature maps for CRISM data from 1.40 to 3.85 µm. It approximates the inverse of DISORT which simulates solar and emission radiative streams.
Di Biagio, C.; Formenti, P.; Caponi, L.; Cazaunau, M.; Pangui, E.; Journet, E.; Nowak, S.; Caquineau, S.; Andreae, M. O.; Kandler, K.; Saeed, T.; Piketh, S.; Seibert, D.; Williams, E.; Balkanski, Y.; Doussin, J. F.
2017-12-01
Mineral dust is one of the most abundant aerosol species in the atmosphere and strongly contributes to the global and regional direct radiative effect. Still large uncertainties persist on the magnitude and overall sign of the dust direct effect, where indeed one of the main unknowns is how much mineral dust absorbs light in the shortwave (SW) spectral range. Aerosol absorption is represented both by the imaginary part (k) of the complex refractive index or the single scattering albedo (SSA, i.e. the ratio of the scattering to extinction coefficient). In this study we present a new dataset of SW complex refractive indices and SSA for mineral dust aerosols obtained from in situ measurements in the 4.2 m3 CESAM simulation chamber at LISA (Laboratoire Interuniversitaire des Systemes Atmospheriques) in Créteil, France. Investigated dust aerosol samples were issued from major desert sources worldwide, including the African Sahara and Sahel, Eastern Asia, the Middle East, Southern Africa, Australia, and the Americas, with differing iron oxides content. Results from the present study provide a regional mapping of the SW absorption by dust and show that the imaginary part of the refractive index largely varies (by up to a factor 6, 0.003-0.02 at 370 nm and 0.001-0.003 at 950 nm) for the different source areas due to the change in the particle iron oxide content. The SSA for dust varies between 0.75-0.90 at 370 nm and 0.95-0.99 at 950 nm, with the largest absorption observed for Sahelian and Australian dust aerosols. Our range of variability for k and SSA is well bracketed by already published literature estimates, but suggests that regional‒dependent values should be used in models. The possible relationship between k and the dust iron oxides content is investigated with the aim of providing a parameterization of the regional‒dependent dust absorption to include in climate models.
Markowicz, K. M.; Ritter, C.; Lisok, J.; Makuch, P.; Stachlewska, I. S.; Cappelletti, D.; Mazzola, M.; Chilinski, M. T.
2017-09-01
This work presents a methodology for obtaining vertical profiles of aerosol single scattering properties based on a combination of different measurement techniques. The presented data were obtained under the iAREA (Impact of absorbing aerosols on radiative forcing in the European Arctic) campaigns conducted in Ny-Ålesund (Spitsbergen) during the spring seasons of 2015-2017. The retrieval uses in-situ observations of black carbon concentration and absorption coefficient measured by a micro-aethalometer AE-51 mounted onboard a tethered balloon, as well as remote sensing data obtained from sun photometer and lidar measurements. From a combination of the balloon-borne in-situ and the lidar data, we derived profiles of single scattering albedo (SSA) as well as absorption, extinction, and aerosol number concentration. Results have been obtained in an altitude range from about 400 m up to 1600 m a.s.l. and for cases with increased aerosol load during the Arctic haze seasons of 2015 and 2016. The main results consist of the observation of increasing values of equivalent black carbon (EBC) and absorption coefficient with altitude, and the opposite trend for aerosol concentration for particles larger than 0.3 μm. SSA was retrieved with the use of lidar Raman and Klett algorithms for both 532 and 880 nm wavelengths. In most profiles, SSA shows relatively high temporal and altitude variability. Vertical variability of SSA computed from both methods is consistent; however, some discrepancy is related to Raman retrieval uncertainty and absorption coefficient estimation from AE-51. Typically, very low EBC concentration in Ny-Ålesund leads to large error in the absorbing coefficient. However, SSA uncertainty for both Raman and Klett algorithms seems to be reasonable, e.g. SSA of 0.98 and 0.95 relate to an error of ±0.01 and ± 0.025, respectively.
SCAP-82, Single Scattering, Albedo Scattering, Point-Kernel Analysis in Complex Geometry
International Nuclear Information System (INIS)
Disney, R.K.; Vogtman, S.E.
1987-01-01
1 - Description of problem or function: SCAP solves for radiation transport in complex geometries using the single or albedo scatter point kernel method. The program is designed to calculate the neutron or gamma ray radiation level at detector points located within or outside a complex radiation scatter source geometry or a user specified discrete scattering volume. Geometry is describable by zones bounded by intersecting quadratic surfaces within an arbitrary maximum number of boundary surfaces per zone. Anisotropic point sources are describable as pointwise energy dependent distributions of polar angles on a meridian; isotropic point sources may also be specified. The attenuation function for gamma rays is an exponential function on the primary source leg and the scatter leg with a build- up factor approximation to account for multiple scatter on the scat- ter leg. The neutron attenuation function is an exponential function using neutron removal cross sections on the primary source leg and scatter leg. Line or volumetric sources can be represented as a distribution of isotropic point sources, with un-collided line-of-sight attenuation and buildup calculated between each source point and the detector point. 2 - Method of solution: A point kernel method using an anisotropic or isotropic point source representation is used, line-of-sight material attenuation and inverse square spatial attenuation between the source point and scatter points and the scatter points and detector point is employed. A direct summation of individual point source results is obtained. 3 - Restrictions on the complexity of the problem: - The SCAP program is written in complete flexible dimensioning so that no restrictions are imposed on the number of energy groups or geometric zones. The geometric zone description is restricted to zones defined by boundary surfaces defined by the general quadratic equation or one of its degenerate forms. The only restriction in the program is that the total
2015-09-01
Automated classification of built-up areas using neural networks and subpixel demixing methods on multispectral/hyperspectral data,” Proceedings of...scattering albedo (SSA) according to Hapke theory assuming bidirectional scattering at nadir look angles and uses a constrained linear model on the computed...following Hapke 9 (1993); and Mustard and Pieters 18 (1987)) assuming the reflectance spectra are bidirectional . SSA spectra were also generated
International Nuclear Information System (INIS)
Xiong, Chuan; Shi, Jiancheng
2014-01-01
To date, the light scattering models of snow consider very little about the real snow microstructures. The ideal spherical or other single shaped particle assumptions in previous snow light scattering models can cause error in light scattering modeling of snow and further cause errors in remote sensing inversion algorithms. This paper tries to build up a snow polarized reflectance model based on bicontinuous medium, with which the real snow microstructure is considered. The accurate specific surface area of bicontinuous medium can be analytically derived. The polarized Monte Carlo ray tracing technique is applied to the computer generated bicontinuous medium. With proper algorithms, the snow surface albedo, bidirectional reflectance distribution function (BRDF) and polarized BRDF can be simulated. The validation of model predicted spectral albedo and bidirectional reflectance factor (BRF) using experiment data shows good results. The relationship between snow surface albedo and snow specific surface area (SSA) were predicted, and this relationship can be used for future improvement of snow specific surface area (SSA) inversion algorithms. The model predicted polarized reflectance is validated and proved accurate, which can be further applied in polarized remote sensing. -- Highlights: • Bicontinuous random medium were used for real snow microstructure modeling. • Photon tracing technique with polarization status tracking ability was applied. • SSA–albedo relationship of snow is close to that of sphere based medium. • Validation of albedo and BRDF showed good results. • Validation of polarized reflectance showed good agreement with experiment data
Modelling of strong heterogeneities in aerosol single scattering albedos over a polluted region
Mallet, M.; Pont, V.; Liousse, C.
2005-05-01
To date, most models dedicated to the investigation of aerosol direct or semi-direct radiative forcings have assumed the various aerosol components to be either completely externally mixed or homogeneously internally mixed. Some recent works have shown that a core-shell treatment of particles should be more realistic, leading to significant differences in the radiative impact as compared to only externally or well-internally mixed states. To account for these studies, an optical module, ORISAM-RAD, has been developed for computing aerosol radiative properties under the hypothesis of internally mixed particles with a n-layer spherical concentric structure. Mesoscale simulations using ORISAM-RAD, coupled with the 3D mesoscale model Meso-NH-C, have been performed for one selected day (06/24/2001) during the ESCOMPTE experiment in the Marseilles-Fos/Berre region, which illustrate the ability of this new module to reproduce spatial heterogeneities of measured single scattering albedo (ωo), due to industrial and/or urban pollution plumes.
An Investigation of Aerosol Scattering and Absorption Properties in Wuhan, Central China
Directory of Open Access Journals (Sweden)
Wei Gong
2015-04-01
Full Text Available Aerosol scattering and absorption properties were continuously measured and analyzed at the urban Laboratory for Information Engineering in Surveying, Mapping and Remote Sensing (LIESMARS site in Wuhan, central China, from 1 December 2009 to 31 March 2014. The mean aerosol scattering coefficient , absorption coefficient , and single scattering albedo (SSA were 377.54 Mm−1, 119.06 Mm−1, and 0.73, respectively. Both and showed obvious annual variability with large values in winter and small values in summer, principally caused by the annual characteristics of meteorological conditions, especially planetary boundary layer height (PBLH and local emissions. The SSA showed a slight annual variation. High values of SSA were related to formation of secondary aerosols in winter hazes and aerosol hygroscopic growth in humid summer. The large SSA in June can be attributed to the biomass combustion in Hubei and surrounding provinces. Both and showed double peak phenomena in diurnal variation resulting from the shallow stable PBLH at night and automobile exhaust emission during morning rush hours. The SSA also exhibited a double peak phenomenon related to the proportional variation of black carbon (BC and light scattering particulates in the day and night. The long-term exploration on quantified aerosol optical properties can help offer scientific basis of introducing timely environmental policies for local government.
Directory of Open Access Journals (Sweden)
S. Talebi
2018-04-01
Full Text Available This paper presents a theoretical study of derivation Microwave Vegetation Indices (MVIs in different pairs of frequencies using two methods. In the first method calculating MVI in different frequencies based on Matrix Doubling Model (to take in to account multi scattering effects has been done and analyzed in various soil properties. The second method was based on MVI theoretical basis and its independency to underlying soil surface signals. Comparing the results from two methods with vegetation properties (single scattering albedo and optical depth indicated partial correlation between MVI from first method and optical depth, and full correlation between MVI from second method and vegetation properties. The second method to derive MVI can be used widely in global microwave vegetation monitoring.
Ignatovich, V K
2005-01-01
A new, algebraic, method is applied to calculation of neutron albedo from substance to check the claim that use of ultradispersive fuel and moderator of an active core can help to gain in size and mass of the reactor. In a model of isotropic distribution of incident and reflected neutrons it is shown that coherent scattering on separate grains in the case of thermal neutrons increases transport cross section negligibly, however it decreases albedo from a wall of finite thickness because of decrease of substance density. A visible increase of albedo takes place only for neutrons with wave length of the order of the size of a single grain.
Flynn, Connor; Dahlgren, R. P.; Dunagan, S.; Johnson, R.; Kacenelenbogen, M.; LeBlanc, S.; Livingston, J.; Redemann, J.; Schmid, B.; Segal Rozenhaimer, M.;
2015-01-01
The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyper spectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT).From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy TCAP I II campaigns, and NASAs SEAC4RS and ARISE campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2, and from in situ measurements.
Sengupta, D.; Gao, L.; Wilcox, E. M.; Beres, N. D.; Moosmüller, H.; Khlystov, A.
2017-12-01
Radiative forcing and climate change greatly depends on earth's surface albedo and its temporal and spatial variation. The surface albedo varies greatly depending on the surface characteristics ranging from 5-10% for calm ocean waters to 80% for some snow-covered areas. Clean and fresh snow surfaces have the highest albedo and are most sensitive to contamination with light absorbing impurities that can greatly reduce surface albedo and change overall radiative forcing estimates. Accurate estimation of snow albedo as well as understanding of feedbacks on climate from changes in snow-covered areas is important for radiative forcing, snow energy balance, predicting seasonal snowmelt, and run off rates. Such information is essential to inform timely decision making of stakeholders and policy makers. Light absorbing particles deposited onto the snow surface can greatly alter snow albedo and have been identified as a major contributor to regional climate forcing if seasonal snow cover is involved. However, uncertainty associated with quantification of albedo reduction by these light absorbing particles is high. Here, we use Mie theory (under the assumption of spherical snow grains) to reconstruct the single scattering parameters of snow (i.e., single scattering albedo ῶ and asymmetry parameter g) from observation-based size distribution information and retrieved refractive index values. The single scattering parameters of impurities are extracted with the same approach from datasets obtained during laboratory combustion of biomass samples. Instead of using plane-parallel approximation methods to account for multiple scattering, we have used the simple "Monte Carlo ray/photon tracing approach" to calculate the snow albedo. This simple approach considers multiple scattering to be the "collection" of single scattering events. Using this approach, we vary the effective snow grain size and impurity concentrations to explore the evolution of snow albedo over a wide
Dintwe, Kebonye; Okin, Gregory S.; Xue, Yongkang
2017-06-01
Surface albedo is a critical parameter that controls surface energy balance. In dryland ecosystems, fires play a significant role in decreasing surface albedo, resulting in positive radiative forcing. Here we investigate the long-term effect of fire on surface albedo. We devised a method to calculate short-, medium-, and long-term effect of fire-induced radiative forcing and their relative effects on energy balance. We used Moderate Resolution Imaging Spectroradiometer (MODIS) data in our analysis, covering different vegetation classes in sub-Saharan Africa (SSA). Our analysis indicated that mean short-term fire-induced albedo change in SSA was -0.022, -0.035, and -0.041 for savannas, shrubland, and grasslands, respectively. At regional scale, mean fire-induced albedo change in savannas was -0.018 and -0.024 for northern sub-Saharan of Africa and the southern hemisphere Africa, respectively. The short-term mean fire-induced radiative forcing in burned areas in sub-Saharan Africa (SSA) was 5.41 W m-2, which contributed continental and global radiative forcings of 0.25 and 0.058 W m-2, respectively. The impact of fire in surface albedo has long-lasting effects that varies with vegetation type. The long-term energetic effects of fire-induced albedo change and associated radiative forcing were, on average, more than 19 times greater across SSA than the short-term effects, suggesting that fires exerted far more radiative forcing than previously thought. Taking into account the actual duration of fire's effect on surface albedo, we conclude that the contribution of SSA fires, globally and throughout the year, is 0.12 W m-2. These findings provide crucial information on possible impact of fire on regional climate variability.
Aethalometer multiple scattering correction Cref for mineral dust aerosols
Di Biagio, Claudia; Formenti, Paola; Cazaunau, Mathieu; Pangui, Edouard; Marchand, Nicolas; Doussin, Jean-François
2017-08-01
In this study we provide a first estimate of the Aethalometer multiple scattering correction Cref for mineral dust aerosols. Cref is an empirical constant used to correct the aerosol absorption coefficient measurements for the multiple scattering artefact of the Aethalometer; i.e. the filter fibres on which aerosols are deposited scatter light and this is miscounted as absorption. The Cref at 450 and 660 nm was obtained from the direct comparison of Aethalometer data (Magee Sci. AE31) with (i) the absorption coefficient calculated as the difference between the extinction and scattering coefficients measured by a Cavity Attenuated Phase Shift Extinction analyser (CAPS PMex) and a nephelometer respectively at 450 nm and (ii) the absorption coefficient from a MAAP (Multi-Angle Absorption Photometer) at 660 nm. Measurements were performed on seven dust aerosol samples generated in the laboratory by the mechanical shaking of natural parent soils issued from different source regions worldwide. The single scattering albedo (SSA) at 450 and 660 nm and the size distribution of the aerosols were also measured. Cref for mineral dust varies between 1.81 and 2.56 for a SSA of 0.85-0.96 at 450 nm and between 1.75 and 2.28 for a SSA of 0.98-0.99 at 660 nm. The calculated mean for dust is 2.09 (±0.22) at 450 nm and 1.92 (±0.17) at 660 nm. With this new Cref the dust absorption coefficient by the Aethalometer is about 2 % (450 nm) and 11 % (660 nm) higher than that obtained by using Cref = 2.14 at both 450 and 660 nm, as usually assumed in the literature. This difference induces a change of up to 3 % in the dust SSA at 660 nm. The Cref seems to be independent of the fine and coarse particle size fractions, and so the obtained Cref can be applied to dust both close to sources and following transport. Additional experiments performed with pure kaolinite minerals and polluted ambient aerosols indicate Cref of 2.49 (±0.02) and 2.32 (±0.01) at 450 and 660 nm (SSA = 0.96-0.97) for
Dunagan, Stephen E.
2016-01-01
The 4STAR (Spectrometer for Sky-Scanning, Sun-Tracking Atmospheric Research) instrument combines airborne sun tracking capabilities of the Ames Airborne Tracking Sun Photometer (AATS-14) with AERONET (Aerosol Robotic Network)-like sky-scanning capability and adds state-of-the-art fiber-coupled grating spectrometry to yield hyperspectral measurements of direct solar irradiance and angularly resolved sky radiance. The combination of sun-tracking and sky-scanning capability enables retrievals of wavelength-dependent aerosol optical depth (AOD), mode-resolved aerosol size distribution (SD), asphericity, and complex refractive index, and thus also the scattering phase function, asymmetry parameter, single-scattering albedo (SSA), and absorption aerosol optical thickness (AAOT). From 2012 to 2014 4STAR participated in four major field campaigns: the U.S. Dept. of Energy's TCAP (Two-Column Aerosol Project) I & II campaigns, and NASA's SEAC4RS (Studies of Emissions, Atmospheric Composition, Clouds and Climate Coupling by Regional Surveys) and ARISE (Arctic Radiation - IceBridge Sea & Ice Experiment) campaigns. Establishing a strong performance record, 4STAR operated successfully on all flights conducted during each of these campaigns. Sky radiance spectra from scans in either constant azimuth (principal plane) or constant zenith angle (almucantar) were interspersed with direct beam measurements during level legs. During SEAC4RS and ARISE, 4STAR airborne measurements were augmented with flight-level albedo from the collocated Shortwave Spectral Flux Radiometer (SSFR) providing improved specification of below-aircraft radiative conditions for the retrieval. Calibrated radiances and retrieved products will be presented with particular emphasis on detailed comparisons of ambient SSA retrievals and measurements during SEAC4RS from 4STAR, AERONET, HSRL2 (High Spectral Resolution Lidar), and from in situ measurements.
Energy Technology Data Exchange (ETDEWEB)
Tuereci, R.G. [Kirikkale Univ., Kirikkale (Turkey). Kirikkale Vocational School; Tuereci, D. [Ministry of Education, Ankara (Turkey). 75th year Anatolia High School
2017-05-15
One speed, time independent and homogeneous medium neutron transport equation can be solved with the anisotropic scattering which includes both the linear anisotropic and the quadratic anisotropic scattering properties. Having solved Case's eigenfunctions and the orthogonality relations among these eigenfunctions, some neutron transport problems such as albedo problem can be calculated as numerically by using numerical or semi-analytic methods. In this study the half-space albedo problem is investigated by using the modified F{sub N} method.
Directory of Open Access Journals (Sweden)
E. I. Kassianov
2007-06-01
Full Text Available Multi-filter Rotating Shadowband Radiometers (MFRSRs provide routine measurements of the aerosol optical depth (τ at six wavelengths (0.415, 0.5, 0.615, 0.673, 0.870 and 0.94 μm. The single-scattering albedo (π0 is typically estimated from the MFRSR measurements by assuming the asymmetry parameter (g. In most instances, however, it is not easy to set an appropriate value of g due to its strong temporal and spatial variability. Here, we introduce and validate an updated version of our retrieval technique that allows one to estimate simultaneously π0 and g for different types of aerosol. We use the aerosol and radiative properties obtained during the Atmospheric Radiation Measurement (ARM Program's Aerosol Intensive Operational Period (IOP to validate our retrieval in two ways. First, the MFRSR-retrieved optical properties are compared with those obtained from independent surface, Aerosol Robotic Network (AERONET, and aircraft measurements. The MFRSR-retrieved optical properties are in reasonable agreement with these independent measurements. Second, we perform radiative closure experiments using the MFRSR-retrieved optical properties. The calculated broadband values of the direct and diffuse fluxes are comparable (~5 W/m2 to those obtained from measurements.
Three-group albedo method applied to the diffusion phenomenon with up-scattering of neutrons
International Nuclear Information System (INIS)
Terra, Andre M. Barge Pontes Torres; Silva, Jorge A. Valle da; Cabral, Ronaldo G.
2007-01-01
The main objective of this research is to develop a three-group neutron Albedo algorithm considering the up-scattering of neutrons in order to analyse the diffusion phenomenon in nonmultiplying media. The neutron Albedo method is an analytical method that does not try to solve describing explicit equations for the neutron fluxes. Thus the neutron Albedo methodology is very different from the conventional methodology, as the neutron diffusion theory model. Graphite is analyzed as a model case. One major application is in the determination of the nonleakage probabilities with more understandable results in physical terms than conventional radiation transport method calculations. (author)
Energy Technology Data Exchange (ETDEWEB)
Oklopčić, Antonija [California Institute of Technology, 1200 East California Boulevard, MC 249-17, Pasadena, CA 91125 (United States); Hirata, Christopher M. [Center for Cosmology and Astroparticle Physics, Ohio State University, 191 West Woodruff Avenue, Columbus, OH 43210 (United States); Heng, Kevin, E-mail: oklopcic@astro.caltech.edu [Center for Space and Habitability, University of Bern, Sidlerstrasse 5, CH-3012, Bern (Switzerland)
2017-09-10
The diagnostic potential of the spectral signatures of Raman scattering, imprinted in planetary albedo spectra at short optical wavelengths, has been demonstrated in research on planets in the solar system, and has recently been proposed as a probe of exoplanet atmospheres, complementary to albedo studies at longer wavelengths. Spectral features caused by Raman scattering offer insight into the properties of planetary atmospheres, such as the atmospheric depth, composition, and temperature, as well as the possibility of detecting and spectroscopically identifying spectrally inactive species, such as H{sub 2} and N{sub 2}, in the visible wavelength range. Raman albedo features, however, depend on both the properties of the atmosphere and the shape of the incident stellar spectrum. Identical planetary atmospheres can produce very different albedo spectra depending on the spectral properties of the host star. Here we present a set of geometric albedo spectra calculated for atmospheres with H{sub 2}/He, N{sub 2}, and CO{sub 2} composition, irradiated by different stellar types ranging from late A to late K stars. Prominent albedo features caused by Raman scattering appear at different wavelengths for different types of host stars. We investigate how absorption due to the alkali elements sodium and potassium may affect the intensity of Raman features, and we discuss the preferred strategies for detecting Raman features in future observations.
The slab albedo problem for the triplet scattering kernel with modified F{sub N} method
Energy Technology Data Exchange (ETDEWEB)
Tuereci, Demet [Ministry of Education, 75th year Anatolia High School, Ankara (Turkey)
2016-12-15
One speed, time independent neutron transport equation for a slab geometry with the quadratic anisotropic scattering kernel is considered. The albedo and transmission factor are calculated by the modified F{sub N} method. The obtained numerical results are listed for different scattering coefficients.
Aerosol layer height from synergistic use of VIIRS and OMPS
Lee, J.; Hsu, N. Y. C.; Sayer, A. M.; Kim, W.; Seftor, C. J.
2017-12-01
This study presents an Aerosol Single-scattering albedo and Height Estimation (ASHE) algorithm, which retrieves the height of UV-absorbing aerosols by synergistically using the Visible Infrared Imaging Radiometer Suite (VIIRS) and the Ozone Mapping and Profiler Suite (OMPS). ASHE provides height information over a much broader area than ground-based or spaceborne lidar measurements by benefitting from the wide swaths of the two instruments used. As determination of single-scattering albedo (SSA) of the aerosol layer is the most critical part for the performance and coverage of ASHE, here we demonstrate three different strategies to constrain the SSA. First, ASHE is able to retrieve the SSA of UV-absorbing aerosols when Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) provides vertical profiles of the aerosol layer of interest. Second, Aerosol Robotic Network (AERONET) inversions can directly constrain the SSA of the aerosol layer when collocated with VIIRS or OMPS. Last, a SSA climatology from ASHE, AERONET, or other data sources can be used for large-scale, aged aerosol events, for which climatological SSA is well-known, at the cost of a slight decrease in retrieval accuracy. The same algorithm can be applied to measurements of similar type, such as those made by the Moderate Resolution Imaging Spectroradiometer (MODIS) and Ozone Monitoring Instrument (OMI), for a long-term, consistent data record.
Ferrare, R. A.; Melfi, S. H.; Whiteman, D. N.; Evans, K. D.; Poellot, M.; Kaufman, Y. J.
1998-01-01
Aerosol backscattering and extinction profiles measured by the NASA Goddard Space Flight Center Scanning Raman Lidar (SRL) during the remote cloud sensing (RCS) intensive operations period (IOP) at the Department of Energy Atmospheric Radiation Measurement (ARM) southern Great Plains (SGP) site during two nights in April 1994 are discussed. These profiles are shown to be consistent with the simultaneous aerosol size distribution measurements made by a PCASP (Passive Cavity Aerosol Spectrometer Probe) optical particle counter flown on the University of North Dakota Citation aircraft. We describe a technique which uses both lidar and PCASP measurements to derive the dependence of particle size on relative humidity, the aerosol real refractive index n, and estimate the effective single-scattering albedo Omega(sub 0). Values of n ranged between 1.4-1.5 (dry) and 1.37-1.47 (wet); Omega(sub 0) varied between 0.7 and 1.0. The single-scattering albedo derived from this technique is sensitive to the manner in which absorbing particles are represented in the aerosol mixture; representing the absorbing particles as an internal mixture rather than the external mixture assumed here results in generally higher values of Omega(sub 0). The lidar measurements indicate that the change in particle size with relative humidity as measured by the PCASP can be represented in the form discussed by Hattel with the exponent gamma = 0.3 + or - 0.05. The variations in aerosol optical and physical characteristics captured in the lidar and aircraft size distribution measurements are discussed in the context of the meteorological conditions observed during the experiment.
Energy Technology Data Exchange (ETDEWEB)
Tuereci, R. Goekhan [Kirikkale Univ. (Turkey). Kirikkale Vocational School; Tuereci, D. [Ministry of Education, Ankara (Turkey). 75th year Anatolia High School
2017-11-15
One speed, time independent and homogeneous medium neutron transport equation is solved with the anisotropic scattering which includes both the linearly and the quadratically anisotropic scattering kernel. Having written Case's eigenfunctions and the orthogonality relations among of these eigenfunctions, slab albedo problem is investigated as numerically by using Modified F{sub N} method. Selected numerical results are presented in tables.
International Nuclear Information System (INIS)
Freitas, B.M.; Silva, A.X. da
2014-01-01
The Instituto de Radioprotecao e Dosimetria (IRD) runs a neutron individual monitoring service with albedo type monitor and thermoluminescent detectors (TLD). Moreover the largest number of workers exposed to neutrons in Brazil is exposed to 241 Am-Be fields. Therefore a study of the response of albedo dosemeter due to neutron scattering from 241 Am-Be source is important for a proper calibration. In this work, it has been evaluated the influence of the scattering correction in two distances at the Low Scattering Laboratory of the Neutron Laboratory of the Brazilian National Laboratory (Lab. Nacional de Metrologia Brasileira de Radiacoes Ionizantes) in the calibration of that albedo dosemeter for a 241 Am-Be source. (author)
Ishimoto, Hiroshi; Adachi, Satoru; Yamaguchi, Satoru; Tanikawa, Tomonori; Aoki, Teruo; Masuda, Kazuhiko
2018-04-01
Sizes and shapes of snow particles were determined from X-ray computed microtomography (micro-CT) images, and their single-scattering properties were calculated at visible and near-infrared wavelengths using a Geometrical Optics Method (GOM). We analyzed seven snow samples including fresh and aged artificial snow and natural snow obtained from field samples. Individual snow particles were numerically extracted, and the shape of each snow particle was defined by applying a rendering method. The size distribution and specific surface area distribution were estimated from the geometrical properties of the snow particles, and an effective particle radius was derived for each snow sample. The GOM calculations at wavelengths of 0.532 and 1.242 μm revealed that the realistic snow particles had similar scattering phase functions as those of previously modeled irregular shaped particles. Furthermore, distinct dendritic particles had a characteristic scattering phase function and asymmetry factor. The single-scattering properties of particles of effective radius reff were compared with the size-averaged single-scattering properties. We found that the particles of reff could be used as representative particles for calculating the average single-scattering properties of the snow. Furthermore, the single-scattering properties of the micro-CT particles were compared to those of particle shape models using our current snow retrieval algorithm. For the single-scattering phase function, the results of the micro-CT particles were consistent with those of a conceptual two-shape model. However, the particle size dependence differed for the single-scattering albedo and asymmetry factor.
Universal dependence of the total number albedo of photons on the mean number of photon scatterings
Directory of Open Access Journals (Sweden)
Ljubenov Vladan L.
2011-01-01
Full Text Available This paper presents the results of research on photon reflection from plane targets based on Monte Carlo simulations performed by the MCNP code. Five materials (water, concrete, aluminum, iron, and copper are examined in the area of initial photon energies of up to 200 keV. The values of the total number albedo for photons dependent on the initial photon energy or the mean number of photon scatterings are calculated and graphically presented. We have shown that the values of the total number albedo for different target materials, expressed as a function of the mean number of photon scatterings, are in good agreement with each other and can be approximated by simple, universal analytic functions obtained by the least squares method. The accuracy of these analytic appoximations is confirmed by their comparison with the results of PENELOPE and FOTELP Monte Carlo codes.
Aethalometer multiple scattering correction Cref for mineral dust aerosols
Directory of Open Access Journals (Sweden)
C. Di Biagio
2017-08-01
Full Text Available In this study we provide a first estimate of the Aethalometer multiple scattering correction Cref for mineral dust aerosols. Cref is an empirical constant used to correct the aerosol absorption coefficient measurements for the multiple scattering artefact of the Aethalometer; i.e. the filter fibres on which aerosols are deposited scatter light and this is miscounted as absorption. The Cref at 450 and 660 nm was obtained from the direct comparison of Aethalometer data (Magee Sci. AE31 with (i the absorption coefficient calculated as the difference between the extinction and scattering coefficients measured by a Cavity Attenuated Phase Shift Extinction analyser (CAPS PMex and a nephelometer respectively at 450 nm and (ii the absorption coefficient from a MAAP (Multi-Angle Absorption Photometer at 660 nm. Measurements were performed on seven dust aerosol samples generated in the laboratory by the mechanical shaking of natural parent soils issued from different source regions worldwide. The single scattering albedo (SSA at 450 and 660 nm and the size distribution of the aerosols were also measured. Cref for mineral dust varies between 1.81 and 2.56 for a SSA of 0.85–0.96 at 450 nm and between 1.75 and 2.28 for a SSA of 0.98–0.99 at 660 nm. The calculated mean for dust is 2.09 (±0.22 at 450 nm and 1.92 (±0.17 at 660 nm. With this new Cref the dust absorption coefficient by the Aethalometer is about 2 % (450 nm and 11 % (660 nm higher than that obtained by using Cref = 2.14 at both 450 and 660 nm, as usually assumed in the literature. This difference induces a change of up to 3 % in the dust SSA at 660 nm. The Cref seems to be independent of the fine and coarse particle size fractions, and so the obtained Cref can be applied to dust both close to sources and following transport. Additional experiments performed with pure kaolinite minerals and polluted ambient aerosols indicate Cref of 2.49 (±0.02 and 2
Directory of Open Access Journals (Sweden)
C. Di Biagio
2016-08-01
Full Text Available Pollution aerosols strongly influence the composition of the Western Mediterranean basin, but at present little is known on their optical properties. We report in this study in situ observations of the single scattering albedo (ω of pollution aerosol plumes measured over the Western Mediterranean basin during the TRAQA (TRansport and Air QuAlity airborne campaign in summer 2012. Cases of pollution export from different source regions around the basin and at different altitudes between ∼ 160 and 3500 m above sea level were sampled during the flights. Data from this study show a large variability of ω, with values between 0.84–0.98 at 370 nm and 0.70–0.99 at 950 nm. The single scattering albedo generally decreases with the wavelength, with some exception associated to the mixing of pollution with sea spray or dust particles over the sea surface. The lowest values of ω (0.84–0.70 between 370 and 950 nm are measured in correspondence of a fresh plume possibly linked to ship emissions over the basin. The range of variability of ω observed in this study seems to be independent of the source region around the basin, as well as of the altitude and aging time of the plumes. The observed variability of ω reflects in a large variability for the complex refractive index of pollution aerosols, which is estimated to span in the large range 1.41–1.77 and 0.002–0.097 for the real and the imaginary parts, respectively, between 370 and 950 nm. Radiative calculations in clear-sky conditions were performed with the GAME radiative transfer model to test the sensitivity of the aerosol shortwave Direct Radiative Effect (DRE to the variability of ω as observed in this study. Results from the calculations suggest up to a 50 and 30 % change of the forcing efficiency (FE, i.e. the DRE per unit of optical depth, at the surface (−160/−235 W m−2 τ−1 at 60° solar zenith angle and at the Top-Of-Atmosphere (−137/−92
Influence of stratospheric aerosol on albedo
Energy Technology Data Exchange (ETDEWEB)
Gormatyuk, Yu K; Kaufman, Yu G; Kolomeev, M P
1985-06-01
The influence of stratospheric aerosol (SA) on the transfer of solar radiation in the atmosphere is the principal factor determining the effect of SA on climate. The change in the radiation balance under the influence of SA is computed most precisely in radiative-convective models. However, the complex method used in these models cannot be used for other types of climate models. The objective of the study was to obtain a quantitative evaluation of the influence of SA on albedo without the use of simplifying assumptions. In the approximation of single scattering an expression is derived for change in albedo under the influence of stratospheric aerosol taking into account the dependence of albedo of the atmosphere-earth's surface system on solar zenith distance. The authors give the results of computations of the response of mean annual albedo to sulfuric acid aerosol for 10/sup 0/ latitude zones in the Northern Hemisphere. Specifically, computations of the optical characteristics of aerosol were made using the Mie theory for 10 spectral intervals taking in the range of wavelengths of solar radiation from 0.29 to 4.0 ..mu.. m. The refractive index of aerosol was stipulated in accordance with Palmer and Williams. The angular dependence of albedo for cloudless and cloudy atmospheres given by Harshvardhan was used. The values of undisturbed albedo were assumed to be identical for all wavelengths due to lack of climatological data on the spectral dependence of albedo of the atmosphere-earth's surface system. The angular distribution of the intensity of solar radiation for each of the latitude zones was computed by the method described by I.M. Alekseyev, et al.
Bisi, M. M.; Chang, O.; Gonzalez-Esparza, A.; Fallows, R. A.; Aguilar-Rodriguez, E.
2017-12-01
The phenomenon of Interplanetary Scintillation (IPS) occurs from the scattering of radio waves coming from compact radio sources that cross electron density fluctuations in the interplanetary medium. By analyzing these fluctuations in the measurements of flux intensity of galactic (compact) radio sources in a radio telescope, it is possible to infer some properties of structures in the solar wind. Studies based on observations of IPS have provided valuable information on the physics of the internal heliosphere for over 50 years. There are two techniques that provide IPS results: 1) Single-Station Analysis (SSA), where a theoretical model is fitted to the observed spectrum; and 2) Cross-Correlation Function (CCF), where two antennas separated by a few hundred kilometers simultaneously and independently observe the same radio source. In order to combine and complement solar wind speed determinations, it is important to validate the results of these two IPS techniques. In this work we analyze events from previously studied observations from MERLIN (Multi-Element Radio-Linked Interferometer Network) using the CCF methodology. The SSA model fit is applied to these observations and compared with the previous results to validate the two techniques. The objective is to know the behavior of the parameters in cases studied by CCFs that can be implemented in the SSA model. This work studies the capability of SSA model fit to describe complex events in the interplanetary environment and seeks to improve the adjustment of parameters from individual spectra to the theoretical model. The validation of these two methodologies is important to be able to combine data in real time from different radio telescopes which is necessary for the success of the Worldwide Interplanetary Scintillation Stations (WIPSS) Network to monitor solar wind structures using IPS data.
International Nuclear Information System (INIS)
Um, Junshik; McFarquhar, Greg M.
2013-01-01
The optimal orientation averaging scheme (regular lattice grid scheme or quasi Monte Carlo (QMC) method), the minimum number of orientations, and the corresponding computing time required to calculate the average single-scattering properties (i.e., asymmetry parameter (g), single-scattering albedo (ω o ), extinction efficiency (Q ext ), scattering efficiency (Q sca ), absorption efficiency (Q abs ), and scattering phase function at scattering angles of 90° (P 11 (90°)), and 180° (P 11 (180°))) within a predefined accuracy level (i.e., 1.0%) were determined for four different nonspherical atmospheric ice crystal models (Gaussian random sphere, droxtal, budding Bucky ball, and column) with maximum dimension D=10μm using the Amsterdam discrete dipole approximation at λ=0.55, 3.78, and 11.0μm. The QMC required fewer orientations and less computing time than the lattice grid. The calculations of P 11 (90°) and P 11 (180°) required more orientations than the calculations of integrated scattering properties (i.e., g, ω o , Q ext , Q sca , and Q abs ) regardless of the orientation average scheme. The fewest orientations were required for calculating g and ω o . The minimum number of orientations and the corresponding computing time for single-scattering calculations decreased with an increase of wavelength, whereas they increased with the surface-area ratio that defines particle nonsphericity. -- Highlights: •The number of orientations required to calculate the average single-scattering properties of nonspherical ice crystals is investigated. •Single-scattering properties of ice crystals are calculated using ADDA. •Quasi Monte Carlo method is more efficient than lattice grid method for scattering calculations. •Single-scattering properties of ice crystals depend on a newly defined parameter called surface area ratio
Inversion of the Earth spherical albedo from radiation-pressure
Wilkman, Olli; Herranen, Joonas; Näränen, Jyri; Virtanen, Jenni; Koivula, Hannu; Poutanen, Markku; Penttilä, Antti; Gritsevich, Maria; Muinonen, Karri
2017-04-01
We are studying the retrieval of the spherical albedo and net radiation of the Earth from the perturbations caused by the planet's radiation on the dynamics of its satellites. The spherical or Bond albedo gives the ratio of the fluxes incident on and scattered by the planet. The net radiation represents the net heat input into the planet's climate system and drives changes in its atmospheric, surface, and ocean temperatures. The ultimate aim of the study is inverting the problem and estimating the Earth albedo based on observations of satellites, simultaneously improving the space-geodetic positioning accuracy. Here we investigate the effect of the spherical albedo on satellite orbits with the help of a simplified model. We simulate the propagation of satellite orbits using a new simulation software. The simulation contains the main perturbing forces on medium and high Earth orbits, used by, e.g., navigation satellites, including the radiation pressure of reflected sunlight from the Earth. An arbitrary satellite shape model can be used, and the rotation of the satellite is modeled. In this first study, we use a box-wing satellite model with a simple surface BRDF. We also assume a diffusely reflecting Earth with a single global albedo value. We vary the Earth albedo and search for systematic effects on different orbits. Thereafter, we estimate the dependence of the albedo accuracy on the satellite positioning and timing data available. We show that the inversion of the spherical albedo with reasonable accuracy is feasible from the current space-geodetic measurements.
Srivastava, A. K.; Bisht, D. S.; Singh, Sachchidanand; Kishore, N.; Soni, V. K.; Singh, Siddhartha; Tiwari, S.
2018-06-01
Aerosol scattering and absorption characteristics were investigated at an urban megacity Delhi in the western Indo-Gangetic Basin (IGB) during the period from October 2011 to September 2012 using different in-situ measurements. The scattering coefficient (σsp at 550 nm) varied between 71 and 3014 Mm-1 (mean 710 ± 615 Mm-1) during the entire study period, which was about ten times higher than the absorption coefficient (σabs at 550 nm 67 ± 40 Mm-1). Seasonally, σsp and σabs were substantially higher during the winter/post-monsoon periods, which also gave rise to single scattering albedo (SSA) by 5%. The magnitude of SSA (at 550 nm) varied between 0.81 and 0.94 (mean: 0.89 ± 0.05). Further, the magnitude of scattering Ångström exponent (SAE) and back-scattering Ångström exponent (BAE) showed a wide range from -1.20 to 1.57 and -1.13 to 0.87, respectively which suggests large variability in aerosol sizes and emission sources. Relatively higher aerosol backscatter fraction (b at 550 nm) during the monsoon (0.25 ± 0.10) suggests more inhomogeneous scattering, associated with the coarser dust particles. However, lower value of b during winter (0.13 ± 0.02) is associated with more isotropic scattering due to dominance of smaller size particles. This is further confirmed with the estimated asymmetry parameter (AP at 550 nm), which exhibits opposite trend with b. The aerosol optical parameters were used in a radiative transfer model to estimate aerosol radiative forcing. A mean radiative forcing of -61 ± 22 W m-2 (ranging from -111 to -40 W m-2) was observed at the surface and 42 ± 24 W m-2 (ranging from 18 to 87 W m-2) into the atmosphere, which can give rise to the mean atmospheric heating rate of 1.18 K day-1.
Albedo analytical method for multi-scattered neutron flux calculation in cavity
International Nuclear Information System (INIS)
Shin, Kazuo; Selvi, S.; Hyodo, Tomonori
1986-01-01
A simple formula which describes multi-scattered neutron flux in a spherical cavity was derived based on the albedo concept. The formura treats a neutron source which has an arbitrary energy-angle distribution and is placed at any point in the cavity. The derived formula was applied to the estimation of neutron fluxes in two cavities, i.e. a spherical concrete cell with a 14-MeV neutron source at the center and the ''YAYOI'' reactor cavity with a pencil beam of reactor neutrons. The results of the analytical formula agreed very well with the reference data in the both problems. It was concluded that the formula is applicable to estimate the neutron fluxes in a spherical cell except for special cases that tangential source neutrons are incident to the cavity wall. (author)
International Nuclear Information System (INIS)
1982-01-01
1 - Description of problem or function: Format: SAIL format; Number of groups: 23 neutron / 17 gamma-ray; Nuclides: Type 04 Concrete and Low Carbon Steel (A533B). Origin: Science Applications, Inc (SAI); Weighting spectrum: yes. SAIL is a library of albedo scattering data to be used in three-dimensional Monte Carlo codes to solve radiation transport problems specific to the reactor pressure vessel cavity region of a LWR. The library contains data for Type 04 Concrete and Low Carbon Steel (A533B). 2 - Method of solution: The calculation of the albedo data was perform- ed with a version of the discrete ordinates transport code DOT which treats the transport of neutrons, secondary gamma-rays and gamma- rays in one dimension, while maintaining the complete two-dimension- al treatment of the angular dependence
Spectral and diurnal variations in clear sky planetary albedo
Briegleb, B.; Ramanathan, V.
1982-01-01
Spectral and diurnal variations in the clear sky planetary albedo of the earth are calculated using a radiative transfer model to obtain January and July values for a 5 deg x 5 deg global grid. The model employs observed climatological values of temperatures, humidities, snow and sea-ice cover. The diurnal cycle of clear sky albedo is calculated in the following intervals: 0.2-0.5, 0.5-0.7, and 0.7-4 microns. Observed ozone distribution is specified as a function of latitude and season. The 0.2-0.5 micron spectral albedo is 10-20% higher than the total albedo for all latitudes because of Rayleigh scattering; the 0.5-0.7 micron albedo differs from the total albedo by 1-2% for most latitudes, while the 0.7-4 micron albedo is 5-10% lower than the total because of strong atmospheric absorption. Planetary albedo decreases from morning to local noon, with diurnal variations being particularly strong over water.
International Nuclear Information System (INIS)
Liu Li; Mishchenko, Michael I.; Cairns, Brian; Carlson, Barbara E.; Travis, Larry D.
2006-01-01
In this study, we model single-scattering properties of small cirrus crystals using mixtures of polydisperse, randomly oriented spheroids and cylinders with varying aspect ratios and with a refractive index representative of water ice at a wavelength of 1.88 μm. The Stokes scattering matrix elements averaged over wide shape distributions of spheroids and cylinders are compared with those computed for polydisperse surface-equivalent spheres. The shape-averaged phase function for a mixture of oblate and prolate spheroids is smooth, featureless, and nearly flat at side-scattering angles and closely resembles those typically measured for cirrus. Compared with the ensemble-averaged phase function for spheroids, that for a shape distribution of cylinders shows a relatively deeper minimum at side-scattering angles. This may indicate that light scattering from realistic cirrus crystals can be better represented by a shape mixture of ice spheroids. Interestingly, the single-scattering properties of shape-averaged oblate and prolate cylinders are very similar to those of compact cylinders with a diameter-to-length ratio of unity. The differences in the optical cross sections, single-scattering albedo, and asymmetry parameter between the spherical and the nonspherical particles studied appear to be relatively small. This may suggest that for a given optical thickness, the influence of particle shape on the radiative forcing caused by a cloud composed of small ice crystals can be negligible
Measurement of TLD Albedo response on various calibration phantoms
International Nuclear Information System (INIS)
Momose, T.; Tsujimura, N.; Shinohara, K.; Ishiguro, H.; Nakamura, T.
1996-01-01
The International Commission on Radiation Units and Measurements (ICRU) has recommended that individual dosemeter should be calibrated on a suitable phantom and has pointed out that the calibration factor of a neutron dosemeter is strongly influenced by the the exact size and shape of the body and the phantom to which the dosemeter is attached. As the principle of an albedo type thermoluminescent personal dosemeter (albedo TLD) is essentially based on a detection of scattered and moderated neutron from a human body, the sensitivity of albedo TLD is strongly influenced by the incident neutron energy and the calibration phantom. (1) Therefore for albedo type thermoluminescent personal dosemeter (albedo TLD), the information of neutron albedo response on the calibration phantom is important for appropriate dose estimation. In order to investigate the effect of phantom type on the reading of the albedo TLD, measurement of the TLD energy response and angular response on some typical calibration phantoms was performed using dynamitron accelerator and 252 Cf neutron source. (author)
Discrete ordinate theory of radiative transfer. 2: Scattering from maritime haze
Kattawar, G. W.; Plass, G. N.; Catchings, F. E.
1971-01-01
Discrete ordinate theory was used to calculate the reflected and transmitted radiance of photons which have interacted with plane parallel maritime haze layers. The results are presented for three solar zenith angles, three values of the surface albedo, and a range of optical thicknesses from very thin to very thick. The diffuse flux at the lower boundary and the cloud albedo were tabulated. The forward peak and other features in the single scattered phase function caused the radiance in many cases to be very different from that for Rayleigh scattering. The variation of the radiance with both the zenith or nadir angle and the azimuthal angle is more marked, and the relative limb darkening under very thick layers is greater, for haze than for Rayleigh scattering. The downward diffuse flux at the lower boundary for A = O is always greater and the cloud albedo is always less for haze than for Rayleigh layers.
Directory of Open Access Journals (Sweden)
G. Paredes-Miranda
2009-06-01
Full Text Available A photoacoustic spectrometer, a nephelometer, an aethalometer, and an aerosol mass spectrometer were used to measure at ground level real-time aerosol light absorption, scattering, and chemistry at an urban site located in North East Mexico City (Instituto Mexicano del Petroleo, Mexican Petroleum Institute, denoted by IMP, as part of the Megacity Impact on Regional and Global Environments field experiment, MILAGRO, in March 2006. Photoacoustic and reciprocal nephelometer measurements at 532 nm accomplished with a single instrument compare favorably with conventional measurements made with an aethalometer and a TSI nephelometer. The diurnally averaged single scattering albedo at 532 nm was found to vary from 0.60 to 0.85 with the peak value at midday and the minimum value at 07:00 a.m. local time, indicating that the Mexico City plume is likely to have a net warming effect on local climate. The peak value is associated with strong photochemical generation of secondary aerosol. It is estimated that the photochemical production of secondary aerosol (inorganic and organic is approximately 75% of the aerosol mass concentration and light scattering in association with the peak single scattering albedo. A strong correlation of aerosol scattering at 532 nm and total aerosol mass concentration was found, and an average mass scattering efficiency factor of 3.8 m2/g was determined. Comparisons of photoacoustic and aethalometer light absorption with oxygenated organic aerosol concentration (OOA indicate a very small systematic bias of the filter based measurement associated with OOA and the peak aerosol single scattering albedo.
Paredes-Miranda, G.; Arnott, W. P.; Jimenez, J. L.; Aiken, A. C.; Gaffney, J. S.; Marley, N. A.
2009-06-01
A photoacoustic spectrometer, a nephelometer, an aethalometer, and an aerosol mass spectrometer were used to measure at ground level real-time aerosol light absorption, scattering, and chemistry at an urban site located in North East Mexico City (Instituto Mexicano del Petroleo, Mexican Petroleum Institute, denoted by IMP), as part of the Megacity Impact on Regional and Global Environments field experiment, MILAGRO, in March 2006. Photoacoustic and reciprocal nephelometer measurements at 532 nm accomplished with a single instrument compare favorably with conventional measurements made with an aethalometer and a TSI nephelometer. The diurnally averaged single scattering albedo at 532 nm was found to vary from 0.60 to 0.85 with the peak value at midday and the minimum value at 07:00 a.m. local time, indicating that the Mexico City plume is likely to have a net warming effect on local climate. The peak value is associated with strong photochemical generation of secondary aerosol. It is estimated that the photochemical production of secondary aerosol (inorganic and organic) is approximately 75% of the aerosol mass concentration and light scattering in association with the peak single scattering albedo. A strong correlation of aerosol scattering at 532 nm and total aerosol mass concentration was found, and an average mass scattering efficiency factor of 3.8 m2/g was determined. Comparisons of photoacoustic and aethalometer light absorption with oxygenated organic aerosol concentration (OOA) indicate a very small systematic bias of the filter based measurement associated with OOA and the peak aerosol single scattering albedo.
Steps Toward an EOS-Era Aerosol Air Mass Type Climatology
Kahn, Ralph A.
2012-01-01
We still have a way to go to develop a global climatology of aerosol type from the EOS-era satellite data record that currently spans more than 12 years of observations. We have demonstrated the ability to retrieve aerosol type regionally, providing a classification based on the combined constraints on particle size, shape, and single-scattering albedo (SSA) from the MISR instrument. Under good but not necessarily ideal conditions, the MISR data can distinguish three-to-five size bins, two-to-four bins in SSA, and spherical vs. non-spherical particles. However, retrieval sensitivity varies enormously with scene conditions. So, for example, there is less information about aerosol type when the mid-visible aerosol optical depth (AOD) is less that about 0.15 or 0.2.
Directory of Open Access Journals (Sweden)
J. Bi
2017-06-01
Full Text Available We conducted a comprehensive field campaign to explore the optical characteristics of mineral dust in Dunhuang farmland near the Gobi Desert of northwest China during spring of 2012. The day-to-day and diurnal variations of dust aerosol showed prominent features throughout the experiment, primarily attributable to frequent dust events and local anthropogenic emissions. The overall average mass concentrations of the particulate matter with an aerodynamic diameter less than 10 µm (PM10, light scattering coefficient (σsp, 670, absorption coefficient (σap, 670, and single-scattering albedo (SSA670 were 113 ± 169 µg m−3, 53.3 ± 74.8 Mm−1, 3.2 ± 2.4 Mm−1, and 0.913 ± 0.05, respectively, which were comparable to the background levels in the southern United States but smaller than those in the eastern and other northwestern Chinese cities. The anthropogenic dust produced by agricultural cultivations (e.g., land planning, plowing, and disking exerted a significant superimposed effect on high dust concentrations in Dunhuang farmland prior to the growing season (i.e., from 1 April to 10 May. Strong south valley wind and vertical mixing in daytime scavenged the pollution, and the weak northeast mountain wind and stable inversion layer at night favorably accumulated the air pollutants near the surface. In the afternoon (13:00–18:00 LT, local time, mean SSA670 was 0.945 ± 0.04 predominantly from dust particles, whereas finer particles and lower SSA670 values ( ∼ 0.90–0.92 were measured at night, suggesting the potential influence by the mixed dust pollutants. During a typical biomass burning event on 4 April 2012, σap, 670 increased from ∼ 2.0 to 4.75 Mm−1 and SSA670 changed from ∼ 0.90 to ∼ 0.83, implying remarkable modification of aerosol absorptive properties induced by human activities. The findings of this study would help to advance an in
PROCEEDINGS OF RIKEN BNL RESEARCH CENTER WORKSHOP ENTITLED ''SINGLE SPIN ASYMMETRIES'' (VOLUME 75)
International Nuclear Information System (INIS)
YUAN, F.; VOGELSANG, W.
2005-01-01
Single-transverse spin asymmetries (SSA) in strong interactions have a long history, starting from the 1970s and 1980s when surprisingly large single-transverse spin asymmetries were observed in p+p → πX and pp → Λ + X, where really none were expected. They have again attracted much interest in recent years from both experimental and theoretical sides. In particular, first measurements by the STAR, PHENIX, and BRAHMS collaborations at RHIC have now become available which again reveal large single transverse spin asymmetries for hadron production in polarized proton proton scattering. This extends the SSA observations from the fixed target energy range to the collider regime. Meanwhile, experimental studies in Deep Inelastic Scattering by the HERMES collaboration at DESY, SMC at CERN, and CLAS at JLab also show a remarkably large SSA in semi-inclusive hadron production, γ*p → πX, when the proton is transversely polarized. On the theoretical side, there are several approaches to understanding SSA within Quantum Chromodynamics (QCD). For example, to explain the large SSAs for hadron production in hadron collisions, a mechanism that takes into account the contribution from quark-gluon-quark correlations (twist-3) in the nucleon was proposed. On the other hand, possible origins of SSA in DIS and hadronic scattering were also found in leading-twist transverse momentum dependent parton distributions. Current theoretical efforts aim at a better conceptual understanding of these two types of mechanisms, and of their connections. We were very happy at this timely date to bring together the theorists and experimentalists of this field to review and discuss the current theoretical status and the latest experimental results. The whole workshop contained 25 formal talks, both experiment (15) and theory (10), and a few informal talks and many fruitful discussions. The topics covered all the relevant SSA observables, including in Deep Inelastic Scattering, the Drell
The colour potentials of SSA-containing mortar
DEFF Research Database (Denmark)
Kappel, Annemette; Ottosen, Lisbeth M.; Kirkelund, Gunvor Marie
2015-01-01
This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA is with a......This paper reports an experimental study of aesthetical qualities of mortar containing sewage sludgeash (SSA). SSA is the residue produced at water treatment plants where incineration of the sludge is applied in order to decrease volume and to prevent pathogens from spreading. Today SSA...
Impact of OH Heterogenous Oxidation on the Evolution of Brown Carbon Aerosol Optical Properties
Schnitzler, E.; Abbatt, J.
2017-12-01
The effects of varying relative humidity (RH) on the evolution of brown carbon (BrC) optical properties induced by heterogeneous OH oxidation were investigated in a series of photooxidation chamber experiments. A BrC surrogate was generated from aqueous 1,3-dihydroxybenzene (10 mM) and H2O2 (10 mM) exposed to >300 nm radiation, atomized, passed through a series of trace gas denuders, and injected into the chamber, which was conditioned to about 10 or 60% RH. Following aerosol injection, H2O2 was continuously bubbled into the chamber; an hour later, the chamber was irradiated with black-lights (UV-B) to produce OH. Before irradiation, aerosol absorption and scattering at 405 nm, measured using a photoacoustic spectrometer, decreased due only to deposition and dilution, and single scattering albedo (SSA) was relatively steady. In the presence of gas-phase OH, absorption first increased, despite continued particle losses, and SSA decreased. Subsequently, absorption decreased faster than scattering, and SSA increased uniformly. At 60% RH, colour enhancement, likely associated with functionalization, was greatest after only minutes of reaction. In contrast, at 10% RH, peak colour enhancement occurred after about two hours of reaction, indicating that the decrease in RH and the attendant increase in particle viscosity significantly impeded heterogeneous OH oxidation of the BrC surrogate.
International Nuclear Information System (INIS)
Ding, Jiachen; Bi, Lei; Yang, Ping; Kattawar, George W.; Weng, Fuzhong; Liu, Quanhua; Greenwald, Thomas
2017-01-01
An ice crystal single-scattering property database is developed in the microwave spectral region (1 to 874 GHz) to provide the scattering, absorption, and polarization properties of 12 ice crystal habits (10-plate aggregate, 5-plate aggregate, 8-column aggregate, solid hexagonal column, hollow hexagonal column, hexagonal plate, solid bullet rosette, hollow bullet rosette, droxtal, oblate spheroid, prolate spheroid, and sphere) with particle maximum dimensions from 2 µm to 10 mm. For each habit, four temperatures (160, 200, 230, and 270 K) are selected to account for temperature dependence of the ice refractive index. The microphysical and scattering properties include projected area, volume, extinction efficiency, single-scattering albedo, asymmetry factor, and six independent nonzero phase matrix elements (i.e. P_1_1, P_1_2, P_2_2, P_3_3, P_4_3 and P_4_4). The scattering properties are computed by the Invariant Imbedding T-Matrix (II-TM) method and the Improved Geometric Optics Method (IGOM). The computation results show that the temperature dependence of the ice single-scattering properties in the microwave region is significant, particularly at high frequencies. Potential active and passive remote sensing applications of the database are illustrated through radar reflectivity and radiative transfer calculations. For cloud radar applications, ignoring temperature dependence has little effect on ice water content measurements. For passive microwave remote sensing, ignoring temperature dependence may lead to brightness temperature biases up to 5 K in the case of a large ice water path. - Highlights: • Single-scattering properties of ice crystals are computed from 1 to 874 GHz. • Ice refractive index temperature dependence is considered at 160, 200, 230 and 270 K. • Potential applications of the database to microwave remote sensing are illustrated. • Ignoring temperature dependence of ice refractive index can lead to 5 K difference in IWP retrieval
Compton-scatter tissue densitometry: calculation of single and multiple scatter photon fluences
International Nuclear Information System (INIS)
Battista, J.J.; Bronskill, M.J.
1978-01-01
The accurate measurement of in vivo electron densities by the Compton-scatter method is limited by attenuations and multiple scattering in the patient. Using analytic and Monte Carlo calculation methods, the Clarke tissue density scanner has been modelled for incident monoenergetic photon energies from 300 to 2000 keV and for mean scattering angles of 30 to 130 degrees. For a single detector focussed to a central position in a uniform water phantom (25 x 25 x 25 cm 3 ) it has been demonstrated that: (1) Multiple scatter contamination is an inherent limitation of the Compton-scatter method of densitometry which can be minimised, but not eliminated, by improving the energy resolution of the scattered radiation detector. (2) The choice of the incident photon energy is a compromise between the permissible radiation dose to the patient and the tolerable level of multiple scatter contamination. For a mean scattering angle of 40 degrees, the intrinsic multiple-single scatter ratio decreases from 64 to 35%, and the radiation dose (per measurement) increases from 1.0 to 4.1 rad, as the incident photon energy increases from 300 to 2000 keV. These doses apply to a sampled volume of approximately 0.3 cm 3 and an electron density precision of 0.5%. (3) The forward scatter densitometer configuration is optimum, minimising both the dose and the multiple scatter contamination. For an incident photon energy of 1250 keV, the intrinsic multiple-single scatter ratio reduces from 122 to 27%, and the dose reduces from 14.3 to 1.2 rad, as the mean scattering angle decreases from 130 to 30 degrees. These calculations have been confirmed by experimental measurements. (author)
Improved streaming analysis technique: spherical harmonics expansion of albedo data
International Nuclear Information System (INIS)
Albert, T.E.; Simmons, G.L.
1979-01-01
An improved albedo scattering technique was implemented with a three-dimensional Monte Carlo transport code for use in analyzing radiation streaming problems. The improvement was based on a shifted spherical Harmonics expansion of the doubly differential albedo data base. The result of the improvement was a factor of 3 to 10 reduction in data storage requirements and approximately a factor of 3 to 6 increase in computational speed. Comparisons of results obtained using the technique with measurements are shown for neutron streaming in one- and two-legged square concrete ducts
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSA423 (Link to dictyBase) - - - - SSA423F (Link to Original s...ite) SSA423F 443 - - - - - - Show SSA423 Library SS (Link to library) Clone ID SSA423 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...FIIGFFLCLTVFLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIA...VSNSTDNTGCGEYTSCGDCREDK GCVWCGSEGICTEGTFYGTKPLNINGACKDFMWMQCKIQGRWAILIAAGGAFLIIVFFFI CLCCCCCRRKKDKHYHNIQDDET
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D
RAMAN SCATTERING BY MOLECULAR HYDROGEN AND NITROGEN IN EXOPLANETARY ATMOSPHERES
Energy Technology Data Exchange (ETDEWEB)
Oklopčić, Antonija [California Institute of Technology, MC 249-17, 1200 East California Boulevard, Pasadena, California 91125 (United States); Hirata, Christopher M. [Center for Cosmology and Astroparticle Physics, Ohio State University, 191 West Woodruff Avenue, Columbus, Ohio 43210 (United States); Heng, Kevin, E-mail: oklopcic@astro.caltech.edu [Center for Space and Habitability, University of Bern, Sidlerstrasse 5, CH-3012, Bern (Switzerland)
2016-11-20
An important source of opacity in exoplanet atmospheres at short visible and near-UV wavelengths is Rayleigh scattering of light on molecules. It is accompanied by a related, albeit weaker process—Raman scattering. We analyze the signatures of Raman scattering imprinted in the reflected light and the geometric albedo of exoplanets, which could provide information about atmospheric properties. Raman scattering affects the geometric albedo spectra of planets in the following ways. First, it causes filling-in of strong absorption lines in the incident radiation, thus producing sharp peaks in the albedo. Second, it shifts the wavelengths of spectral features in the reflected light causing the so-called Raman ghost lines. Raman scattering can also cause a broadband reduction of the albedo due to wavelength shifting of a stellar spectrum with red spectral index. Observing the Raman peaks in the albedo could be used to measure the column density of gas, thus providing constraints on the presence of clouds in the atmosphere. Observing the Raman ghost lines could be used to spectroscopically identify the main scatterer in the atmosphere, even molecules like H{sub 2} or N{sub 2}, which do not have prominent spectral signatures in the optical wavelength range. If detected, ghost lines could also provide information about the temperature of the atmosphere. In this paper, we investigate the effects of Raman scattering in hydrogen- and nitrogen-dominated atmospheres. We analyze the feasibility of detecting the signatures of Raman scattering with the existing and future observational facilities, and of using these signatures as probes of exoplanetary atmospheres.
Energy Technology Data Exchange (ETDEWEB)
Shoemaker, N. F.; Huddleston, C. M.
1962-12-10
Treatments of the differential dose albedo of gamma rays on concrete have supposed that the albedo value is a function of: the energy of the incident gamma radiation, the polar angle of incidence, the polar angle of reflection (or scatter), and the azimuthal angle of reflection. It is demonstrated that, if certain reasonable assumptions are made regarding the mechanism of reflection, it is not necessary to investigate variations in albedo with azimuthal angle of refiection. Once differential dose albedo has been determined for a complete set of incident and reflected polar angles with zero azimuth, albedo at any azimuth can be derived by a suitable transformation. (auth)
The Case for GEO Hosted SSA Payloads
Welsch, C.; Armand, B.; Repp, M.; Robinson, A.
2014-09-01
Space situational awareness (SSA) in the geosynchronous earth orbit (GEO) belt presents unique challenges, and given the national importance and high value of GEO satellites, is increasingly critical as space becomes more congested and contested. Space situational awareness capabilities can serve as an effective deterrent against potential adversaries if they provide accurate, timely, and persistent information and are resilient to the threat environment. This paper will demonstrate how simple optical SSA payloads hosted on GEO commercial and government satellites can complement the SSA mission and data provided by Space-Based Space Surveillance (SBSS) and the Geosynchronous Space Situational Awareness Program (GSSAP). GSSAP is built by Orbital Sciences Corporation and launched on July 28, 2014. Analysis performed for this paper will show how GEO hosted SSA payloads, working in combination with SBSS and GSSAP, can increase persistence and timely coverage of high value assets in the GEO belt. The potential to further increase GEO object identification and tracking accuracy by integrating SSA data from multiple sources across different viewing angles including GEO hosted SSA sources will be addressed. Hosting SSA payloads on GEO platforms also increases SSA mission architecture resiliency as the sensors are by distributed across multiple platforms including commercial platforms. This distributed architecture presents a challenging target for an adversary to attempt to degrade or disable. We will present a viable concept of operations to show how data from hosted SSA sensors could be integrated with SBSS and GSSAP data to present a comprehensive and more accurate data set to users. Lastly, we will present an acquisition approach using commercial practices and building on lessons learned from the Commercially Hosted Infra Red Payload CHIRP to demonstrate the affordability of GEO hosted SSA payloads.
International Nuclear Information System (INIS)
Fu, Q.; Thorsen, T.J.; Su, J.; Ge, J.M.; Huang, J.P.
2009-01-01
We simulate the single-scattering properties (SSPs) of dust aerosols with both spheroidal and spherical shapes at a wavelength of 0.55 μm for two refractive indices and four effective radii. Herein spheres are defined by preserving both projected area and volume of a non-spherical particle. It is shown that the relative errors of the spheres to approximate the spheroids are less than 1% in the extinction efficiency and single-scattering albedo, and less than 2% in the asymmetry factor. It is found that the scattering phase function of spheres agrees with spheroids better than the Henyey-Greenstein (HG) function for the scattering angle range of 0-90 o . In the range of ∼90-180 o , the HG function is systematically smaller than the spheroidal scattering phase function while the spherical scattering phase function is smaller from ∼90 o to 145 o but larger from ∼145 o to 180 o . We examine the errors in reflectivity and absorptivity due to the use of SSPs of equivalent spheres and HG functions for dust aerosols. The reference calculation is based on the delta-DISORT-256-stream scheme using the SSPs of the spheroids. It is found that the errors are mainly caused by the use of the HG function instead of the SSPs for spheres. By examining the errors associated with the delta-four- and delta-two-stream schemes using various approximate SSPs of dust aerosols, we find that the errors related to the HG function dominate in the delta-four-stream results, while the errors related to the radiative transfer scheme dominate in the delta-two-stream calculations. We show that the relative errors in the global reflectivity due to the use of sphere SSPs are always less than 5%. We conclude that Mie-based SSPs of non-spherical dust aerosols are well suited in radiative flux calculations.
Summer Arctic sea ice albedo in CMIP5 models
Koenigk, T.; Devasthale, A.; Karlsson, K.-G.
2014-01-01
Spatial and temporal variations of summer sea ice albedo over the Arctic are analyzed using an ensemble of historical CMIP5 model simulations. The results are compared to the CLARA-SAL product that is based on long-term satellite observations. The summer sea ice albedo varies substantially among CMIP5 models, and many models show large biases compared to the CLARA-SAL product. Single summer months show an extreme spread of ice albedo among models; July values vary between 0....
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...NNTLKPKQTTKGFNIGGQPGNPTN*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c
A Multisensor Approach to Global Retrievals of Land Surface Albedo
Directory of Open Access Journals (Sweden)
Aku Riihelä
2018-05-01
Full Text Available Satellite-based retrievals offer the most cost-effective way to comprehensively map the surface albedo of the Earth, a key variable for understanding the dynamics of radiative energy interactions in the atmosphere-surface system. Surface albedo retrievals have commonly been designed separately for each different spaceborne optical imager. Here, we introduce a novel type of processing framework that combines the data from two polar-orbiting optical imager families, the Advanced Very High-Resolution Radiometer (AVHRR and Moderate Resolution Imaging Spectroradiometer (MODIS. The goal of the paper is to demonstrate that multisensor albedo retrievals can provide a significant reduction in the sampling time required for a robust and comprehensive surface albedo retrieval, without a major degradation in retrieval accuracy, as compared to state-of-the-art single-sensor retrievals. We evaluated the multisensor retrievals against reference in situ albedo measurements and compare them with existing datasets. The results show that global land surface albedo retrievals with a sampling period of 10 days can offer near-complete spatial coverage, with a retrieval bias mostly comparable to existing single sensor datasets, except for bright surfaces (deserts and snow where the retrieval framework shows degraded performance because of atmospheric correction design compromises. A level difference is found between the single sensor datasets and the demonstrator developed here, pointing towards a need for further work in the atmospheric correction, particularly over bright surfaces, and inter-sensor radiance homogenization. The introduced framework is expandable to include other sensors in the future.
Study of Aerosol Optical Properties Over Two Sites in the Foothills of the Central Himalayas
Rupakheti, D.; Kang, S.; Cong, Z.; Rupakheti, M.; Tripathee, L.; Panday, A. K.; Holben, B.
2018-04-01
Atmospheric aerosol possesses impacts on climate system and ecological environments, human health and agricultural productivity. The environment over Himalayas and Tibetan Plateau region are continuously degraded due to the transport of pollution from the foothills of the Himalayas; mostly the Indo-Gangetic Plain (IGP). Thus, analysis of aerosol optical properties over two sites; Lumbini and Kathmandu (the southern slope of central Himalayas) using AERONET's CIMEL sun photometer were conducted in this study. Aerosol optical depth (AOD at 500 nm), angstrom exponent (α or AE), volume size distribution (VSD), single scattering albedo (SSA) and asymmetry parameter (AP) were studied for 2013-2014 and the average AOD was found to be: 0.64 ± 0.41 (Lumbini) and 0.45 ± 0.30 (Kathmandu). The average AE was found to be: 1.25 ± 0.24 and 1.26 ± 0.18 respectively for two sites. The relation between AOD and AE was used to discriminate the aerosol types over these sites which indicated anthropogenic, mixed and biomass burning origin aerosol constituted the major aerosol types in Lumbini and Kathmandu. A clear bi-modal distribution of aerosol volume size was observed with highest volume concentration during the post-monsoon season in fine mode and pre-monsoon season in coarse mode (Lumbini) and highest value over both modes during pre-monsoon season in Kathmandu. The single scattering albedo (SSA) and asymmetry parameter (AP) analyses suggested aerosols over the Himalayan foothills sites are dominated by absorbing and anthropogenic aerosols from urban and industrial activities and biomass burning. Long-term studies are essential to understand and characterize the nature of aerosol over this research gap zone.
Aerosol climatology over the Mexico City basin: Characterization of optical properties
Carabali, Giovanni; Estévez, Héctor Raúl; Valdés-Barrón, Mauro; Bonifaz-Alfonzo, Roberto; Riveros-Rosas, David; Velasco-Herrera, Víctor Manuel; Vázquez-Gálvez, Felipe Adrián
2017-09-01
Climatology of Aerosol Optical Depth (AOD), Single Scattering Albedo (SSA), and aerosol particle-size distribution were analyzed using a 15-year (1999-2014) dataset from AErosol RObotic NETwork (AERONET) observations over the Mexico City (MC) basin. The atmosphere over this site is dominated by two main aerosol types, represented by urban/industrial pollution and biomass-burning particles. Due to the specific meteorological conditions within the basin, seasons are usually classified into three as follows: Dry Winter (DW) (November-February); Dry Spring (DS) (March-April), and the RAiny season (RA) (May-October), which are mentioned throughout this article. Using a CIMEL sun photometer, we conducted continuous observations over the MC urban area from January 1999 to December 2014. Aerosol Optical Depth (AOD), Ångström exponent (α440-870), Single Scattering Albedo (SSA), and aerosol particle-size distribution were derived from the observational data. The overall mean AOD500 during the 1999-2014 period was 0.34 ± 0.07. The monthly mean AOD reached a maximal value of 0.49 in May and a minimal value of 0.27 in February and March. The average α440-870 value for the period studied was 1.50 ± 0.16. The monthly average of α440-870 reached a minimal value of 1.32 in August and a maximal value of 1.61 in May. Average SSA at 440 nm was 0.89 throughout the observation period, indicating that aerosols over Mexico City are composed mainly of absorptive particles. Concentrations of fine- and coarse-mode aerosols over MC were highest in DS season compared with other seasons, especially for particles with radii measuring between 0.1 and 0.2 μm. Results from the Spectral De-convolution Algorithm (SDA) show that fine-mode aerosols dominated AOD variability in MC. In the final part of this article, we present a classification of aerosols in MC by using the graphical method proposed by Gobbi et al. (2007), which is based on the combined analysis of α and its spectral curvature
Delivering SSA Capabilities to the Warfighter
van Weezendonk, J.; Sherk, J.; Ryan, T.; McGuire, R.
The Space Superiority Systems Wing at the Space and Missile Center (SMC/SY) equips US forces with Offensive Counterspace (OCS), Defensive Counterspace (DCS), and Space Situation Awareness (SSA) systems that further enhance space superiority. The Technology Division (SYT) mission is to identify, develop, and transition cutting-edge technologies to the warfighter. SYT invests in the most relevant technologies for SSA, DCS and OCS that enhance SMC/SY's portfolio. This presentation will provide an overview of the SMC/SY SSA Technology being worked and highlights several key programs. The presentation will also highlight how the SMC/SY SSA efforts fit into to a Space Superiority Architecture. SYT executes its own Space Control Technology program line and leverages technologies from various DoD and national laboratories, Federally Funded Research and Development Companies, national agencies, industry and academia to accomplish their mission. The portions of the SY FY06 SSA portfolio that will be discussed are: Precision Metrics, Star Sensor Studies, Multi-mission Deployable Optical System, Intelligent Agent Data Fusion efforts, ESSA ACTD and the GReAT tech demo.
Response of TLD-albedo and nuclear track dosimeters exposed to plutonium sources
International Nuclear Information System (INIS)
Brackenbush, L.W.; Baumgartner, W.V.; Fix, J.J.
1991-12-01
Neutron dosimetry has been extensively studied at Hanford since the mid-1940s. At the present time, Hanford contractors use thermoluminescent dosimeter (TLD)-albedo dosimeters to record the neutron dose equivalent received by workers. The energy dependence of the TLD-albedo dosimeter has been recognized and documented since introduced at Hanford in 1964 and numerous studies have helped assure the accuracy of dosimeters. With the recent change in Hanford's mission, there has been a significant decrease in the handling of plutonium tetrafluoride, and an increase in the handling of plutonium metal and plutonium oxide sources. This study was initiated to document the performance of the current Hanford TLD-albedo dosimeter under the low scatter conditions of the calibration laboratory and under the high scatter conditions in the work place under carefully controlled conditions at the Plutonium Finishing Plant (PFP). The neutron fields at the PFP facility were measured using a variety of instruments, including a multisphere spectrometer, tissue equivalent proportional counters, and specially calibrated rem meters. Various algorithms were used to evaluate the TLD-albedo dosimeters, and the results are given in this report. Using current algorithms, the dose equivalents evaluated for bare sources and sources with less than 2.5 cm (1 in.) of acrylic plastic shielding in high scatter conditions typical of glove box operations are reasonably accurate. Recently developed CR-39 track etch dosimeters (TEDs) were also exposed in the calibration laboratory and at the PFP. The results indicate that the TED dosimeters are quite accurate for both bare and moderated neutron sources. Until personnel dosimeter is available that incorporates a direct measure of the neutron dose to a person, technical uncertainties in the accuracy of the recorded data will continue
Response of TLD-albedo and nuclear track dosimeters exposed to plutonium sources
Energy Technology Data Exchange (ETDEWEB)
Brackenbush, L.W.; Baumgartner, W.V.; Fix, J.J.
1991-12-01
Neutron dosimetry has been extensively studied at Hanford since the mid-1940s. At the present time, Hanford contractors use thermoluminescent dosimeter (TLD)-albedo dosimeters to record the neutron dose equivalent received by workers. The energy dependence of the TLD-albedo dosimeter has been recognized and documented since introduced at Hanford in 1964 and numerous studies have helped assure the accuracy of dosimeters. With the recent change in Hanford`s mission, there has been a significant decrease in the handling of plutonium tetrafluoride, and an increase in the handling of plutonium metal and plutonium oxide sources. This study was initiated to document the performance of the current Hanford TLD-albedo dosimeter under the low scatter conditions of the calibration laboratory and under the high scatter conditions in the work place under carefully controlled conditions at the Plutonium Finishing Plant (PFP). The neutron fields at the PFP facility were measured using a variety of instruments, including a multisphere spectrometer, tissue equivalent proportional counters, and specially calibrated rem meters. Various algorithms were used to evaluate the TLD-albedo dosimeters, and the results are given in this report. Using current algorithms, the dose equivalents evaluated for bare sources and sources with less than 2.5 cm (1 in.) of acrylic plastic shielding in high scatter conditions typical of glove box operations are reasonably accurate. Recently developed CR-39 track etch dosimeters (TEDs) were also exposed in the calibration laboratory and at the PFP. The results indicate that the TED dosimeters are quite accurate for both bare and moderated neutron sources. Until personnel dosimeter is available that incorporates a direct measure of the neutron dose to a person, technical uncertainties in the accuracy of the recorded data will continue.
Response of TLD-albedo and nuclear track dosimeters exposed to plutonium sources
Energy Technology Data Exchange (ETDEWEB)
Brackenbush, L.W.; Baumgartner, W.V.; Fix, J.J.
1991-12-01
Neutron dosimetry has been extensively studied at Hanford since the mid-1940s. At the present time, Hanford contractors use thermoluminescent dosimeter (TLD)-albedo dosimeters to record the neutron dose equivalent received by workers. The energy dependence of the TLD-albedo dosimeter has been recognized and documented since introduced at Hanford in 1964 and numerous studies have helped assure the accuracy of dosimeters. With the recent change in Hanford's mission, there has been a significant decrease in the handling of plutonium tetrafluoride, and an increase in the handling of plutonium metal and plutonium oxide sources. This study was initiated to document the performance of the current Hanford TLD-albedo dosimeter under the low scatter conditions of the calibration laboratory and under the high scatter conditions in the work place under carefully controlled conditions at the Plutonium Finishing Plant (PFP). The neutron fields at the PFP facility were measured using a variety of instruments, including a multisphere spectrometer, tissue equivalent proportional counters, and specially calibrated rem meters. Various algorithms were used to evaluate the TLD-albedo dosimeters, and the results are given in this report. Using current algorithms, the dose equivalents evaluated for bare sources and sources with less than 2.5 cm (1 in.) of acrylic plastic shielding in high scatter conditions typical of glove box operations are reasonably accurate. Recently developed CR-39 track etch dosimeters (TEDs) were also exposed in the calibration laboratory and at the PFP. The results indicate that the TED dosimeters are quite accurate for both bare and moderated neutron sources. Until personnel dosimeter is available that incorporates a direct measure of the neutron dose to a person, technical uncertainties in the accuracy of the recorded data will continue.
Sessile serrated adenoma (SSA) vs. traditional serrated adenoma (TSA).
Torlakovic, Emina Emilia; Gomez, Jose D; Driman, David K; Parfitt, Jeremy R; Wang, Chang; Benerjee, Tama; Snover, Dale C
2008-01-01
The morphologic distinction between various serrated polyps of the colorectum may be challenging. The distinction between sessile serrated adenoma (SSA) and traditional serrated adenoma (TSA) may be difficult using currently available criteria mostly based on cytologic characteristics. We have evaluated 66 serrated polyps including 29 SSA, 18 TSA, and 19 hyperplastic polyps for overall shape of the polyps, architectural features of individual crypts, the presence of eosinophilic cytoplasm, size and distribution of the proliferation and maturation zones, as well as Ki-67 and CK20 expression. The extent of the expression of CK20 and Ki-67 could not distinguish between the 3 types of serrated polyps, but the distribution of their expression was very helpful and differences were statistically significant. The distribution of Ki-67+ cells was the single most helpful distinguishing feature of the serrated polyp type (PTSA had low Ki-67 expression, which was limited to "ectopic crypts" and admixed tubular adenomalike areas. In serrated polyps, ectopic crypt formation (ECF) defined by the presence of ectopic crypts with their bases not seated adjacent to the muscularis mucosae was nearly exclusive to TSA and was found in all cases, while the presence of cytologic atypia and eosinophilia of the cytoplasm were characteristic, but not limited to TSA. No evidence of ECF, but nevertheless abnormal distribution of proliferation zone was characteristic of SSA, whereas HP had neither. The presence of the ECF defines TSA in a more rigorous fashion than previous diagnostic criteria and also explains the biologic basis of exuberant protuberant growth associated with TSA and the lack of such growth in SSA. Recognition of this phenomenon may also help in exploring the genetic and molecular basis for differences between SSA and TSA, because these architectural abnormalities may well be a reflection of abnormalities in genetically programmed mucosal development.
Directory of Open Access Journals (Sweden)
A. Farahat
2016-11-01
Full Text Available In this paper particle categorization and absorption properties were discussed to understand transport mechanisms at different geographic locations and possible radiative impacts on climate. The long-term Aerosol Robotic Network (AERONET data set (1999–2015 is used to estimate aerosol optical depth (AOD, single scattering albedo (SSA, and the absorption Ångström exponent (αabs at eight locations in North Africa and the Middle East. Average variation in SSA is calculated at four wavelengths (440, 675, 870, and 1020 nm, and the relationship between aerosol absorption and physical properties is used to infer dominant aerosol types at different locations. It was found that seasonality and geographic location play a major role in identifying dominant aerosol types at each location. Analyzing aerosol characteristics among different sites using AERONET Version 2, Level 2.0 data retrievals and the Hybrid Single Particle Lagrangian Integrated Trajectory model (HYSPLIT backward trajectories shows possible aerosol particle transport among different locations indicating the importance of understanding transport mechanisms in identifying aerosol sources.
Spatio-temporal Variability of Albedo and its Impact on Glacier Melt Modelling
Kinnard, C.; Mendoza, C.; Abermann, J.; Petlicki, M.; MacDonell, S.; Urrutia, R.
2017-12-01
Albedo is an important variable for the surface energy balance of glaciers, yet its representation within distributed glacier mass-balance models is often greatly simplified. Here we study the spatio-temporal evolution of albedo on Glacier Universidad, central Chile (34°S, 70°W), using time-lapse terrestrial photography, and investigate its effect on the shortwave radiation balance and modelled melt rates. A 12 megapixel digital single-lens reflex camera was setup overlooking the glacier and programmed to take three daily images of the glacier during a two-year period (2012-2014). One image was chosen for each day with no cloud shading on the glacier. The RAW images were projected onto a 10m resolution digital elevation model (DEM), using the IMGRAFT software (Messerli and Grinsted, 2015). A six-parameter camera model was calibrated using a single image and a set of 17 ground control points (GCPs), yielding a georeferencing accuracy of accounting for possible camera movement over time. The reflectance values from the projected image were corrected for topographic and atmospheric influences using a parametric solar irradiation model, following a modified algorithm based on Corripio (2004), and then converted to albedo using reference albedo measurements from an on-glacier automatic weather station (AWS). The image-based albedo was found to compare well with independent albedo observations from a second AWS in the glacier accumulation area. Analysis of the albedo maps showed that the albedo is more spatially-variable than the incoming solar radiation, making albedo a more important factor of energy balance spatial variability. The incorporation of albedo maps within an enhanced temperature index melt model revealed that the spatio-temporal variability of albedo is an important factor for the calculation of glacier-wide meltwater fluxes.
Using BRDFs for accurate albedo calculations and adjacency effect corrections
Energy Technology Data Exchange (ETDEWEB)
Borel, C.C.; Gerstl, S.A.W.
1996-09-01
In this paper the authors discuss two uses of BRDFs in remote sensing: (1) in determining the clear sky top of the atmosphere (TOA) albedo, (2) in quantifying the effect of the BRDF on the adjacency point-spread function and on atmospheric corrections. The TOA spectral albedo is an important parameter retrieved by the Multi-angle Imaging Spectro-Radiometer (MISR). Its accuracy depends mainly on how well one can model the surface BRDF for many different situations. The authors present results from an algorithm which matches several semi-empirical functions to the nine MISR measured BRFs that are then numerically integrated to yield the clear sky TOA spectral albedo in four spectral channels. They show that absolute accuracies in the albedo of better than 1% are possible for the visible and better than 2% in the near infrared channels. Using a simplified extensive radiosity model, the authors show that the shape of the adjacency point-spread function (PSF) depends on the underlying surface BRDFs. The adjacency point-spread function at a given offset (x,y) from the center pixel is given by the integral of transmission-weighted products of BRDF and scattering phase function along the line of sight.
Kim, M.; Kim, J.; Jeong, U.; Kim, W.; Hong, H.; Holben, B.; Eck, T. F.; Lim, J.; Song, C.; Lee, S.;
2016-01-01
An aerosol model optimized for northeast Asia is updated with the inversion data from the Distributed Regional Aerosol Gridded Observation Networks (DRAGON)-northeast (NE) Asia campaign which was conducted during spring from March to May 2012. This updated aerosol model was then applied to a single visible channel algorithm to retrieve aerosol optical depth (AOD) from a Meteorological Imager (MI) on-board the geostationary meteorological satellite, Communication, Ocean, and Meteorological Satellite (COMS). This model plays an important role in retrieving accurate AOD from a single visible channel measurement. For the single-channel retrieval, sensitivity tests showed that perturbations by 4 % (0.926 +/- 0.04) in the assumed single scattering albedo (SSA) can result in the retrieval error in AOD by over 20 %. Since the measured reflectance at the top of the atmosphere depends on both AOD and SSA, the overestimation of assumed SSA in the aerosol model leads to an underestimation of AOD. Based on the AErosol RObotic NETwork (AERONET) inversion data sets obtained over East Asia before 2011, seasonally analyzed aerosol optical properties (AOPs) were categorized by SSAs at 675 nm of 0.92 +/- 0.035 for spring (March, April, and May). After the DRAGON-NE Asia campaign in 2012, the SSA during spring showed a slight increase to 0.93 +/- 0.035. In terms of the volume size distribution, the mode radius of coarse particles was increased from 2.08 +/- 0.40 to 2.14 +/- 0.40. While the original aerosol model consists of volume size distribution and refractive indices obtained before 2011, the new model is constructed by using a total data set after the DRAGON-NE Asia campaign. The large volume of data in high spatial resolution from this intensive campaign can be used to improve the representative aerosol model for East Asia. Accordingly, the new AOD data sets retrieved from a single-channel algorithm, which uses a precalculated look-up table (LUT) with the new aerosol model, show
IAU nomenclature for albedo features on the planet Mercury
Dollfus, A.; Chapman, C. R.; Davies, M. E.; Gingerich, O.; Goldstein, R.; Guest, J.; Morrison, D.; Smith, B. A.
1978-01-01
The International Astronomical Union has endorsed a nomenclature for the albedo features on Mercury. Designations are based upon the mythological names related to the god Hermes; they are expressed in Latin form. The dark-hued albedo features are associated with the generic term Solitudo. The light-hued areas are designated by a single name without generic term. The 32 names adopted are allocated on the Mercury map.
2012-06-29
... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0002] Privacy Act of 1974, as Amended...
Directory of Open Access Journals (Sweden)
Hyunkee Hong
2017-02-01
Full Text Available We investigate the simultaneous effects of aerosol peak height (APH, aerosol properties, measurement geometry, and other factors on the air mass factor for NO2 retrieval at sites with high NO2 concentration. A comparison of the effects of high and low surface reflectance reveals that NO2 air mass factor (AMF values over a snowy surface (surface reflectance 0.8 are generally higher than those over a deciduous forest surface (surface reflectance 0.05. Under high aerosol optical depth (AOD conditions, the aerosol shielding effect over a high-albedo surface is revealed to reduce the path-length of light at the surface, whereas high single scattering albedo (SSA conditions (e.g., SSA = 0.95 lead to an increase in the aerosol albedo effect, which results in an increased AMF over areas with low surface reflectance. We also conducted an in-depth study of the APH effect on AMF. For an AOD of 0.1 and half width (HW of 5 km, NO2 AMF decreases by 29% from 1.36 to 0.96 as APH changes from 0 to 2 km. In the case of high-AOD conditions (0.9 and HW of 5 km, the NO2 AMF decreases by 240% from 1.85 to 0.54 as APH changes from 0 to 2 km. The AMF variation due to error in the model input parameters (e.g., AOD, SSA, aerosol shape, and APH is also examined. When APH is 0 km with an AOD of 0.4, SSA of 0.88, and surface reflectance of 0.05, a 30% error in AOD induces an AMF error of between 4.85% and −3.67%, an SSA error of 0.04 leads to NO2 VCD errors of between 4.46% and −4.77%, and a 30% error in AOD induces an AMF error of between −9.53% and 8.35% with an APH of 3 km. In addition to AOD and SSA, APH is an important factor in calculating AMF, due to the 2 km error in APH under high-SZA conditions, which leads to an NO2 VCD error of over 60%. Aerosol shape is also found to have a measureable effect on AMF under high-AOD and small relative azimuth angle (RAA conditions. The diurnal effect of the NO2 profile is also examined and discussed.
Mazzoleni, C.; Dubey, M.; Chakrabarty, R.; Moosmuller, H.; Onasch, T.; Zavala, M.; Herndon, S.; Kolb, C.
2007-12-01
Aerosol optical properties affect planetary radiative balance and depend on chemical composition, size distribution, and morphology. During the MILAGRO field campaign, we measured aerosol absorption and scattering in Mexico City using the Los Alamos aerosol photoacoustic (LAPA) instrument operating at 781 nm. The LAPA was mounted on-board the Aerodyne Research Inc. mobile laboratory, which hosted a variety of gaseous and aerosol instruments. During the campaign, the laboratory was moved to different sites, capturing spatial and temporal variability. Additionally, we collected ambient aerosols on Nuclepore filters for scanning electron microscopy (SEM) analysis. SEM images of selected filters were taken to study particle morphology. Between March 7th and 19th air was sampled at the top of Pico Tres Padres, a mountain on the north side of Mexico City. Aerosol absorption and scattering followed diurnal patterns related to boundary layer height and solar insulation. We report an analysis of aerosol absorption, scattering, and morphology for three days (9th, 11th and 12th of March 2006). The single scattering albedo (SSA, ratio of scattering to total extinction) showed a drop in the tens-of-minutes-to-hour time frame after the boundary layer grew above the sampling site. Later in the day the SSA rose steadily reaching a maximum in the afternoon. The SEM images showed a variety of aerosol shapes including fractal-like aggregates, spherical particles, and other shapes. The absorption correlated with the CO2 signal and qualitatively with the fraction of fractal-like particles to the total particle count. In the afternoon the SSA qualitatively correlated with a relative increase in spherical particles and total particle count. These observed changes in optical properties and morphology can be explained by the dominant contribution of freshly emitted particles in the morning and by secondary particle formation in the afternoon. SSA hourly averaged values ranged from ~0.63 in
Long-term measurements of aerosol optical parameters in Athens, Greece
Paraskevopoulou, Despoina; Liakakou, Eleni; Gerasopoulos, Evangelos; Mihalopoulos, Nikolaos
2015-04-01
Aerosol chemical composition was studied in conjunction with its optical properties in the area of Athens Greece. For this purpose, sampling of fine aerosol fraction (PM2,5) took place on a daily basis from August 2010 to April 2013 at an urban background location. The samples are subsequently analyzed for their content in organic (OC) and elemental carbon (EC), major ions and trace metals, resulting in the exercise of chemical mass closure. In parallel, the optical properties of aerosols are recorded using a nephelometer and a particle soot absorption photometer (PSAP), leading to the calculation of scattering (σscat) and absorption (σabs) coefficients, respectively; while single scattering albedo (SSA) and mass scattering and absorption efficiencies are thereinafter calculated. Daily σscat values provide an average of 30.1±3.9 Μm-1 while, the average of σabs is 5.2±1.4 Μm-1. The seasonal cycle of σscat presents maximum during summer and in November, due to long-range transport of aerosol from continental Europe and dust transfer from Africa, respectively. The estimated mass absorption efficiency of EC is estimated to be 8.3±0.2 m2 g-1 for the whole studied period, while the corresponding estimated mass scattering efficiency of PM2.5 is 1.7±0.1 m2 g-1 and does not affected by the presence of dust. The average SSA equals to 0.87±0.11 for the three-year period. On a seasonal basis, SSA presents maximum values during summer that is consistent with the reduction of EC - the main absorbing specie. Finally, the reconstruction of scattering coefficients was performed taking into consideration the measured chemistry of fine aerosol.
Emittance of a finite scattering medium with refractive index greater than unity
International Nuclear Information System (INIS)
Crosbie, A.L.
1980-01-01
Refractive index and scattering can significantly influence the transfer of radiation in a semitransparent medium such as water, glass, plastics, or ceramics. In a recent article (1979), the author presented exact numerical results for the emittance of a semiinfinite scattering medium with a refractive index greater than unity. The present investigation extends the analysis to a finite medium. The physical situation consists of a finite planar layer. The isothermal layer emits, absorbs, and isotropically scatters thermal radiation. It is characterized by single scattering albedo, optical thickness, refractive index, and temperature. A formula for the directional emittance is derived, the directional emittance being the emittance of the medium multiplied by the interface transmittance. The ratio of hemispherical to normal emittance is tabulated and discussed
Calculating the albedo characteristics by the method of transmission probabilities
International Nuclear Information System (INIS)
Lukhvich, A.A.; Rakhno, I.L.; Rubin, I.E.
1983-01-01
The possibility to use the method of transmission probabilities for calculating the albedo characteristics of homogeneous and heterogeneous zones is studied. The transmission probabilities method is a numerical method for solving the transport equation in the integrated form. All calculations have been conducted as a one-group approximation for the planes and rods with different optical thicknesses and capture-to-scattering ratios. Above calculations for plane and cylindrical geometries have shown the possibility to use the numerical method of transmission probabilities for calculating the albedo characteristics of homogeneous and heterogeneous zones with high accuracy. In this case the computer time consumptions are minimum even with the cylindrical geometry, if the interpolation calculation of characteristics is used for the neutrons of the first path
Paredes-Miranda, G.; Arnott, W. P.; Gaffney, J. S.; Marley, N. A.; Campbell, D.; Fujita, E.
2007-12-01
Aerosol light scattering and absorption measurements were deployed in and near Mexico City in March 2006 as part of the Megacity Impacts on Regional and Global Environments (MIRAGE). The primary site in Mexico City was an urban site at Instituto Mexicano del Petroleo (Mexican Oil Institute, denoted by IMP). Similar campaigns were held in Las Vegas, NV in January-February, 2003; and Los Angeles, CA at numerous sites during all seasons from 2003 through 2007. The IMP site gave in-situ characterization of the Mexico City plume under favorable wind conditions. The photoacoustic instrument (PAS) used at IMP operates at 532 nm, and conveniently allowed for characterization of gaseous absorption at this wavelength as well. Light scattering measurements are accomplished within the PAS by the reciprocal nephelometery method. In Mexico City the aerosol absorption coefficient typically varies between 20 and 180 Mm-1 during the course of the day and significant diurnal variation of the aerosol single scattering albedo was observed probably as a consequence of secondary aerosol formation. We will present the diurnal variation of the scattering and absorption as well as the single scattering albedo and fraction of absorption due to gases at the IMP site and compare with Las Vegas diurnal variation. Mexico City 'breaths' more during the course of the day than Las Vegas, Nevada in part because the latitude of Mexico City resulted in more direct solar radiation. Further insight on the meteorological connections and population dynamics will be discussed.
Social Security Administration — The dataset includes fiscal year data for initial claims for SSA disability benefits that were referred to a state agency for a disability determination. Specific...
Modifying infrared scattering effects of single yeast cells with plasmonic metal mesh
Malone, Marvin A.; Prakash, Suraj; Heer, Joseph M.; Corwin, Lloyd D.; Cilwa, Katherine E.; Coe, James V.
2010-11-01
The scattering effects in the infrared (IR) spectra of single, isolated bread yeast cells (Saccharomyces cerevisiae) on a ZnSe substrate and in metal microchannels have been probed by Fourier transform infrared imaging microspectroscopy. Absolute extinction [(3.4±0.6)×10-7 cm2 at 3178 cm-1], scattering, and absorption cross sections for a single yeast cell and a vibrational absorption spectrum have been determined by comparing it to the scattering properties of single, isolated, latex microspheres (polystyrene, 5.0 μm in diameter) on ZnSe, which are well modeled by the Mie scattering theory. Single yeast cells were then placed into the holes of the IR plasmonic mesh, i.e., metal films with arrays of subwavelength holes, yielding "scatter-free" IR absorption spectra, which have undistorted vibrational lineshapes and a rising generic IR absorption baseline. Absolute extinction, scattering, and absorption spectral profiles were determined for a single, ellipsoidal yeast cell to characterize the interplay of these effects.
Directory of Open Access Journals (Sweden)
M. Kim
2016-02-01
Full Text Available An aerosol model optimized for northeast Asia is updated with the inversion data from the Distributed Regional Aerosol Gridded Observation Networks (DRAGON-northeast (NE Asia campaign which was conducted during spring from March to May 2012. This updated aerosol model was then applied to a single visible channel algorithm to retrieve aerosol optical depth (AOD from a Meteorological Imager (MI on-board the geostationary meteorological satellite, Communication, Ocean, and Meteorological Satellite (COMS. This model plays an important role in retrieving accurate AOD from a single visible channel measurement. For the single-channel retrieval, sensitivity tests showed that perturbations by 4 % (0.926 ± 0.04 in the assumed single scattering albedo (SSA can result in the retrieval error in AOD by over 20 %. Since the measured reflectance at the top of the atmosphere depends on both AOD and SSA, the overestimation of assumed SSA in the aerosol model leads to an underestimation of AOD. Based on the AErosol RObotic NETwork (AERONET inversion data sets obtained over East Asia before 2011, seasonally analyzed aerosol optical properties (AOPs were categorized by SSAs at 675 nm of 0.92 ± 0.035 for spring (March, April, and May. After the DRAGON-NE Asia campaign in 2012, the SSA during spring showed a slight increase to 0.93 ± 0.035. In terms of the volume size distribution, the mode radius of coarse particles was increased from 2.08 ± 0.40 to 2.14 ± 0.40. While the original aerosol model consists of volume size distribution and refractive indices obtained before 2011, the new model is constructed by using a total data set after the DRAGON-NE Asia campaign. The large volume of data in high spatial resolution from this intensive campaign can be used to improve the representative aerosol model for East Asia. Accordingly, the new AOD data sets retrieved from a single-channel algorithm, which uses a precalculated look-up table (LUT with the new aerosol model
Spectral Dependence of the Scattering Coefficient in Case 1 and Case 2 Waters
Gould, Richard W., Jr.; Arnone, Robert A.; Martinolich, Paul M.
1999-04-01
An approximate linear relationship between the scattering coefficient and the wavelength of light in the visible is found in case 1 and case 2 waters. From this relationship, we estimate scattering at an unknown wavelength from scattering at a single measured wavelength. This approximation is based on measurements in a 1.5-m-thick surface layer collected with an AC9 instrument at 63 stations in the Arabian Sea, northern Gulf of Mexico, and coastal North Carolina. The light-scattering coefficient at 412 nm ranged from 0.2 to 15.1 m 1 in these waters, and the absorption coefficient at 412 nm ranged from 0.2 to 4.0 m 1 . A separate data set for 100 stations from Oceanside, California, and Chesapeake Bay, Virginia, was used to validate the relationship. Although the Oceanside waters were considerably different from the developmental data set (based on absorption-to-scattering ratios and single-scattering albedos), the average error between modeled and measured scattering values was 6.0% for the entire test data set over all wavelengths (without regard to sign). The slope of the spectral scattering relationship decreases progressively from high-scattering, turbid waters dominated by suspended sediments to lower-scattering, clear waters dominated by phytoplankton.
The Aesthetical quality of SSA-containing mortar and concrete
DEFF Research Database (Denmark)
Kappel, Annemette; Kirkelund, Gunvor Marie; Ottosen, Lisbeth M.
2014-01-01
that gives a characteristic red colour. The process of grinding SSA has shown to improve the compressive strength of SSA- containing mortar (Donatello et al. 2010). Thus, in this study SSA was grinded in 6 different intervals ranging from 0 – 10 min, and then added to the mortar mix replacing 20% of cement....... The experiment revealed that the colour of the SSA-containing mortar intensified as the time interval of the grinding process increased. Each of the 6 steps within the time interval provided an additional colour tone and generated a colour scale consisting of mortar samples ranging from greyish to a more...
Observations of Surfzone Albedo
Sinnett, G.; Feddersen, F.
2014-12-01
The surfzone environment (where waves break) contains several unique and previously unconsidered processes that affect the heat budget. Entering short-wave radiation is a dominant term in both shelf and surfzone heat budgets. In contrast to the shelf, however, depth limited wave breaking in the surfzone generates spray, whitewater and suspended sediments, elevating the surface albedo (ratio of reflected to incident short-wave radiation). Elevated albedo reduces the level of solar short-wave radiation entering the water, potentially resulting in less heating. Additionally, surfzone water quality is often impacted by fecal bacteria contamination. As bacteria mortality is related to short-wave solar radiation, elevated surfzone albedo could reduce pathogen mortality, impacting human health. Albedo in the open ocean has been frequently studied and parameterizations often consider solar zenith angle, wind speed and ocean chlorophyll concentration, producing albedo values typically near 0.06. However, surfzone albedo observations have been extremely sparse, yet show depth limited wave breaking may increase the albedo by nearly a factor of 10 up to 0.5. Here, we present findings from a field study at the Scripps Institution of Oceanography pier to observe the affect of waves on surfzone albedo. Concurrent measurements were taken with a four-way radiometer (to measure both downwelling and upwelling short-wave and long wave radiation) mounted above the surfzone. A co-located GoPro camera was used to relate visual aspects of the surfzone to measured reflectance, and wave height and period were observed with a bottom mounted pressure sensor in 5 m water depth just outside the surfzone. Wind speed and direction were observed on the pier 10 m above the water surface. Here, we will examine the surfzone albedo dependence on surfzone parameters, such as wave height.
Neutron Transport in Finite Random Media with Pure-Triplet Scattering
International Nuclear Information System (INIS)
Sallaha, M.; Hendi, A.A.
2008-01-01
The solution of the one-speed neutron transport equation in a finite slab random medium with pure-triplet anisotropic scattering is studied. The stochastic medium is assumed to consist of two randomly mixed immiscible fluids. The cross section and the scattering kernel are treated as discrete random variables, which obey the same statistics as Markovian processes and exponential chord length statistics. The medium boundaries are considered to have specular reflectivities with angular-dependent externally incident flux. The deterministic solution is obtained by using Pomraning-Eddington approximation. Numerical results are calculated for the average reflectivity and average transmissivity for different values of the single scattering albedo and varying the parameters which characterize the random medium. Compared to the results obtained by Adams et al. in case of isotropic scattering that based on the Monte Carlo technique, it can be seen that we have good comparable data
Brazilian two-component TLD albedo neutron individual monitoring system
Energy Technology Data Exchange (ETDEWEB)
Martins, M.M., E-mail: marcelo@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD), Av. Salvador Allende, s/n, CEP: 22780-160, Rio de Janeiro, RJ (Brazil); Mauricio, C.L.P., E-mail: claudia@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD), Av. Salvador Allende, s/n, CEP: 22780-160, Rio de Janeiro, RJ (Brazil); Fonseca, E.S. da, E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD), Av. Salvador Allende, s/n, CEP: 22780-160, Rio de Janeiro, RJ (Brazil); Silva, A.X. da, E-mail: ademir@con.ufrj.b [Coordenacao dos Programas de Pos-Graduacao em Engenharia, COPPE/PEN Caixa Postal 68509, CEP: 21941-972, Rio de Janeiro, RJ (Brazil)
2010-12-15
Since 1983, Instituto de Radioprotecao e Dosimetria, Brazil, uses a TLD one-component albedo neutron monitor, which has a single different calibration factor specifically for each installation type. In order to improve its energy response, a two-component albedo monitor was developed, which measure the thermal neutron component besides the albedo one. The two-component monitor has been calibrated in reference neutron fields: thermal, five accelerator-produced monoenergetic beams (70, 144, 565, 1200 and 5000 keV) and five radionuclide sources ({sup 252}Cf, {sup 252}Cf(D{sub 2}O), {sup 241}Am-Be, {sup 241}Am-B and {sup 238}Pu-Be) at several distances. Since January 2008, mainly Brazilian workers who handle neutron sources at different distances and moderation, such as in well logging and calibration facilities are using it routinely.
Several numerical and analytical solutions of the radiative transfer equation (RTE) for plane albedo were compared for solar light reflection by sea water. The study incorporated the simplest case, that being a semi-infinite one-dimensional plane-parallel absorbing and scattering...
Single particle analysis with a 3600 light scattering photometer
International Nuclear Information System (INIS)
Bartholdi, M.F.
1979-06-01
Light scattering by single spherical homogeneous particles in the diameter range 1 to 20 μm and relative refractive index 1.20 is measured. Particle size of narrowly dispersed populations is determined and a multi-modal dispersion of five components is completely analyzed. A 360 0 light scattering photometer for analysis of single particles has been designed and developed. A fluid stream containing single particles intersects a focused laser beam at the primary focal point of an ellipsoidal reflector ring. The light scattered at angles theta = 2.5 0 to 177.5 0 at phi = 0 0 and 180 0 is reflected onto a circular array of photodiodes. The ellipsoidal reflector is situated in a chamber filled with fluid matching that of the stream to minimize refracting and reflecting interfaces. The detector array consists of 60 photodiodes each subtending 3 0 in scattering angle on 6 0 centers around 360 0 . 32 measurements on individual particles can be acquired at rates of 500 particles per second. The intensity and angular distribution of light scattered by spherical particles are indicative of size and relative refractive index. Calculations, using Lorenz--Mie theory, of differential scattering patterns integrated over angle corresponding to the detector geometry determined the instrument response to particle size. From this the expected resolution and experimental procedures are determined.Ultimately, the photometer will be utilized for identification and discrimination of biological cells based on the sensitivity of light scattering to size, shape, refractive index differences, internal granularity, and other internal morphology. This study has demonstrated the utility of the photometer and indicates potential for application to light scattering studies of biological cells
The Lauricella functions and exact string scattering amplitudes
International Nuclear Information System (INIS)
Lai, Sheng-Hong; Lee, Jen-Chi; Yang, Yi
2016-01-01
We discover that the 26D open bosonic string scattering amplitudes (SSA) of three tachyons and one arbitrary string state can be expressed in terms of the D-type Lauricella functions with associated SL(K+3,ℂ) symmetry. As a result, SSA and symmetries or relations among SSA of different string states at various limits calculated previously can be rederived. These include the linear relations first conjectured by Gross http://dx.doi.org/10.1016/0370-2693(87)90355-8; http://dx.doi.org/10.1016/0550-3213(88)90390-2; http://dx.doi.org/10.1103/PhysRevLett.60.1229D.J. Gross and J.R. Ellis, Strings at superplanckian energies: in search of the string symmetry, Phil. Trans. Roy. Soc. Lond. A 329 (1989) 401. http://dx.doi.org/10.1016/0550-3213(89)90435-5 and later corrected and proved in http://dx.doi.org/10.1016/j.physletb.2005.02.034; http://arxiv.org/abs/hep-th/0303012; http://dx.doi.org/10.1016/j.nuclphysb.2004.04.022; http://dx.doi.org/10.1016/j.nuclphysb.2004.11.032; http://dx.doi.org/10.1103/PhysRevLett.96.171601; http://dx.doi.org/10.1016/j.nuclphysb.2005.07.018; http://dx.doi.org/10.1016/j.nuclphysb.2005.12.025 in the hard scattering limit, the recurrence relations in the Regge scattering limit with associated SL(5,ℂ) symmetry http://dx.doi.org/10.1088/1126-6708/2009/06/028; http://dx.doi.org/10.1007/JHEP04(2013)082; http://dx.doi.org/10.1016/j.physletb.2014.11.017 and the extended recurrence relations in the nonrelativistic scattering limit with associated SL(4,ℂ) symmetry http://dx.doi.org/10.1007/JHEP05(2016)186 discovered recently. Finally, as an application, we calculate a new recurrence relation of SSA which is valid for all energies.
Kecorius, Simonas; Ma, Nan; Teich, Monique; van Pinxteren, Dominik; Zhang, Shenglan; Gröβ, Johannes; Spindler, Gerald; Müller, Konrad; Iinuma, Yoshiteru; Hu, Min; Herrmann, Hartmut; Wiedensohler, Alfred
2017-09-01
Particulate emissions from crop residue burning decrease the air quality as well as influence aerosol radiative properties on a regional scale. The North China Plain (NCP) is known for the large scale biomass burning (BB) of field residues, which often results in heavy haze pollution episodes across the region. We have been able to capture a unique BB episode during the international CAREBeijing-NCP intensive field campaign in Wangdu in the NCP (38.6°N, 115.2°E) from June to July 2014. It was found that aerosol particles originating from this BB event showed a significantly different mixing state compared with clean and non-BB pollution episodes. BB originated particles showed a narrower probability density function (PDF) of shrink factor (SF). And the maximum was found at shrink factor of 0.6, which is higher than in other episodes. The non-volatile particle number fraction during the BB episode decreased to 3% and was the lowest measured value compared to all other predefined episodes. To evaluate the influence of particle mixing state on aerosol single scattering albedo (SSA), SSA at different RHs was simulated using the measured aerosol physical-chemical properties. The differences between the calculated SSA for biomass burning, clean and pollution episodes are significant, meaning that the variation of SSA in different pollution conditions needs to be considered in the evaluation of aerosol direct radiative effects in the NCP. And the calculated SSA was found to be quite sensitive on the mixing state of BC, especially at low-RH condition. The simulated SSA was also compared with the measured values. For all the three predefined episodes, the measured SSA are very close to the calculated ones with assumed mixing states of homogeneously internal and core-shell internal mixing, indicating that both of the conception models are appropriate for the calculation of ambient SSA in the NCP.
Measuring the influence of aerosols and albedo on sky polarization.
Kreuter, A; Emde, C; Blumthaler, M
2010-11-01
All-sky distributions of the polarized radiance are measured using an automated fish-eye camera system with a rotating polarizer. For a large range of aerosol and surface albedo situations, the influence on the degree of polarization and sky radiance is investigated. The range of aerosol optical depth and albedo is 0.05-0.5 and 0.1-0.75, respectively. For this range of parameters, a reduction of the degree of polarization from about 0.7 to 0.4 was observed. The analysis is done for 90° scattering angle in the principal plane under clear sky conditions for a broadband channel of 450 ± 25 nm and solar zenith angles between 55° and 60°. Radiative transfer calculations considering three different aerosol mixtures are performed and and agree with the measurements within the statistical error.
Energy Technology Data Exchange (ETDEWEB)
Markovic, S; Pavlovic, R [Inst. of Nuclear Science Vinca, Belgrade (Yugoslavia). Radiation and Environmental Protection Lab.; Boreli, F [Fac. of Electrical Engineering, Belgrade (Yugoslavia)
1996-12-31
In realization of radiation protection measures for medical staff present during diagnostic procedures, the necessary condition is knowledge of the space - energy distributions of the scattered radiation from the patient. In this paper, the simple calculation procedure for the scattered radiation field of the actual diagnostic energies is presented. Starting from the single Compton scattering model and using the justified transformations the final equations in elementary form are derived. For numerical calculations the computer code ANGIO was created. The calculated results were confirmed by detailed dosimetric measurements of the scattered field around patient (the water phantom) in SSDL in the Institute of nuclear sciences `Vinca`, Belgrade. These results are good base for assessment of irradiation. The main irradiation source for the physician and the other members of the medical team is the back scattered radiation from patient - albedo. (author). 3 figs., 3 refs.
Directory of Open Access Journals (Sweden)
R. Fierz-Schmidhauser
2010-03-01
Full Text Available Ambient relative humidity (RH determines the water content of atmospheric aerosol particles and thus has an important influence on the amount of visible light scattered by particles. The RH dependence of the particle light scattering coefficient (σsp is therefore an important variable for climate forcing calculations. We used a humidification system for a nephelometer which allows for the measurement of σsp at a defined RH in the range of 20–95%. In this paper we present measurements of light scattering enhancement factors f(RH=σsp(RH/σsp(dry from a 1-month campaign (May 2008 at the high alpine site Jungfraujoch (3580 m a.s.l., Switzerland. Measurements at the Jungfraujoch are representative for the lower free troposphere above Central Europe. For this aerosol type hardly any information about the f(RH is available so far. At this site, f(RH=85% varied between 1.2 and 3.3. Measured f(RH agreed well with f(RH calculated with Mie theory using measurements of the size distribution, chemical composition and hygroscopic diameter growth factors as input. Good f(RH predictions at RH<85% were also obtained with a simplified model, which uses the Ångström exponent of σsp(dry as input. RH influences further intensive optical aerosol properties. The backscatter fraction decreased by about 30% from 0.128 to 0.089, and the single scattering albedo increased on average by 0.05 at 85% RH compared to dry conditions. These changes in σsp, backscatter fraction and single scattering albedo have a distinct impact on the radiative forcing of the Jungfraujoch aerosol.
Calculation of double energy angle differential neutron albedos for radiation shielding applications
International Nuclear Information System (INIS)
Litaize, O.; Diop, C.M.; Nimal, J.C.
2000-01-01
Void radiation shielding problems can be dealt with albedo concept which is an alternative to the complex bringing into operation of the 'exact' transport method calculations (SN, Monte Carlo). Up to here, differential albedos are used for single reflections from walls in the NARCISSE-3 propagation albedo code developed at CEA and used for project calculations. For taking into account the neutron multiple reflections on lacunar medium walls, double energy-angle differential albedos are needed. TRIPOLI-4 neutral particle transport Monte Carlo code in three dimensional geometries, has been chosen to implement a double differential albedo calculus routine and therefore to generate albedo data for different kinds of medium. The surfacic estimator, which could be used, is not enough efficient because all neutrons do not contribute to the result. A new estimator is carried out. At each collision site, during the neutron history simulation, it allows to compute the probability of the neutron to go through the medium and to come through the reflection surface in the direction and at the energy considered. This estimator is about hundred times more efficient than the surfacic estimator. (author)
Energy Technology Data Exchange (ETDEWEB)
Onasch, Timothy B [Aerodyne Research, Inc.; Sedlacek, Arthur J [Brookhaven National Lab. (BNL), Upton, NY (United States)
2017-03-15
The scientific focus of this study was to investigate and quantify the mass loadings, chemical compositions, and optical properties of biomass burning particulate emissions generated in the laboratory from Western U.S. fuels using a similar instrument suite to the one deployed on the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility Gulfstream-1 (G-1) aircraft during the 2013 Biomass Burning Observation Project (BBOP) field study (Kleinman and Sedlacek, 2013). We deployed the single-particle soot photometer (SP2) to make measurements of biomass burning refractory black carbon (rBC) mass loadings and size distributions to correlate with non-refractory particulate matter (NR-PM; i.e., HR-AMS) and rBC (SP-AMS) measurements as a function of photo-oxidation processes in an environmental chamber. With these measurements, we will address the following scientific questions: 1. What are the emission indices (g/kg fuel) of rBC from various wildland fuels from the Pacific Northwest (i.e., relevant to BBOP analysis) as a function of combustion conditions and simulated atmospheric processing in an environmental chamber? 2. What are the optical properties (e.g., mass-specific absorption cross-section [MAC], single-scattering albedo [SSA], and absorption Angstrom exponent [AAE)] of rBC emitted from various wildland fuels and how are they impacted by atmospheric processing? 3. How does the mixing state of rBC in biomass-burning plumes relate to the optical properties? 4. How does the emitted rBC affect radiative forcing?
Gómez-Amo, J L; Estellés, V; Marcos, C; Segura, S; Esteve, A R; Pedrós, R; Utrillas, M P; Martínez-Lozano, J A
2017-12-01
The most destructive wildfire experienced in Spain since 2004 occurred close to Valencia in summer 2012. A total of 48.500ha were affected by two wildfires, which were mostly active during 29-30 June. The fresh smoke plume was detected at the Burjassot measurement station simultaneously to a severe dust episode. We propose an empirical method to evaluate the dust and smoke mixing and its impact on the microphysical and optical properties. For this, we combine direct-sun measurements with a Cimel CE-318 sun-photometer with an inversion methodology, and the Mie theory to derive the column-integrated size distribution, single scattering albedo (SSA) and asymmetry parameter (g). The mixing of dust and smoke greatly increased the aerosol load and modified the background aerosol properties. Mineral dust increased the aerosol optical depth (AOD) up to 1, while the smoke plume caused an extreme AOD peak of 8. The size distribution of the mixture was bimodal, with a fine and coarse modes dominated by the smoke particles and mineral dust, respectively. The SSA and g for the dust-smoke mixture show a marked sensitivity on the smoke mixing-ratio, mainly at longer wavelengths. Mineral dust and smoke share a similar SSA at 440nm (~0.90), but with opposite spectral dependency. A small dust contribution to the total AOD substantially affects the SSA of the mixture, and also SSA at 1020nm increases from 0.87 to 0.95. This leads to a different spectral behaviour of SSA that changes from positive (smoke plume) to negative (dust), depending on the dust and smoke mixing-ratio. Copyright © 2017 Elsevier B.V. All rights reserved.
Biomass Burning Aerosol Absorption Measurements with MODIS Using the Critical Reflectance Method
Zhu, Li; Martins, Vanderlei J.; Remer, Lorraine A.
2010-01-01
This research uses the critical reflectance technique, a space-based remote sensing method, to measure the spatial distribution of aerosol absorption properties over land. Choosing two regions dominated by biomass burning aerosols, a series of sensitivity studies were undertaken to analyze the potential limitations of this method for the type of aerosol to be encountered in the selected study areas, and to show that the retrieved results are relatively insensitive to uncertainties in the assumptions used in the retrieval of smoke aerosol. The critical reflectance technique is then applied to Moderate Resolution Imaging Spectrometer (MODIS) data to retrieve the spectral aerosol single scattering albedo (SSA) in South African and South American 35 biomass burning events. The retrieved results were validated with collocated Aerosol Robotic Network (AERONET) retrievals. One standard deviation of mean MODIS retrievals match AERONET products to within 0.03, the magnitude of the AERONET uncertainty. The overlap of the two retrievals increases to 88%, allowing for measurement variance in the MODIS retrievals as well. The ensemble average of MODIS-derived SSA for the Amazon forest station is 0.92 at 670 nm, and 0.84-0.89 for the southern African savanna stations. The critical reflectance technique allows evaluation of the spatial variability of SSA, and shows that SSA in South America exhibits higher spatial variation than in South Africa. The accuracy of the retrieved aerosol SSA from MODIS data indicates that this product can help to better understand 44 how aerosols affect the regional and global climate.
The organic fraction of bubble-generated, accumulation mode Sea Spray Aerosol (SSA
Directory of Open Access Journals (Sweden)
R. L. Modini
2010-03-01
Full Text Available Recent studies have detected a dominant accumulation mode (~100 nm in the Sea Spray Aerosol (SSA number distribution. There is evidence to suggest that particles in this mode are composed primarily of organics. To investigate this hypothesis we conducted experiments on NaCl, artificial SSA and natural SSA particles with a Volatility-Hygroscopicity-Tandem-Differential-Mobility-Analyser (VH-TDMA. NaCl particles were atomiser generated and a bubble generator was constructed to produce artificial and natural SSA particles. Natural seawater samples for use in the bubble generator were collected from biologically active, terrestrially-affected coastal water in Moreton Bay, Australia. Differences in the VH-TDMA-measured volatility curves of artificial and natural SSA particles were used to investigate and quantify the organic fraction of natural SSA particles. Hygroscopic Growth Factor (HGF data, also obtained by the VH-TDMA, were used to confirm the conclusions drawn from the volatility data. Both datasets indicated that the organic fraction of our natural SSA particles evaporated in the VH-TDMA over the temperature range 170–200 °C. The organic volume fraction for 71–77 nm natural SSA particles was 8±6%. Organic volume fraction did not vary significantly with varying water residence time (40 s to 24 h in the bubble generator or SSA particle diameter in the range 38–173 nm. At room temperature we measured shape- and Kelvin-corrected HGF at 90% RH of 2.46±0.02 for NaCl, 2.35±0.02 for artifical SSA and 2.26±0.02 for natural SSA particles. Overall, these results suggest that the natural accumulation mode SSA particles produced in these experiments contained only a minor organic fraction, which had little effect on hygroscopic growth. Our measurement of 8±6% is an order of magnitude below two previous measurements of the organic fraction in SSA particles of comparable sizes. We stress that our results were obtained using coastal seawater and
Assessment of 10-Year Global Record of Aerosol Products from the OMI Near-UV Algorithm
Ahn, C.; Torres, O.; Jethva, H. T.
2014-12-01
Global observations of aerosol properties from space are critical for understanding climate change and air quality applications. The Ozone Monitoring Instrument (OMI) onboard the EOS-Aura satellite provides information on aerosol optical properties by making use of the large sensitivity to aerosol absorption and dark surface albedo in the UV spectral region. These unique features enable us to retrieve both aerosol extinction optical depth (AOD) and single scattering albedo (SSA) successfully from radiance measurements at 354 and 388 nm by the OMI near UV aerosol algorithm (OMAERUV). Recent improvements to algorithms in conjunction with the Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) and Atmospheric Infrared Sounder (AIRS) carbon monoxide data also reduce uncertainties due to aerosol layer heights and types significantly in retrieved products. We present validation results of OMI AOD against space and time collocated Aerosol Robotic Network (AERONET) measured AOD values over multiple stations representing major aerosol episodes and regimes. We also compare the OMI SSA against the inversion made by AERONET as well as an independent network of ground-based radiometer called SKYNET in Japan, China, South-East Asia, India, and Europe. The outcome of the evaluation analysis indicates that in spite of the "row anomaly" problem, affecting the sensor since mid-2007, the long-term aerosol record shows remarkable sensor stability. The OMAERUV 10-year global aerosol record is publicly available at the NASA data service center web site (http://disc.sci.gsfc.nasa.gov/Aura/data-holdings/OMI/omaeruv_v003.shtml).
View From a Megacity: Aerosol Light Absorption and Scattering at Four Sites in and Near Mexico City.
Paredes-Miranda, G.; Arnott, W. P.; Gaffney, J. S.; Marley, N. A.
2006-12-01
As part of the Megacity Impacts on Regional and Global Environments, MIRAGE-Mex deployment to Mexico City in the period of 30 days, March 2006, a suite of photoacoustic spectrometers (PAS) were installed to measure at ground level the light absorption and scattering by aerosols at four sites: an urban site at Instituto Mexicano del Petroleo (Mexican Oil Institute, denoted by IMP), a suburban site at the Technological University of Tecamac, a rural site at "La Biznaga" ranch, and a site at the Paseo de Cortes (altitude 3,810 meters ASL) in the rural area above Amecameca in the State of Mexico, on the saddle between the volcanoes Popocatepetl and Iztaccihuatl. The IMP site gave in-situ characterization of the Mexico City plume under favorable wind conditions while the other sites provided characterization of the plume, mixed in with any local sources. The second and third sites are north of Mexico City, and the fourth site is south. The PAS used at IMP operates at 532 nm, and conveniently allowed for characterization of gaseous absorption at this wavelength as well. Instruments at the second and third sites operate at 870 nm, and the one at the fourth site at 780 nm. Light scattering measurements are accomplished within the PAS by the reciprocal nephelometery method. In the urban site the aerosol absorption coefficient typically varies between 40 and 250 Mm-1 during the course of the day and significant diurnal variation of the aerosol single scattering albedo was observed. Comparisons with TSI nephelometer scattering and Aetholemeter absorption measurements at the T0 site will be presented. We will present a broad overview of the diurnal variation of the scattering and absorption as well as the single scattering albedo and fraction of absorption due to gases at the IMP site. Insight on the dynamical connections will be discussed.
Evaluating Options for Civil Space Situational Awareness (SSA)
Lal, B.; Carioscia, S. A.
In recent years, the number of active satellites and human-made orbital space debris has increased dramatically. An expansion of activities in space, as is currently being proposed by many commercial and international entities, is expected to further exacerbate this challenge. The 18th Space Control Squadron under the Department of Defense (DOD) United States Strategic Command provides space situational awareness (SSA) services to users outside the national security community at no cost. International and commercial users demand better SSA service than is currently feasible, and the demand comes at a time when DOD is under pressure to better prepare for and respond to growing space-based threats to national security. Concerned about the possibility of overextending across conflicting missions in a fiscally constrained environment, some DOD officials have publicly noted a desire to move SSA services not related to national security out of DOD purview. Responding to a request from the Federal Aviation Administration (FAA) Office of Commercial Space Transportation (AST), researchers at the Science and Technology Policy Institute (STPI) identified and evaluated potential approaches for providing SSA services for civil and commercial operations in space. In this paper, we summarize the report [1] and present the pros and cons of four approaches to the provision of civil SSA services in the United States: (1) maintaining status quo through continued provision by DOD; (2) provision by a civil government entity; (3) industry self-provision; and (4) provision by an international organization. Within the second approach, assuming the provision of SSA by a civil agency, STPI further identified and discussed four options: (1) civil agency service capability embedded within DOD; (2) independent civil service capability, using DOD software and systems; (3) independent civil service capability, using commercial software and systems; and (4) the government certifies non
Preliminary approach of the MELiSSA loop energy balance
Poulet, Lucie; Lamaze, Brigitte; Lebrun, Jean
Long duration missions, such as the establishment of permanent bases on the lunar surface or the travel to Mars, require a huge amount of life support consumables (e.g. food, water and oxygen). Current rockets are at the moment unable to launch such a mass from Earth. Consequently Regenerative Life Support Systems are necessary to sustain long-term manned space mission to increase recycling rates and so reduce the launched mass. Thus the European and Canadian research has been concentrating on the MELiSSA (Micro-Ecological Life Support System Alternative) project over the last 20 years. MELiSSA is an Environmental Controlled Life Support System (ECLSS), i.e. a closed regenerative loop inspired of a lake ecosystem. Using light as a source of energy, MELiSSA's goal is the recovery of food, water and oxygen from CO2 and organic wastes, using microorganisms and higher plants. The architecture of a ECLSS depends widely on the mission scenario. To compare several ECLSS architectures and in order to be able to evaluate them, ESA is developing a multi criteria evaluation tool: ALISSE (Advanced LIfe Support System Evaluator). One of these criteria is the energy needed to operate the ECLSS. Unlike other criteria like the physical mass, the energy criterion has not been investigated yet and needs hence a detailed analysis. It will consequently be the focus of this study. The main objective of the work presented here is to develop a dynamic tool able to estimate the energy balance for several configurations of the MELiSSA loop. The first step consists in establishing the energy balance using concrete figures from the MELiSSA Pilot Plant (MPP). This facility located at the Universitat Autonoma de Barcelona (UAB) is aimed at the ground demonstration of the MELiSSA loop. The MELiSSA loop is structured on several subsystems; each of them is characterized by supplies, exhausts and process reactions. For the purpose of this study (i.e. a generic tool) the solver EES (Engineering
SAI/EPRI Albedo Information Library
International Nuclear Information System (INIS)
Simmons, G.L.
1979-03-01
The SAI/EPRI Albedo Information Library (SAIL) is described. This description included the techniques used to develop the data and comparisons with albedo data. Albedo data are presented for Type 04 Concrete and Low Carbon Steel, the most common materials encountered in radiation streaming analysis. Applications of the SAIL data are presented and compared with experimental results
Single spin asymmetries in semi-inclusive deep inelastic scattering
International Nuclear Information System (INIS)
Mulders, P.J.
1998-01-01
In this talk I want to illustrate the many possibilities for studying the structure of hadrons in hard scattering processes by giving a number of examples involving increasing complexity in the demands for particle polarization, particle identification or polarimetry. In particular the single spin asymmetries will be discussed. The measurements discussed in this talk are restricted to lepton-hadron scattering, but can be found in various other hard processes such as Drell-Yan scattering or e + e - annihilation. (author)
The Influence of a Sandy Substrate, Seagrass, or Highly Turbid Water on Albedo and Surface Heat Flux
Fogarty, M. C.; Fewings, M. R.; Paget, A. C.; Dierssen, H. M.
2018-01-01
Sea-surface albedo is a combination of surface-reflected and water-leaving irradiance, but water-leaving irradiance typically contributes less than 15% of the total albedo in open-ocean conditions. In coastal systems, however, the bottom substrate or suspended particulate matter can increase the amount of backscattered light, thereby increasing albedo and decreasing net shortwave surface heat flux. Here a sensitivity analysis using observations and models predicts the effect of light scattering on albedo and the net shortwave heat flux for three test cases: a bright sand bottom, a seagrass canopy, and turbid water. After scaling to the full solar shortwave spectrum, daytime average albedo for the test cases is up to 0.20 and exceeds the value of 0.05 predicted using a commonly applied parameterization. Daytime net shortwave heat flux into the water is significantly reduced, particularly for waters with bright sediments, dense horizontal seagrass canopies waters with suspended particulate matter concentration ≥ 50 g m-3. Observations of a more vertical seagrass canopy within 0.2 and 1 m of the surface indicate the increase in albedo compared to the common parameterization is negligible. Therefore, we suggest that the commonly applied albedo lookup table can be used in coastal heat flux estimates in water as shallow as 1 m unless the bottom substrate is highly reflective or the water is highly turbid. Our model results provide guidance to researchers who need to determine albedo in highly reflective or highly turbid conditions but have no direct observations.
76 FR 41685 - Electronic Substitutions for Form SSA-538
2011-07-15
... visit our Internet site, Social Security Online, at http://www.socialsecurity.gov . SUPPLEMENTARY... SOCIAL SECURITY ADMINISTRATION 20 CFR Part 416 [Docket No. SSA-2009-0027] RIN 0960-AH02 Electronic Substitutions for Form SSA-538 AGENCY: Social Security Administration. ACTION: Final rule with request for...
A. A. Marks; M. D. King
2013-01-01
Black carbon in sea ice will decrease sea ice surface albedo through increased absorption of incident solar radiation, exacerbating sea ice melting. Previous literature has reported different albedo responses to additions of black carbon in sea ice and has not considered how a snow cover may mitigate the effect of black carbon in sea ice. Sea ice is predominately snow covered. Visible light absorption and light scattering coefficients are calculated for a typical first year and multi-y...
SSA State Agency Workload Data
Social Security Administration — The dataset is revised and expanded from 4 to 71 data fields. It includes monthly data from October 2000 onwards for SSA disability cases that were referred to the...
Understanding Large-scale Structure in the SSA22 Protocluster Region Using Cosmological Simulations
Topping, Michael W.; Shapley, Alice E.; Steidel, Charles C.; Naoz, Smadar; Primack, Joel R.
2018-01-01
We investigate the nature and evolution of large-scale structure within the SSA22 protocluster region at z = 3.09 using cosmological simulations. A redshift histogram constructed from current spectroscopic observations of the SSA22 protocluster reveals two separate peaks at z = 3.065 (blue) and z = 3.095 (red). Based on these data, we report updated overdensity and mass calculations for the SSA22 protocluster. We find {δ }b,{gal}=4.8+/- 1.8 and {δ }r,{gal}=9.5+/- 2.0 for the blue and red peaks, respectively, and {δ }t,{gal}=7.6+/- 1.4 for the entire region. These overdensities correspond to masses of {M}b=(0.76+/- 0.17)× {10}15{h}-1 {M}ȯ , {M}r=(2.15+/- 0.32)× {10}15{h}-1 {M}ȯ , and {M}t=(3.19+/- 0.40)× {10}15{h}-1 {M}ȯ for the red, blue, and total peaks, respectively. We use the Small MultiDark Planck (SMDPL) simulation to identify comparably massive z∼ 3 protoclusters, and uncover the underlying structure and ultimate fate of the SSA22 protocluster. For this analysis, we construct mock redshift histograms for each simulated z∼ 3 protocluster, quantitatively comparing them with the observed SSA22 data. We find that the observed double-peaked structure in the SSA22 redshift histogram corresponds not to a single coalescing cluster, but rather the proximity of a ∼ {10}15{h}-1 {M}ȯ protocluster and at least one > {10}14{h}-1 {M}ȯ cluster progenitor. Such associations in the SMDPL simulation are easily understood within the framework of hierarchical clustering of dark matter halos. We finally find that the opportunity to observe such a phenomenon is incredibly rare, with an occurrence rate of 7.4{h}3 {{{Gpc}}}-3. Based on data obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration, and was made possible by the generous financial support of the W.M. Keck Foundation.
Kristin Lewis; William P. Arnott; Hans Moosmuller; Cyle E. Wold
2008-01-01
A dual-wavelength photoacoustic instrument operating at 405 and 870 nm was used during the 2006 Fire Lab at Missoula Experiment to measure light scattering and absorption by smoke from the combustion of a variety of biomass fuels. Simultaneous measurements of aerosol light scattering by reciprocal nephelometry within the instrument's acoustic resonator accompany...
Sida, Tesfaye Shiferaw
2018-01-01
Scattered trees dominate smallholder agricultural landscapes in Ethiopia, as in large parts of sub-Saharan Africa (SSA). While the integration of scattered trees with crops could provide a viable pathway for sustainable intensification of these farming systems, they also lead to trade- offs.
Albedo matters: Understanding runaway albedo variations on Pluto
Earle, Alissa M.; Binzel, Richard P.; Young, Leslie A.; Stern, S. A.; Ennico, K.; Grundy, W.; Olkin, C. B.; Weaver, H. A.; New Horizons Surface Composition Theme
2018-03-01
The data returned from NASA's New Horizons reconnaissance of the Pluto system show striking albedo variations from polar to equatorial latitudes as well as sharp longitudinal boundaries. Pluto has a high obliquity (currently 119°) that varies by 23° over a period of less than 3 million years. This variation, combined with its regressing longitude of perihelion (360° over 3.7 million years), creates epochs of "Super Seasons" where one pole is pointed at the Sun at perihelion, thereby experiencing a short, relatively warm summer followed by its longest possible period of winter darkness. In contrast, the other pole experiences a much longer, less intense summer and a short winter season. We use a simple volatile sublimation and deposition model to explore the relationship between albedo variations, latitude, and volatile sublimation and deposition for the current epoch as well as historical epochs during which Pluto experienced these "Super Seasons." Our investigation quantitatively shows that Pluto's geometry creates the potential for runaway albedo and volatile variations, particularly in the equatorial region, which can sustain stark longitudinal contrasts like the ones we see between Tombaugh Regio and the informally named Cthulhu Regio.
GillespieSSA: Implementing the Gillespie Stochastic Simulation Algorithm in R
Directory of Open Access Journals (Sweden)
Mario Pineda-Krch
2008-02-01
Full Text Available The deterministic dynamics of populations in continuous time are traditionally described using coupled, first-order ordinary differential equations. While this approach is accurate for large systems, it is often inadequate for small systems where key species may be present in small numbers or where key reactions occur at a low rate. The Gillespie stochastic simulation algorithm (SSA is a procedure for generating time-evolution trajectories of finite populations in continuous time and has become the standard algorithm for these types of stochastic models. This article presents a simple-to-use and flexible framework for implementing the SSA using the high-level statistical computing language R and the package GillespieSSA. Using three ecological models as examples (logistic growth, Rosenzweig-MacArthur predator-prey model, and Kermack-McKendrick SIRS metapopulation model, this paper shows how a deterministic model can be formulated as a finite-population stochastic model within the framework of SSA theory and how it can be implemented in R. Simulations of the stochastic models are performed using four different SSA Monte Carlo methods: one exact method (Gillespie's direct method; and three approximate methods (explicit, binomial, and optimized tau-leap methods. Comparison of simulation results confirms that while the time-evolution trajectories obtained from the different SSA methods are indistinguishable, the approximate methods are up to four orders of magnitude faster than the exact methods.
A successive order of scattering model for solving vector radiative transfer in the atmosphere
International Nuclear Information System (INIS)
Min Qilong; Duan Minzheng
2004-01-01
A full vector radiative transfer model for vertically inhomogeneous plane-parallel media has been developed by using the successive order of scattering approach. In this model, a fast analytical expansion of Fourier decomposition is implemented and an exponent-linear assumption is used for vertical integration. An analytic angular interpolation method of post-processing source function is also implemented to accurately interpolate the Stokes vector at arbitrary angles for a given solution. It has been tested against the benchmarks for the case of randomly orientated oblate spheroids, illustrating a good agreement for each stokes vector (within 0.01%). Sensitivity tests have been conducted to illustrate the accuracy of vertical integration and angle interpolation approaches. The contribution of each scattering order for different optical depths and single scattering albedos are also analyzed
Directory of Open Access Journals (Sweden)
Guennadi Saiko
2014-01-01
Full Text Available Various scenarios of light propagation paths in turbid media (single backward scattering, multiple backward scattering, banana shape are discussed and their contributions to reflectance spectra are estimated. It has been found that a single backward or multiple forward scattering quasi-1D paths can be the major contributors to reflected spectra in wide area illumination scenario. Such a single backward scattering (SBS approximation allows developing of an analytical approach which can take into account refractive index mismatched boundary conditions and multilayer geometry and can be used for real-time spectral processing. The SBS approach can be potentially applied for the distances between the transport and reduced scattering domains. Its validation versus the Kubelka-Munk model, path integrals, and diffusion approximation of the radiation transport theory is discussed.
A Hierarchical Volumetric Shadow Algorithm for Single Scattering
Baran, Ilya; Chen, Jiawen; Ragan-Kelley, Jonathan Millar; Durand, Fredo; Lehtinen, Jaakko
2010-01-01
Volumetric effects such as beams of light through participating media are an important component in the appearance of the natural world. Many such effects can be faithfully modeled by a single scattering medium. In the presence of shadows, rendering these effects can be prohibitively expensive: current algorithms are based on ray marching, i.e., integrating the illumination scattered towards the camera along each view ray, modulated by visibility to the light source at each sample. Visibility...
Elastic scattering of electrons from singly ionized argon
International Nuclear Information System (INIS)
Griffin, D.C.; Pindzola, M.S.
1996-01-01
Recently, Greenwood et al. [Phys. Rev. Lett. 75, 1062 (1995)] reported measurements of large-angle elastic scattering of electrons from singly ionized argon at an energy of 3.3 eV. They compared their results for the differential cross section with cross sections determined using phase shifts obtained from two different scattering potentials and found large discrepancies between theory and experiment at large angles. They state that these differences may be due to the effects of polarization of the target, which are not included in their calculations, as well as inaccurate representations of electron exchange in the local scattering potentials that are employed to determine the phase shifts. In order to test these proposed explanations of the discrepancies, we have carried out calculations of elastic scattering from Ar + using the R-matrix method. We compare both a single-state calculation, which does not include polarization, and a 17-state calculation, in which the effects of dipole polarizability are included through the use of polarization pseudostates within the close-coupling expansion, to each other and with the measurements. We find some differences between the two calculations at intermediate scattering angles, but very close agreement at angles above 100 degree. Although the calculated cross sections agree with experiment between 120 degree and 135 degree, large discrepancies persist at angles above 135 degree. We conclude that the differences between the measurements and theory cannot be explained on the basis of an inaccurate representation of electron exchange or polarization of the target. copyright 1996 The American Physical Society
New tools and paradigms for the analysis of sea spray aerosols by single particle mass spectrometry
Sultana, Camille M.
2017-01-01
Aerosols can influence the chemistry of the atmosphere as well as also impact global climate by directly scattering light and modifying cloud properties. Sea spray aerosols (SSA) are the second most abundant natural aerosol globally and have the potential to strongly influence atmospheric chemistry and scattering of solar radiation in marine regions. In this dissertation, an ATOFMS was utilized to characterize the chemistry of SSA, focusing on describing the mixing state of the population an...
UV/visible albedos from airborne measurements
Webb, A.; Kylling, A.; Stromberg, I.
2003-04-01
During the INSPECTRO campaign effective surface albedo was measured at UV and visible wavelengths from two airborne platforms, a Cessna light aircraft and a hot air balloon. On board the Cessna was a scanning spectroradiometer measuring from 300 - 500nm at 10nm intervals. The NILU cube, with 6 faces and two UV channels at 312 and 340nm, was suspended beneath the hot air balloon. Flights took place over East Anglia during September, 2002. Balloon flights were made below cloud layers, while the Cessna flew both above and below cloud. The Cessna also flew over Barton Bendish, where surface albedos have been measured for ground truthing of satellite data, and measured the effective albedo at four visible wave- lengths in the centres of the satellite bandpass functions. Results of measurements from the different platforms are compared, and model simulations used to deduce the surface albedo from the effective albedo at altitude, giving, for example, an albedo of 0.02 ± 0.01 at 340nm.
A New Trend-Following Indicator: Using SSA to Design Trading Rules
Leles, Michel Carlo Rodrigues; Mozelli, Leonardo Amaral; Guimarães, Homero Nogueira
Singular Spectrum Analysis (SSA) is a non-parametric approach that can be used to decompose a time-series as trends, oscillations and noise. Trend-following strategies rely on the principle that financial markets move in trends for an extended period of time. Moving Averages (MAs) are the standard indicator to design such strategies. In this study, SSA is used as an alternative method to enhance trend resolution in comparison with the traditional MA. New trading rules using SSA as indicator are proposed. This paper shows that for the Down Jones Industrial Average (DJIA) and Shangai Securities Composite Index (SSCI) time-series the SSA trading rules provided, in general, better results in comparison to MA trading rules.
Estimation of daily albedo on Tottori sand surface
International Nuclear Information System (INIS)
Gu, S.; Otsuki, K.; Kamichika, M.
2001-01-01
Daily albedos of a bare sand surface were measured with a solarimeter (Eko MS-62) between 23 August and 30 November in 1997 at Tottori sand dune, Japan. These quickly decreased on rainy days, and recovered during dry spells (days between rainfalls). A strong exponential relationship was found between daily albedos and the number of dry days. The daily albedos on dry days also showed a direct relationship with daily transmissivities in the range less than 0.55. Two simple models were developed to estimate daily albedos for dry spell days on bare Tottori sand surface using routine meteorological data. Daily albedos were calculated using these two models, and compared with the measured daily albedos. For Model #1, the daily albedos were successfully predicted only using the number of dry spell days; the correlation coefficient between the estimated and measured albedo was 0.73, and the standard error was 1.2%. For Model #2, the number of dry spell days and transmissivity were considered in order to calculate the daily albedo on dry spell days; the correlation coefficient was 0.85, and the standard error was 0.9%. Estimated albedos were in good agreement with measured albedos. (author)
International Nuclear Information System (INIS)
Suzuki, Katsuhisa; Ogawa, Toshihiro.
1982-01-01
The ozone Hartey absorption band in the middle ultraviolet range is commonly adopted for the ozone measurement by rocket and satellite observations. In Japan, since 1965 the ozone absorption in the solar ultraviolet radiation has been observed by rocket-borne uv photometers. On the other hand the spectroscopic measurements of the scattered solar ultraviolet radiation from the terrestrial atmosphere will be performed by the EXOS-C satellite which will be launched in 1984. We tested the spectrometer for this satellite experiment by S-520-4 rocket launched on 5 September 1981. This instrument observed the scattered radiation of 2500 A -- 3300 A and the visible earth albedo of 4030 A. The spectrometer is consisted of a concave grating and has about 10 A wavelength resolution. A photomultiplier having a Cs-Te photocathode is used as a uv detector. The visible albedo is measured by a photometer consisting of an interference filter and a phototube. We estimated the atmospheric ozone profile, comparing the uv spectrum obtained by this experiment with the model calculations. The estimated ozone density profile higher than 30 km altitude has good agreement with the profile obtained by the previous uv photometer experiments at Uchinoura. There are differences between the observed spectrum and the calculated one in = 3100 A. We can explain them by the effect of Mie scattering and the uv stray light. In the present experiment we could successfully test the functions of the instrument in the space. rocket, spectrometer, solar ultraviolet radiation, earth albedo, ozone (author)
Determining Complex Structures using Docking Method with Single Particle Scattering Data
Directory of Open Access Journals (Sweden)
Haiguang Liu
2017-04-01
Full Text Available Protein complexes are critical for many molecular functions. Due to intrinsic flexibility and dynamics of complexes, their structures are more difficult to determine using conventional experimental methods, in contrast to individual subunits. One of the major challenges is the crystallization of protein complexes. Using X-ray free electron lasers (XFELs, it is possible to collect scattering signals from non-crystalline protein complexes, but data interpretation is more difficult because of unknown orientations. Here, we propose a hybrid approach to determine protein complex structures by combining XFEL single particle scattering data with computational docking methods. Using simulations data, we demonstrate that a small set of single particle scattering data collected at random orientations can be used to distinguish the native complex structure from the decoys generated using docking algorithms. The results also indicate that a small set of single particle scattering data is superior to spherically averaged intensity profile in distinguishing complex structures. Given the fact that XFEL experimental data are difficult to acquire and at low abundance, this hybrid approach should find wide applications in data interpretations.
Arctic sea ice albedo from AVHRR
Lindsay, R. W.; Rothrock, D. A.
1994-01-01
The seasonal cycle of surface albedo of sea ice in the Arctic is estimated from measurements made with the Advanced Very High Resolution Radiometer (AVHRR) on the polar-orbiting satellites NOAA-10 and NOAA-11. The albedos of 145 200-km-square cells are analyzed. The cells are from March through September 1989 and include only those for which the sun is more than 10 deg above the horizon. Cloud masking is performed manually. Corrections are applied for instrument calibration, nonisotropic reflection, atmospheric interference, narrowband to broadband conversion, and normalization to a common solar zenith angle. The estimated albedos are relative, with the instrument gain set to give an albedo of 0.80 for ice floes in March and April. The mean values for the cloud-free portions of individual cells range from 0.18 to 0.91. Monthly averages of cells in the central Arctic range from 0.76 in April to 0.47 in August. The monthly averages of the within-cell standard deviations in the central Arctic are 0.04 in April and 0.06 in September. The surface albedo and surface temperature are correlated most strongly in March (R = -0.77) with little correlation in the summer. The monthly average lead fraction is determined from the mean potential open water, a scaled representation of the temperature or albedo between 0.0 (for ice) and 1.0 (for water); in the central Arctic it rises from an average 0.025 in the spring to 0.06 in September. Sparse data on aerosols, ozone, and water vapor in the atmospheric column contribute uncertainties to instantaneous, area-average albedos of 0.13, 0.04, and 0.08. Uncertainties in monthly average albedos are not this large. Contemporaneous estimation of these variables could reduce the uncertainty in the estimated albedo considerably. The poor calibration of AVHRR channels 1 and 2 is another large impediment to making accurate albedo estimates.
REFLECTED LIGHT CURVES, SPHERICAL AND BOND ALBEDOS OF JUPITER- AND SATURN-LIKE EXOPLANETS
Energy Technology Data Exchange (ETDEWEB)
Dyudina, Ulyana; Kopparla, Pushkar; Ingersoll, Andrew P.; Yung, Yuk L. [Division of Geological and Planetary Sciences, 150-21 California Institute of Technology, Pasadena, CA 91125 (United States); Zhang, Xi [University of California Santa Cruz 1156 High Street, Santa Cruz, CA 95064 (United States); Li, Liming [Department of Physics, University of Houston, Houston, TX 77204 (United States); Dones, Luke [Southwest Research Institute, 1050 Walnut Street, Suite 300, Boulder CO 80302 (United States); Verbiscer, Anne, E-mail: ulyana@gps.caltech.edu [Department of Astronomy, University of Virginia, Charlottesville, VA 22904-4325 (United States)
2016-05-10
Reflected light curves observed for exoplanets indicate that a few of them host bright clouds. We estimate how the light curve and total stellar heating of a planet depends on forward and backward scattering in the clouds based on Pioneer and Cassini spacecraft images of Jupiter and Saturn. We fit analytical functions to the local reflected brightnesses of Jupiter and Saturn depending on the planet’s phase. These observations cover broadbands at 0.59–0.72 and 0.39–0.5 μ m, and narrowbands at 0.938 (atmospheric window), 0.889 (CH4 absorption band), and 0.24–0.28 μ m. We simulate the images of the planets with a ray-tracing model, and disk-integrate them to produce the full-orbit light curves. For Jupiter, we also fit the modeled light curves to the observed full-disk brightness. We derive spherical albedos for Jupiter and Saturn, and for planets with Lambertian and Rayleigh-scattering atmospheres. Jupiter-like atmospheres can produce light curves that are a factor of two fainter at half-phase than the Lambertian planet, given the same geometric albedo at transit. The spherical albedo is typically lower than for a Lambertian planet by up to a factor of ∼1.5. The Lambertian assumption will underestimate the absorption of the stellar light and the equilibrium temperature of the planetary atmosphere. We also compare our light curves with the light curves of solid bodies: the moons Enceladus and Callisto. Their strong backscattering peak within a few degrees of opposition (secondary eclipse) can lead to an even stronger underestimate of the stellar heating.
Preliminary study of the space adaptation of the MELiSSA life support system
Mas-Albaigès, Joan L.; Duatis, Jordi; Podhajsky, Sandra; Guirado, Víctor; Poughon, Laurent
MELiSSA (Micro-Ecological Life Support System Alternative) is an European Space Agency (ESA) project focused on the development of a closed regenerative life support system to aid the development of technologies for future life support systems for long term manned planetary missions, e.g. a lunar base or missions to Mars. In order to understand the potential evolution of the MELiSSA concept towards its future use in the referred manned planetary mission context the MELiSSA Space Adaptation (MSA) activity has been undertaken. MSA's main objective is to model the different MELiSSA compartments using EcosimPro R , a specialized simulation tool for life support applications, in order to define a preliminary MELiSSA implementation for service in a man-tended lunar base scenario, with a four-member crew rotating in six-month increments, and performing the basic LSS functions of air revitalization, food production, and waste and water recycling. The MELiSSA EcosimPro R Model features a dedicated library for the different MELiSSA elements (bioreactors, greenhouse, crew, interconnecting elements, etc.). It is used to dimension the MELiSSA system in terms of major parameters like mass, volume and energy needs, evaluate the accuracy of the results and define the strategy for a progressive loop closure from the initial required performance (approx.100 The MELiSSA configuration(s) obtained through the EcosimPro R simulation are further analysed using the Advanced Life Support System Evaluation (ALISSE) metric, relying on mass, energy, efficiency, human risk, system reliability and crew time, for trade-off and optimization of results. The outcome of the MSA activity is, thus, a potential Life Support System architecture description, based on combined MELiSSA and other physico-chemical technologies, defining its expected performance, associated operational conditions and logistic needs.
Cloud albedo increase from carbonaceous aerosol
Directory of Open Access Journals (Sweden)
W. R. Leaitch
2010-08-01
Full Text Available Airborne measurements from two consecutive days, analysed with the aid of an aerosol-adiabatic cloud parcel model, are used to study the effect of carbonaceous aerosol particles on the reflectivity of sunlight by water clouds. The measurements, including aerosol chemistry, aerosol microphysics, cloud microphysics, cloud gust velocities and cloud light extinction, were made below, in and above stratocumulus over the northwest Atlantic Ocean. On the first day, the history of the below-cloud fine particle aerosol was marine and the fine particle sulphate and organic carbon mass concentrations measured at cloud base were 2.4 μg m−3 and 0.9 μg m−3 respectively. On the second day, the below-cloud aerosol was continentally influenced and the fine particle sulphate and organic carbon mass concentrations were 2.3 μg m−3 and 2.6 μg m−3 respectively. Over the range 0.06–0.8 μm diameter, the shapes of the below-cloud size distributions were similar on both days and the number concentrations were approximately a factor of two higher on the second day. The cloud droplet number concentrations (CDNC on the second day were approximately three times higher than the CDNC measured on the first day. Using the parcel model to separate the influence of the differences in gust velocities, we estimate from the vertically integrated cloud light scattering measurements a 6% increase in the cloud albedo principally due to the increase in the carbonaceous components on the second day. Assuming no additional absorption by this aerosol, a 6% albedo increase translates to a local daytime radiative cooling of ∼12 W m−2. This result provides observational evidence that the role of anthropogenic carbonaceous components in the cloud albedo effect can be much larger than that of anthropogenic sulphate, as some global simulations have indicated.
The OMI Aerosol Absorption Product: An A-train application
Torres, O.; Jethva, H. T.; Ahn, C.
2017-12-01
Because of the uniquely large sensitivity of satellite-measured near-UV radiances to absorption by desert dust, carbonaceous and volcanic ash aerosols, observations by a variety of UV-capable sensors have been routinely used over the last forty years in both qualitative and quantitative applications for estimating the absorption properties of these aerosol types. In this presentation we will discuss a multi-sensor application involving observations from A-train sensors OMI, AIRS and CALIOP for the creation of a 13-year record of aerosol optical depth (AOD) and single scattering albedo (SSA). Determination of aerosol type, in terms of particle size distribution and refractive index, is an important algorithmic step that requires using external information. AIRS CO measurements are used as carbonaceous aerosols tracer to differentiate this aerosol type from desert dust. On the other hand, the height of the absorbing aerosol layer, an important parameter in UV aerosol retrievals, is prescribed using a CALIOP-based climatology. The combined use of these observations in the developments of the OMI long-term AOD/SSA record will be discussed along with an evaluation of retrieval results using independent observations.
The Spatial and Temporal Distributions of Absorbing Aerosols over East Asia
Directory of Open Access Journals (Sweden)
Litai Kang
2017-10-01
Full Text Available Absorbing aerosols can strongly absorb solar radiation and have a profound impact on the global and regional climate. Black carbon (BC, organic carbon (OC and dust are three major types of absorbing aerosols. In order to deepen the overall understanding of absorbing aerosols over East Asia and provide a basis for further investigation of its role in enhanced warming in drylands, the spatial-temporal distribution of absorbing aerosols over East Asia for the period of 2005–2016 was investigated based on the Ozone Monitoring Instrument (OMI satellite retrievals. Overall, high values of Aerosol Absorption Optical Depth (AAOD mainly distribute near dust sources as well as BC and OC sources. AAOD reaches its maximum during spring over East Asia as a result of dust activity and biomass burning. Single-scattering albedo (SSA is comparatively high (>0.96 in the most part of East Asia in the summer, indicating the dominance of aerosol scattering. Hyper-arid regions have the highest Aerosol Optical Depth (AOD and AAOD among the five climatic regions, with springtime values up to 0.72 and 0.04, respectively. Humid and sub-humid regions have relatively high AOD and AAOD during the spring and winter and the highest SSA during the summer. AAOD in some areas shows significant upward trends, which is likely due to the increase of BC and OC emission. SSA shows overall downward trends, indicating the enhancement of the aerosol absorption. Analysis of emission inventory and dust index data shows that BC and OC emissions mainly come from the humid regions, while dust sources mainly distribute in drylands.
Biçer, M.; Kaşkaş, A.
2018-03-01
The infinite medium Green's function is used to solve the half-space albedo, slab albedo and Milne problems for the unpolarized Rayleigh scattering case; these problems are the most classical problems of radiative transfer theory. The numerical results are obtained and are compared with previous ones.
Microwave single-scattering properties of randomly oriented soft-ice hydrometeors
Directory of Open Access Journals (Sweden)
D. Casella
2008-11-01
Full Text Available Large ice hydrometeors are usually present in intense convective clouds and may significantly affect the upwelling radiances that are measured by satellite-borne microwave radiometers – especially, at millimeter-wavelength frequencies. Thus, interpretation of these measurements (e.g., for precipitation retrieval requires knowledge of the single scattering properties of ice particles. On the other hand, shape and internal structure of these particles (especially, the larger ones is very complex and variable, and therefore it is necessary to resort to simplifying assumptions in order to compute their single-scattering parameters.
In this study, we use the discrete dipole approximation (DDA to compute the absorption and scattering efficiencies and the asymmetry factor of two kinds of quasi-spherical and non-homogeneous soft-ice particles in the frequency range 50–183 GHz. Particles of the first kind are modeled as quasi-spherical ice particles having randomly distributed spherical air inclusions. Particles of the second kind are modeled as random aggregates of ice spheres having random radii. In both cases, particle densities and dimensions are coherent with the snow hydrometeor category that is utilized by the University of Wisconsin – Non-hydrostatic Modeling System (UW-NMS cloud-mesoscale model. Then, we compare our single-scattering results for randomly-oriented soft-ice hydrometeors with corresponding ones that make use of: a effective-medium equivalent spheres, b solid-ice equivalent spheres, and c randomly-oriented aggregates of ice cylinders. Finally, we extend to our particles the scattering formulas that have been developed by other authors for randomly-oriented aggregates of ice cylinders.
Structural Encoding of Static Single Assignment Form
DEFF Research Database (Denmark)
Gal, Andreas; Probst, Christian; Franz, Michael
2005-01-01
Static Single Assignment (SSA) form is often used as an intermediate representation during code optimization in Java Virtual Machines. Recently, SSA has successfully been used for bytecode verification. However, constructing SSA at the code consumer is costly. SSAbased mobile code transport formats...... Java bytecode. While the resulting bytecode sequence can still be directly executed by traditional Virtual Machines, our novel VM can infer SSA form and confirm its safety with virtually no overhead....... have been shown to eliminate this cost by shifting SSA creation to the code producer. These new formats, however, are not backward compatible with the established Java class-file format. We propose a novel approach to transport SSA information implicitly through structural code properties of standard...
Measurement of spectral sea ice albedo at Qaanaaq fjord in northwest Greenland
Tanikawa, T.
2017-12-01
The spectral albedos of sea ice were measured at Qaanaaq fjord in northwest Greenland. Spectral measurements were conducted for sea ice covered with snow and sea ice without snow where snow was artificially removed around measurement point. Thickness of the sea ice was approximately 1.3 m with 5 cm of snow over the sea ice. The measurements show that the spectral albedos of the sea ice with snow were lower than those of natural pure snow especially in the visible regions though the spectral shapes were similar to each other. This is because the spectral albedos in the visible region have information of not only the snow but also the sea ice under the snow. The spectral albedos of the sea ice without the snow were approximately 0.4 - 0.5 in the visible region, 0.05-0.25 in the near-infrared region and almost constant of approximately 0.05 in the region of 1500 - 2500 nm. In the visible region, it would be due to multiple scattering by an air bubble within the sea ice. In contrast, in the near-infrared and shortwave infrared wavelengths, surface reflection at the sea ice surface would be dominant. Since a light absorption by the ice in these regions is relatively strong comparing to the visible region, the light could not be penetrated deeply within the sea ice, resulting that surface reflection based on Fresnel reflection would be dominant. In this presentation we also show the results of comparison between the radiative transfer calculation and spectral measurement data.
Go, S.; Kim, J.; KIM, M.; Choi, M.; Lim, H.
2017-12-01
Non-spherical assumption of particle shape has been used to replace the spherical assumption in the Geostationary Environment Monitoring Spectrometer (GEMS) aerosol optical properties retrievals for dust particles. GEMS aerosol retrieval algorithms are based on optimal estimation method to provide aerosol optical depth (AOD), single scattering albedo (SSA) at 443nm, and aerosol loading height (ALH) simultaneously as products. Considering computing time efficiency, the algorithm takes Look-Up Table (LUT) approach using Vector Linearized Discrete Ordinate Radiative Transfer code (VLIDORT), and aerosol optical properties for three aerosol types of absorbing fine aerosol (BC), dust and non-absorbing aerosol (NA) are integrated from AERONET inversion data, and fed into the LUT calculation. In this study, by applying the present algorithm to OMI top-of the atmosphere normalized radiance, retrieved AOD, SSA with both spherical and non-spherical assumptions have been compared to the surface AERONET observations at East Asia sites for 3 years from 2005 to 2007 to evaluate and quantify the effect of non-spherical dust particles on the satellite aerosol retrievals. The root-mean-square error (RMSE) in the satellite retrieved AOD have been slightly reduced as a result of adopting the non-spherical assumption in the GEMS aerosol retrieval algorithm. For SSA, algorithm tested with spheroid models on dust particle shows promising results for the improved SSA. In terms of ALH, the results are qualitatively compared with CALIOP products, and shows consistent variation. This result suggests the importance of taking into account the effects of non-sphericity in the retrieval of dust particles from GEMS measurements.
Energy Technology Data Exchange (ETDEWEB)
Evans, Thomas M.; Aigrain, Suzanne; Barstow, Joanna K. [Department of Physics, University of Oxford, Denys Wilkinson Building, Keble Road, Oxford OX1 3RH (United Kingdom); Pont, Frederic; Sing, David K. [School of Physics, University of Exeter, EX4 4QL Exeter (United Kingdom); Desert, Jean-Michel; Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Gibson, Neale [European Southern Observatory, Karl-Schwarzschild-Strasse 2, D-85748 Garching (Germany); Heng, Kevin [University of Bern, Center for Space and Habitability, Sidlerstrasse 5, CH-3012 Bern (Switzerland); Lecavelier des Etangs, Alain, E-mail: tom.evans@astro.ox.ac.uk [Institut d' Astrophysique de Paris, UMR7095 CNRS, Universite Pierre et Marie Curie, 98 bis Boulevard Arago, F-75014 Paris (France)
2013-08-01
We present a secondary eclipse observation for the hot Jupiter HD 189733b across the wavelength range 290-570 nm made using the Space Telescope Imaging Spectrograph on the Hubble Space Telescope. We measure geometric albedos of A{sub g} = 0.40 {+-} 0.12 across 290-450 nm and A{sub g} < 0.12 across 450-570 nm at 1{sigma} confidence. The albedo decrease toward longer wavelengths is also apparent when using six wavelength bins over the same wavelength range. This can be interpreted as evidence for optically thick reflective clouds on the dayside hemisphere with sodium absorption suppressing the scattered light signal beyond {approx}450 nm. Our best-fit albedo values imply that HD 189733b would appear a deep blue color at visible wavelengths.
Clinical and Pathological Roles of Ro/SSA Autoantibody System
Directory of Open Access Journals (Sweden)
Ryusuke Yoshimi
2012-01-01
Full Text Available Anti-Ro/SSA antibodies are among the most frequently detected autoantibodies against extractable nuclear antigens and have been associated with systemic lupus erythematosus (SLE and Sjögren's syndrome (SS. Although the presence of these autoantibodies is one of the criteria for the diagnosis and classification of SS, they are also sometimes seen in other systemic autoimmune diseases. In the last few decades, the knowledge of the prevalence of anti-Ro/SSA antibodies in various autoimmune diseases and symptoms has been expanded, and the clinical importance of these antibodies is increasing. Nonetheless, the pathological role of the antibodies is still poorly understood. In this paper, we summarize the milestones of the anti-Ro/SSA autoantibody system and provide new insights into the association between the autoantibodies and the pathogenesis of autoimmune diseases.
Simulation and Analysis of the Topographic Effects on Snow-Free Albedo over Rugged Terrain
Directory of Open Access Journals (Sweden)
Dalei Hao
2018-02-01
Full Text Available Topography complicates the modeling and retrieval of land surface albedo due to shadow effects and the redistribution of incident radiation. Neglecting topographic effects may lead to a significant bias when estimating land surface albedo over a single slope. However, for rugged terrain, a comprehensive and systematic investigation of topographic effects on land surface albedo is currently ongoing. Accurately estimating topographic effects on land surface albedo over a rugged terrain presents a challenge in remote sensing modeling and applications. In this paper, we focused on the development of a simplified estimation method for snow-free albedo over a rugged terrain at a 1-km scale based on a 30-m fine-scale digital elevation model (DEM. The proposed method was compared with the radiosity approach based on simulated and real DEMs. The results of the comparison showed that the proposed method provided adequate computational efficiency and satisfactory accuracy simultaneously. Then, the topographic effects on snow-free albedo were quantitatively investigated and interpreted by considering the mean slope, subpixel aspect distribution, solar zenith angle, and solar azimuth angle. The results showed that the more rugged the terrain and the larger the solar illumination angle, the more intense the topographic effects were on black-sky albedo (BSA. The maximum absolute deviation (MAD and the maximum relative deviation (MRD of the BSA over a rugged terrain reached 0.28 and 85%, respectively, when the SZA was 60° for different terrains. Topographic effects varied with the mean slope, subpixel aspect distribution, SZA and SAA, which should not be neglected when modeling albedo.
Scatter measurement and correction method for cone-beam CT based on single grating scan
Huang, Kuidong; Shi, Wenlong; Wang, Xinyu; Dong, Yin; Chang, Taoqi; Zhang, Hua; Zhang, Dinghua
2017-06-01
In cone-beam computed tomography (CBCT) systems based on flat-panel detector imaging, the presence of scatter significantly reduces the quality of slices. Based on the concept of collimation, this paper presents a scatter measurement and correction method based on single grating scan. First, according to the characteristics of CBCT imaging, the scan method using single grating and the design requirements of the grating are analyzed and figured out. Second, by analyzing the composition of object projection images and object-and-grating projection images, the processing method for the scatter image at single projection angle is proposed. In addition, to avoid additional scan, this paper proposes an angle interpolation method of scatter images to reduce scan cost. Finally, the experimental results show that the scatter images obtained by this method are accurate and reliable, and the effect of scatter correction is obvious. When the additional object-and-grating projection images are collected and interpolated at intervals of 30 deg, the scatter correction error of slices can still be controlled within 3%.
Higginson, Drew P.
2017-11-01
We describe and justify a full-angle scattering (FAS) method to faithfully reproduce the accumulated differential angular Rutherford scattering probability distribution function (pdf) of particles in a plasma. The FAS method splits the scattering events into two regions. At small angles it is described by cumulative scattering events resulting, via the central limit theorem, in a Gaussian-like pdf; at larger angles it is described by single-event scatters and retains a pdf that follows the form of the Rutherford differential cross-section. The FAS method is verified using discrete Monte-Carlo scattering simulations run at small timesteps to include each individual scattering event. We identify the FAS regime of interest as where the ratio of temporal/spatial scale-of-interest to slowing-down time/length is from 10-3 to 0.3-0.7; the upper limit corresponds to Coulomb logarithm of 20-2, respectively. Two test problems, high-velocity interpenetrating plasma flows and keV-temperature ion equilibration, are used to highlight systems where including FAS is important to capture relevant physics.
International Nuclear Information System (INIS)
Gad, N; Ibrahim, Alaa; Shokr, M
2017-01-01
We present a comparative study of atmospheric particulate matter (also known as aerosols) observed by satellite remote sensing and ground-based observations. We compare satellite measurements obtained by NASA’s Moderate Resolution Imaging Spectro-Radiometer (MODIS) and Multi-angle Imaging Spectro-Radiometer (MISR) instruments against the ground-based aerosol sun-photometer data from the Aerosol Robotic Network (AERONET) station in Cairo, Egypt from 2003 to 2014 to build a long-term database for climatological studies and to improve upon the accuracy and coverage achievable from the satellite data. We deduce microphysical and geometrical properties about the dominant aerosols based on key optical properties including aerosol optical depth (AOD), single scattering albedo (SSA), and Ångström exponent (AE). This has allowed us to place important constraints on the type of aerosols (natural, anthropogenic, and biogenic). (paper)
Albedo distribution in Lutzow-Holm Bay and its neighborhood
Directory of Open Access Journals (Sweden)
Kiyotaka Nakagawa
1997-03-01
Full Text Available A method has been developed for estimating the filtered narrow band surface albedo with NOAA/AVHRR data, and has been applied to analysis of the surface albedo distribution in Lutzow-Holm Bay and its neighborhood, Antarctica, in 1990. As a result, 16 maps of the surface albedo distribution have been drawn. From a comparison of the albedos inferred from satellite data with those actually observed in Ongul Strait, it is clear that the satellite-inferred, filtered narrow band albedos agree well with the daily means of ground-observed, unfiltered broad band albedo, despite systematic errors of about -4%. It is also clear that there is a characteristic pattern of surface albedo distribution in this area; the open sea has very low albedo of less than 5%, whereas most of the compact pack ice and fast ice has a high albedo of more than 60%. The albedo is lower in the eastern part of Lutzow-Holm Bay than in the western part; especially off the Soya Coast it is less than 40%. The ice sheet of Antarctica has a remarkably high albedo of more than 80%.
Neutron albedo effects of underground nuclear explosion
International Nuclear Information System (INIS)
Yang Bo; Ying Yangjun; Li Jinhong; Bai Yun
2013-01-01
The neutron field distribution is affected by the surrounding medium in the underground nuclear explosion. It will influence the radiation chemical diagnosis. By Monte Carlo simulation, the fuel burnup induced by device and neutron albedo was calculated. The analysis method of albedo effect on radiation chemical diagnosis result under special environment was proposed. Neutron albedo should be considered when capture reaction burnup fraction is used, and then correct analysis can be carried out on the nuclear device.The neutron field distribution is affected by the surrounding medium in the underground nuclear explosion. It will influence the radiation chemical diagnosis. By Monte Carlo simulation, the fuel burnup induced by device and neutron albedo was calculated. The analysis method of albedo effect on radiation chemical diagnosis result under special environment was proposed. Neutron albedo should be considered when capture reaction burnup fraction is used, and then correct analysis can be carried out on the nuclear device. (authors)
Rodriguez, E.; Kolmonen, P.; Virtanen, T. H.; Sogacheva, L.; Sundstrom, A.-M.; de Leeuw, G.
2015-08-01
The Advanced Along-Track Scanning Radiometer (AATSR) on board the ENVISAT satellite is used to study aerosol properties. The retrieval of aerosol properties from satellite data is based on the optimized fit of simulated and measured reflectances at the top of the atmosphere (TOA). The simulations are made using a radiative transfer model with a variety of representative aerosol properties. The retrieval process utilizes a combination of four aerosol components, each of which is defined by their (lognormal) size distribution and a complex refractive index: a weakly and a strongly absorbing fine-mode component, coarse mode sea salt aerosol and coarse mode desert dust aerosol). These components are externally mixed to provide the aerosol model which in turn is used to calculate the aerosol optical depth (AOD). In the AATSR aerosol retrieval algorithm, the mixing of these components is decided by minimizing the error function given by the sum of the differences between measured and calculated path radiances at 3-4 wavelengths, where the path radiances are varied by varying the aerosol component mixing ratios. The continuous variation of the fine-mode components allows for the continuous variation of the fine-mode aerosol absorption. Assuming that the correct aerosol model (i.e. the correct mixing fractions of the four components) is selected during the retrieval process, also other aerosol properties could be computed such as the single scattering albedo (SSA). Implications of this assumption regarding the ratio of the weakly/strongly absorbing fine-mode fraction are investigated in this paper by evaluating the validity of the SSA thus obtained. The SSA is indirectly estimated for aerosol plumes with moderate-to-high AOD resulting from wildfires in Russia in the summer of 2010. Together with the AOD, the SSA provides the aerosol absorbing optical depth (AAOD). The results are compared with AERONET data, i.e. AOD level 2.0 and SSA and AAOD inversion products. The RMSE
Arctic Region Space Weather Customers and SSA Services
DEFF Research Database (Denmark)
Høeg, Per; Kauristi, Kirsti; Wintoft, Peter
Arctic inhabitants, authorities, and companies rely strongly on precise localization information and communication covering vast areas with low infrastructure and population density. Thus modern technology is crucial for establishing knowledge that can lead to growth in the region. At the same time...... and communication can be established without errors resulting from Space Weather effects. An ESA project have identified and clarified, how the products of the four ESA Space Weather Expert Service Centres (SWE) in the ESA Space Situational Awareness Programme (SSA), can contribute to the requirements of SSA...
Single and multiple electromagnetic scattering by dielectric obstacles from a resonance perspective
International Nuclear Information System (INIS)
Riley, D.J.
1987-03-01
A new application of the singularity expansion method (SEM) is explored. This application combines the classical theory of wave propagation through a multiple-scattering environment and the SEM. Because the SEM is generally considered to be a theory for describing surface currents on conducting scatters, extensions are made which permit, under certain conditions, a singularity expansion representation for the electromagnetic field scattered by a dielectric scatterer. Application of this expansion is then made to the multiple-scattering case using both single and multiple interactions. A resonance scattering tensor form is used for the SEM description which leds to an associated tensor form for the solution to the multiple-scattering problem with each SEM pole effect appearing explicitly. The coherent field is determined for both spatial and SEM parameter random variations. A numerical example for the case of an ensemble of dielectric spheres which possess frequency-dependent loss is also made. Accurate resonance expansions for the single-scattering problem are derived, and resonance trajectories based on the Debye relaxation model for the refractive index are introduced. Application of these resonance expansions is then made to the multiple-scattering results for a slab containing a distribution of spheres with varying radii. Conditions are discussed which describe when the hybrid theory is appropriate. 53 refs., 21 figs., 9 tabs
International Nuclear Information System (INIS)
Jablonski, A
2015-01-01
An advanced analytical theory describing electron transport in the surface region of solids may have accuracy comparable to Monte Carlo simulations of electron trajectories, however such an approach requires knowledge of a parameter called the single scattering albedo. This parameter is material dependent and can be calculated from the elastic mean free path and transport mean free path for signal electrons. An attempt is made to derive a simple expression that accurately describes the energy dependence of single scattering albedo in a wide energy range from 50 eV to 30 keV for 78 elemental solids. For these solids and the considered energy range, the mean percentage deviations between the reference values and values calculated from the fitted function were found to be generally well below 1%; the largest value of this deviation was equal to 0.86% (europium). Calculation of the single scattering albedo with high accuracy requires only five fitted coefficients for a given element. Recommendations are also given for calculations of this parameter for compounds. Different predictive formulas expressed in terms of the single scattering albedo are briefly discussed. (paper)
CARP: a computer code and albedo data library for use by BREESE, the MORSE albedo package
International Nuclear Information System (INIS)
Emmett, M.B.; Rhoades, W.A.
1978-10-01
The CARP computer code was written to allow processing of DOT angular flux tapes to produce albedo data for use in the MORSE computer code. An albedo data library was produced containing several materials. 3 tables
Generating multi-scale albedo look-up maps using MODIS BRDF/Albedo products and landsat imagery
Surface albedo determines radiative forcing and is a key parameter for driving Earth’s climate. Better characterization of surface albedo for individual land cover types can reduce the uncertainty in estimating changes to Earth’s radiation balance due to land cover change. This paper presents a mult...
Evolution of ESA's SSA Conjunction Prediction Service
Escobar, D.; Sancho, A. Tirado, J.; Agueda, A.; Martin, L.; Luque, F.; Fletcher, E.; Navarro, V.
2013-08-01
This paper presents the recent evolution of ESA's SSA Conjunction Prediction Service (CPS) as a result of an on-going activity in the Space Surveillance and Tracking (SST) Segment of ESA's Space Situational Awareness (SSA) Programme. The CPS is one of a number of precursor services being developed as part of the SST segment. It has been implemented as a service to provide external users with web-based access to conjunction information and designed with a service-oriented architecture. The paper encompasses the following topics: service functionality enhancements, integration with a live objects catalogue, all vs. all analyses supporting an operational concept based on low and high fidelity screenings, and finally conjunction detection and probability algorithms.
Modeling Earth Albedo for Satellites in Earth Orbit
DEFF Research Database (Denmark)
Bhanderi, Dan; Bak, Thomas
2005-01-01
Many satellite are influences by the Earthøs albedo, though very few model schemes exist.in order to predict this phenomenon. Earth albedo is often treated as noise, or ignored completely. When applying solar cells in the attitude hardware, Earth albedo can cause the attitude estimate to deviate...... with as much as 20 deg. Digital Sun sensors with Earth albedo correction in hardware exist, but are expensive. In addition, albedo estimates are necessary in thermal calculations and power budgets. We present a modeling scheme base4d on Eartht reflectance, measured by NASA's Total Ozone Mapping Spectrometer......, in which the Earth Probe Satellite has recorded reflectivity data daily since mid 1996. The mean of these data can be used to calculate the Earth albedo given the positions of the satellite and the Sun. Our results show that the albedo varies highly with the solar angle to the satellite's field of view...
Temporary electron localization and scattering in disordered single strands of DNA
International Nuclear Information System (INIS)
Caron, Laurent; Sanche, Leon
2006-01-01
We present a theoretical study of the effect of structural and base sequence disorders on the transport properties of nonthermal electron scattering within and from single strands of DNA. The calculations are based on our recently developed formalism to treat multiple elastic scattering from simplified pseudomolecular DNA subunits. Structural disorder is shown to increase both the elastic scattering cross section and the attachment probability on the bases at low energy. Sequence disorder, however, has no significant effect
MELiSSA celebrates 25 years of research into life support
International Nuclear Information System (INIS)
2015-01-01
MELiSSA (Micro-Ecological Life Support System Alternative) is a collaborative project with the European Space Agency ESA and various other scientific partners. The objective of MELiSSA is to develop a system that is able to provide manned space missions with food, drinking water and oxygen autonomously in space. Drinkable water and oxygen are currently being made in the international space station ISS by filtering waste water and by electrolysing water. However, such physiochemical technologies do not offer a solution for food. The MELiSSA project intends to reuse waste products, which include CO2, water, stools and urine from the astronauts, and even the perspiration moisture in the cabin and to transfer these into food through the use of micro-organisms.
Sea ice-albedo climate feedback mechanism
Energy Technology Data Exchange (ETDEWEB)
Schramm, J.L.; Curry, J.A. [Univ. of Colorado, Boulder, CO (United States); Ebert, E.E. [Bureau of Meterology Research Center, Melbourne (Australia)
1995-02-01
The sea ice-albedo feedback mechanism over the Arctic Ocean multiyear sea ice is investigated by conducting a series of experiments using several one-dimensional models of the coupled sea ice-atmosphere system. In its simplest form, ice-albedo feedback is thought to be associated with a decrease in the areal cover of snow and ice and a corresponding increase in the surface temperature, further decreasing the area cover of snow and ice. It is shown that the sea ice-albedo feedback can operate even in multiyear pack ice, without the disappearance of this ice, associated with internal processes occurring within the multiyear ice pack (e.g., duration of the snow cover, ice thickness, ice distribution, lead fraction, and melt pond characteristics). The strength of the ice-albedo feedback mechanism is compared for several different thermodynamic sea ice models: a new model that includes ice thickness distribution., the Ebert and Curry model, the Mayjut and Untersteiner model, and the Semtner level-3 and level-0 models. The climate forcing is chosen to be a perturbation of the surface heat flux, and cloud and water vapor feedbacks are inoperative so that the effects of the sea ice-albedo feedback mechanism can be isolated. The inclusion of melt ponds significantly strengthens the ice-albedo feedback, while the ice thickness distribution decreases the strength of the modeled sea ice-albedo feedback. It is emphasized that accurately modeling present-day sea ice thickness is not adequate for a sea ice parameterization; the correct physical processes must be included so that the sea ice parameterization yields correct sensitivities to external forcing. 22 refs., 6 figs., 1 tab.
Plane-dependent ML scatter scaling: 3D extension of the 2D simulated single scatter (SSS) estimate
Rezaei, Ahmadreza; Salvo, Koen; Vahle, Thomas; Panin, Vladimir; Casey, Michael; Boada, Fernando; Defrise, Michel; Nuyts, Johan
2017-08-01
Scatter correction is typically done using a simulation of the single scatter, which is then scaled to account for multiple scatters and other possible model mismatches. This scaling factor is determined by fitting the simulated scatter sinogram to the measured sinogram, using only counts measured along LORs that do not intersect the patient body, i.e. ‘scatter-tails’. Extending previous work, we propose to scale the scatter with a plane dependent factor, which is determined as an additional unknown in the maximum likelihood (ML) reconstructions, using counts in the entire sinogram rather than only the ‘scatter-tails’. The ML-scaled scatter estimates are validated using a Monte-Carlo simulation of a NEMA-like phantom, a phantom scan with typical contrast ratios of a 68Ga-PSMA scan, and 23 whole-body 18F-FDG patient scans. On average, we observe a 12.2% change in the total amount of tracer activity of the MLEM reconstructions of our whole-body patient database when the proposed ML scatter scales are used. Furthermore, reconstructions using the ML-scaled scatter estimates are found to eliminate the typical ‘halo’ artifacts that are often observed in the vicinity of high focal uptake regions.
Steps Toward an EOS-Era Aerosol Type Climatology
Kahn, Ralph A.
2012-01-01
We still have a way to go to develop a global climatology of aerosol type from the EOS-era satellite data record that currently spans more than 12 years of observations. We have demonstrated the ability to retrieve aerosol type regionally, providing a classification based on the combined constraints on particle size, shape, and single-scattering albedo (SSA) from the MISR instrument. Under good but not necessarily ideal conditions, the MISR data can distinguish three-to-five size bins, two-to-four bins in SSA, and spherical vs. non-spherical particles. However, retrieval sensitivity varies enormously with scene conditions. So, for example, there is less information about aerosol type when the mid-visible aerosol optical depth (AOD) is less that about 0.15 or 0.2, or when the range of scattering angles observed is reduced by solar geometry, even though the quality of the AOD retrieval itself is much less sensitive to these factors. This presentation will review a series of studies aimed at assessing the capabilities, as well as the limitations, of MISR aerosol type retrievals involving wildfire smoke, desert dust, volcanic ash, and urban pollution, in specific cases where suborbital validation data are available. A synthesis of results, planned upgrades to the MISR Standard aerosol algorithm to improve aerosol type retrievals, and steps toward the development of an aerosol type quality flag for the Standard product, will also be covered.
Short-wave albedo of a pine forest
Energy Technology Data Exchange (ETDEWEB)
Kessler, A.
1985-06-01
In this paper nine years of continuous records of the short-wave albedo above a Scotch pine forest in middle Europe were analysed. Special emphasis was given to the dependencies of the albedo on its diurnal variation, its annual variation, the solar altitude, the structure of the stand, the cloud cover, the soil moisture and the spectral reflectance. A long-termed trend of the albedo could not be found, e.g. caused by the stand growth. Finally the annual variation of the albedo of the Scotch pine forest was compared with measurements above different surface types in middle Europe.
Verma, S.; Venkataraman, C.; Boucher, O.
2011-08-01
We examine the aerosol radiative effects due to aerosols emitted from different emission sectors (anthropogenic and natural) and originating from different geographical regions within and outside India during the northeast (NE) Indian winter monsoon (January-March). These studies are carried out through aerosol transport simulations in the general circulation (GCM) model of the Laboratoire de Météorologie Dynamique (LMD). The model estimates of aerosol single scattering albedo (SSA) show lower values (0.86-0.92) over the region north to 10°N comprising of the Indian subcontinent, Bay of Bengal, and parts of the Arabian Sea compared to the region south to 10°N where the estimated SSA values lie in the range 0.94-0.98. The model estimated SSA is consistent with the SSA values inferred through measurements on various platforms. Aerosols of anthropogenic origin reduce the incoming solar radiation at the surface by a factor of 10-20 times the reduction due to natural aerosols. At the top-of-atmosphere (TOA), aerosols from biofuel use cause positive forcing compared to the negative forcing from fossil fuel and natural sources in correspondence with the distribution of SSA which is estimated to be the lowest (0.7-0.78) from biofuel combustion emissions. Aerosols originating from India and Africa-west Asia lead to the reduction in surface radiation (-3 to -8 W m -2) by 40-60% of the total reduction in surface radiation due to all aerosols over the Indian subcontinent and adjoining ocean. Aerosols originating from India and Africa-west Asia also lead to positive radiative effects at TOA over the Arabian Sea, central India (CNI), with the highest positive radiative effects over the Bay of Bengal and cause either negative or positive effects over the Indo-Gangetic plain (IGP).
Validation of MCNP4A for repository scattered radiation analysis
International Nuclear Information System (INIS)
Haas, M.N.; Su, S.
1998-02-01
Comparison is made between experimentally determined albedo (scattered) radiation and MCNP4A predictions in order to provide independent validation for repository shielding analysis. Both neutron and gamma scattered radiation fields from concrete ducts are compared in this paper. Satisfactory agreement is found between actual and calculated results with conservative values calculated by the MCNP4A code for all conditions
MORSE/STORM: A generalized albedo option for Monte Carlo calculations
International Nuclear Information System (INIS)
Gomes, I.C.; Stevens, P.N.
1991-09-01
The advisability of using the albedo procedure for the Monte Carlo solution of deep penetration shielding problems that have ducts and other penetrations has been investigated. The use of albedo data can dramatically improve the computational efficiency of certain Monte Carlo calculations. However, the accuracy of these results may be unacceptable because of lost information during the albedo event and serious errors in the available differential albedo data. This study was done to evaluate and appropriately modify the MORSE/BREESE package, to develop new methods for generating the required albedo data, and to extend the adjoint capability to the albedo-modified calculations. Major modifications to MORSE/BREESE include an option to save for further use information that would be lost at the albedo event, an option to displace the point of emergence during an albedo event, and an option to use spatially dependent albedo data for both forward and adjoint calculations, which includes the point of emergence as a new random variable to be selected during an albedo event. The theoretical basis for using TORT-generated forward albedo information to produce adjuncton albedos was derived. The MORSE/STORM package was developed to perform both forward and adjoint modes of analysis using spatially dependent albedo data. Results obtained with MORSE/STORM for both forward and adjoint modes were compared with benchmark solutions. Excellent agreement and improved computational efficiency were achieved, demonstrating the full utilization of the albedo option in the MORSE code. 7 refs., 17 figs., 15 tabs
Light absorption and scattering by aggregates: Application to black carbon and snow grains
International Nuclear Information System (INIS)
Liou, K.N.; Takano, Y.; Yang, P.
2011-01-01
A geometric-optics surface-wave approach has been developed for the computation of light absorption and scattering by nonspherical particles for application to aggregates and snow grains with external and internal mixing structures. Aggregates with closed- (internal mixing) and open-cell configurations are constructed by means of stochastic procedures using homogeneous and core-shell spheres with smooth or rough surfaces as building blocks. The complex aggregate shape and composition can be accounted for by using the hit-and-miss Monte Carlo geometric photon tracing method. We develop an integral expression for diffraction by randomly oriented aggregates based on Babinet's principle and a photon-number weighted geometric cross section. With reference to surface-wave contributions originally developed for spheres, we introduce a nonspherical correction factor using a non-dimensional volume parameter such that it is 1 for spheres and 0 for elongated particles. The extinction efficiency, single-scattering albedo, and asymmetry factor results for randomly oriented columns and plates compare reasonably well with those determined from the finite-difference time domain (FDTD) and the discrete dipole approximation (DDA) computer codes for size parameters up to about 20. The present theoretical approach covers all size ranges and is particularly attractive from the perspective of efficient light absorption and scattering calculations for complex particle shape and inhomogeneous composition. We show that under the condition of equal volume and mass, the closed-cell configuration has larger absorption than its open-cell counterpart for both ballistic and diffusion-limited aggregates. Because of stronger absorption in the closed-cell case, most of the scattered energy is confined to forward directions, leading to a larger asymmetry factor than the open-cell case. Additionally, light absorption for randomly oriented snowflakes is similar to that of their spherical counterparts
Quantifying the ice-albedo feedback through decoupling
Kravitz, B.; Rasch, P. J.
2017-12-01
The ice-albedo feedback involves numerous individual components, whereby warming induces sea ice melt, inducing reduced surface albedo, inducing increased surface shortwave absorption, causing further warming. Here we attempt to quantify the sea ice albedo feedback using an analogue of the "partial radiative perturbation" method, but where the governing mechanisms are directly decoupled in a climate model. As an example, we can isolate the insulating effects of sea ice on surface energy and moisture fluxes by allowing sea ice thickness to change but fixing Arctic surface albedo, or vice versa. Here we present results from such idealized simulations using the Community Earth System Model in which individual components are successively fixed, effectively decoupling the ice-albedo feedback loop. We isolate the different components of this feedback, including temperature change, sea ice extent/thickness, and air-sea exchange of heat and moisture. We explore the interactions between these different components, as well as the strengths of the total feedback in the decoupled feedback loop, to quantify contributions from individual pieces. We also quantify the non-additivity of the effects of the components as a means of investigating the dominant sources of nonlinearity in the ice-albedo feedback.
Zhou, L.; Gong, Z. R.; Liu, Y. X.; Sun, C. P.; Nori, F.
2010-03-01
We analyze the coherent transport of a single photon, which propagates in a one-dimensional coupled-resonator waveguide and is scattered by a controllable two-level system located inside one of the resonators of this waveguide. Our approach, which uses discrete coordinates, unifies low and high energy effective theories for single-photon scattering. We show that the controllable two-level system can behave as a quantum switch for the coherent transport of a single photon. This study may inspire new electro-optical single-photon quantum devices. We also suggest an experimental setup based on superconducting transmission line resonators and qubits. References: L. Zhou, Z.R. Gong, Y.X. Liu, C.P. Sun, F. Nori, Controllable scattering of photons inside a one-dimensional resonator waveguide, Phys. Rev. Lett. 101, 100501 (2008). L. Zhou, H. Dong, Y.X. Liu, C.P. Sun, F. Nori, Quantum super-cavity with atomic mirrors, Phys. Rev. A 78, 063827 (2008).
Theoretical White Dwarf Spectra on Demand: TheoSSA
Ringat, E.; Rauch, T.
2010-11-01
In the last decades, a lot of progress was made in spectral analysis. The quality (e.g. resolution, S/N ratio) of observed spectra has improved much and several model-atmosphere codes were developed. One of these is the ``Tübingen NLTE Model-Atmosphere Package'' (TMAP), that is a highly developed program for the calculation of model atmospheres of hot, compact objects. In the framework of the German Astrophysical Virtual Observatory (GAVO), theoretical spectral energy distributions (SEDs) can be downloaded via TheoSSA. In a pilot phase, TheoSSA is based on TMAP model atmospheres. We present the current state of this VO service.
Factors affecting polyamide prototypes design of Albedo dosemeters
International Nuclear Information System (INIS)
Martins, M.M.; Mauricio, C.L.P.; Fonseca, E.S.
1996-01-01
This work studies the most important factors which affect the response of albedo neutron dosemeters containing LiF TLDs with the aim to improve their sensitivity. It includes tests of thickness and shape of the polyamide moderator body prototypes, albedo window diameter and TLD position inside the moderator. Analyzing the results, an albedo neutron dosemeter prototype, B 4 C covered, was developed. The prototype has a response three times higher than the albedo dosemeter now in use in Brazil. (author)
Y. Liu; W. Wu; M. P. Jensen; T. Toto
2011-01-01
This paper focuses on three interconnected topics: (1) quantitative relationship between surface shortwave cloud radiative forcing, cloud fraction, and cloud albedo; (2) surfaced-based approach for measuring cloud albedo; (3) multiscale (diurnal, annual and inter-annual) variations and covariations of surface shortwave cloud radiative forcing, cloud fraction, and cloud albedo. An analytical expression is first derived to quantify the relationship between cloud radiative forcing, cloud fractio...
Role of electron-electron scattering on spin transport in single layer graphene
Directory of Open Access Journals (Sweden)
Bahniman Ghosh
2014-01-01
Full Text Available In this work, the effect of electron-electron scattering on spin transport in single layer graphene is studied using semi-classical Monte Carlo simulation. The D’yakonov-P’erel mechanism is considered for spin relaxation. It is found that electron-electron scattering causes spin relaxation length to decrease by 35% at 300 K. The reason for this decrease in spin relaxation length is that the ensemble spin is modified upon an e-e collision and also e-e scattering rate is greater than phonon scattering rate at room temperature, which causes change in spin relaxation profile due to electron-electron scattering.
TiSSA eelkonverents doktorantidele Tallinnas / Koidu Saame
Saame, Koidu
2010-01-01
Tallinna Ülikoolis toimunud TiSSA doktorantide eelkonverentsist 22.-24. aug. 2010.a. Doktorantide ettekannetest. Esinesid: Hans-Uwe Otto, Andriy Yuryev, Tiina Naarits, Ivar Tröner, Koidu Saame, Maija Jäppinen, Janissa Miettinen
BOREAS TE-01 SSA Soil Lab Data
National Aeronautics and Space Administration — ABSTRACT: This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil...
Surface albedo influences climate by affecting the amount of solar radiation that is reflected at the Earth’s surface, and surface albedo is, in turn, affected by land cover. General Circulation Models typically use modeled or prescribed albedo to assess the influence of land co...
Generalized Calibration of the Polarimetric Albedo Scale of Asteroids
Lupishko, D. F.
2018-03-01
Six different calibrations of the polarimetric albedo scale of asteroids have been published so far. Each of them contains its particular random and systematic errors and yields its values of geometric albedo. On the one hand, this complicates their analysis and comparison; on the other hand, it becomes more and more difficult to decide which of the proposed calibrations should be used. Moreover, in recent years, new databases on the albedo of asteroids obtained from the radiometric surveys of the sky with the orbital space facilities (the InfraRed Astronomical Satellite (IRAS), the Japanese astronomical satellite AKARI (which means "light"), the Wide-field Infrared Survey Explorer (WISE), and the Near-Earth Object Wide-field Survey Explorer (NEOWISE)) have appeared; and the database on the diameters and albedos of asteroids obtained from their occultations of stars has substantially increased. Here, we critically review the currently available calibrations and propose a new generalized calibration derived from the interrelations between the slope h and the albedo and between P min and the albedo. This calibration is based on all of the available series of the asteroid albedos and the most complete data on the polarization parameters of asteroids. The generalized calibration yields the values of the polarimetric albedo of asteroids in the system unified with the radiometric albedos and the albedos obtained from occultations of stars by asteroids. This, in turn, removes the difficulties in their comparison, joint analysis, etc.
An Optimal-Estimation-Based Aerosol Retrieval Algorithm Using OMI Near-UV Observations
Jeong, U; Kim, J.; Ahn, C.; Torres, O.; Liu, X.; Bhartia, P. K.; Spurr, R. J. D.; Haffner, D.; Chance, K.; Holben, B. N.
2016-01-01
An optimal-estimation(OE)-based aerosol retrieval algorithm using the OMI (Ozone Monitoring Instrument) near-ultraviolet observation was developed in this study. The OE-based algorithm has the merit of providing useful estimates of errors simultaneously with the inversion products. Furthermore, instead of using the traditional lookup tables for inversion, it performs online radiative transfer calculations with the VLIDORT (linearized pseudo-spherical vector discrete ordinate radiative transfer code) to eliminate interpolation errors and improve stability. The measurements and inversion products of the Distributed Regional Aerosol Gridded Observation Network campaign in northeast Asia (DRAGON NE-Asia 2012) were used to validate the retrieved aerosol optical thickness (AOT) and single scattering albedo (SSA). The retrieved AOT and SSA at 388 nm have a correlation with the Aerosol Robotic Network (AERONET) products that is comparable to or better than the correlation with the operational product during the campaign. The OEbased estimated error represented the variance of actual biases of AOT at 388 nm between the retrieval and AERONET measurements better than the operational error estimates. The forward model parameter errors were analyzed separately for both AOT and SSA retrievals. The surface reflectance at 388 nm, the imaginary part of the refractive index at 354 nm, and the number fine-mode fraction (FMF) were found to be the most important parameters affecting the retrieval accuracy of AOT, while FMF was the most important parameter for the SSA retrieval. The additional information provided with the retrievals, including the estimated error and degrees of freedom, is expected to be valuable for relevant studies. Detailed advantages of using the OE method were described and discussed in this paper.
BOREAS TE-01 SSA Soil Lab Data
National Aeronautics and Space Administration — This data set provides a set of soil properties for the SSA. The soil samples were collected at sets of soil pits. Major soil properties include soil horizon; dry...
Non-traditional Sensor Tasking for SSA: A Case Study
Herz, A.; Herz, E.; Center, K.; Martinez, I.; Favero, N.; Clark, C.; Therien, W.; Jeffries, M.
Industry has recognized that maintaining SSA of the orbital environment going forward is too challenging for the government alone. Consequently there are a significant number of commercial activities in various stages of development standing-up novel sensors and sensor networks to assist in SSA gathering and dissemination. Use of these systems will allow government and military operators to focus on the most sensitive space control issues while allocating routine or lower priority data gathering responsibility to the commercial side. The fact that there will be multiple (perhaps many) commercial sensor capabilities available in this new operational model begets a common access solution. Absent a central access point to assert data needs, optimized use of all commercial sensor resources is not possible and the opportunity for coordinated collections satisfying overarching SSA-elevating objectives is lost. Orbit Logic is maturing its Heimdall Web system - an architecture facilitating “data requestor” perspectives (allowing government operations centers to assert SSA data gathering objectives) and “sensor operator” perspectives (through which multiple sensors of varying phenomenology and capability are integrated via machine -machine interfaces). When requestors submit their needs, Heimdall’s planning engine determines tasking schedules across all sensors, optimizing their use via an SSA-specific figure-of-merit. ExoAnalytic was a key partner in refining the sensor operator interfaces, working with Orbit Logic through specific details of sensor tasking schedule delivery and the return of observation data. Scant preparation on both sides preceded several integration exercises (walk-then-run style), which culminated in successful demonstration of the ability to supply optimized schedules for routine public catalog data collection – then adapt sensor tasking schedules in real-time upon receipt of urgent data collection requests. This paper will provide a
Shintake, Tsumoru
2008-10-01
The number of photons produced by coherent x-ray scattering from a single biomolecule is very small because of its extremely small elastic-scattering cross section and low damage threshold. Even with a high x-ray flux of 3 x 10;{12} photons per 100-nm -diameter spot and an ultrashort pulse of 10 fs driven by a future x-ray free electron laser (x-ray FEL), it has been predicted that only a few 100 photons will be produced from the scattering of a single lysozyme molecule. In observations of scattered x rays on a detector, the transfer of energy from wave to matter is accompanied by the quantization of the photon energy. Unfortunately, x rays have a high photon energy of 12 keV at wavelengths of 1A , which is required for atomic resolution imaging. Therefore, the number of photoionization events is small, which limits the resolution of imaging of a single biomolecule. In this paper, I propose a method: instead of directly observing the photons scattered from the sample, we amplify the scattered waves by superimposing an intense coherent reference pump wave on it and record the resulting interference pattern on a planar x-ray detector. Using a nanosized gold particle as a reference pump wave source, we can collect 10;{4}-10;{5} photons in single shot imaging where the signal from a single biomolecule is amplified and recorded as two-dimensional diffraction intensity data. An iterative phase retrieval technique can be used to recover the phase information and reconstruct the image of the single biomolecule and the gold particle at the same time. In order to precisely reconstruct a faint image of the single biomolecule in Angstrom resolution, whose intensity is much lower than that of the bright gold particle, I propose a technique that combines iterative phase retrieval on the reference pump wave and the digital Fourier transform holography on the sample. By using a large number of holography data, the three-dimensional electron density map can be assembled.
SURFACE ALBEDO AND SPECTRAL VARIABILITY OF CERES
Energy Technology Data Exchange (ETDEWEB)
Li, Jian-Yang; Reddy, Vishnu; Corre, Lucille Le; Sykes, Mark V.; Prettyman, Thomas H. [Planetary Science Institute, 1700 E. Ft. Lowell Road, Suite 106, Tucson, AZ 85719 (United States); Nathues, Andreas; Hoffmann, Martin; Schaefer, Michael [Max Planck Institute for Solar System Research, Göttingen (Germany); Izawa, Matthew R. M.; Cloutis, Edward A. [University of Winnipeg, Winnipeg, Manitoba (Canada); Carsenty, Uri; Jaumann, Ralf; Krohn, Katrin; Mottola, Stefano; Schröder, Stefan E. [German Aerospace Center (DLR), Institute of Planetary Research, Berlin (Germany); Castillo-Rogez, Julie C. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Schenk, Paul [Lunar and Planetary Institute, Houston, TX 77058 (United States); Williams, David A. [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States); Smith, David E. [Solar System Exploration Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Zuber, Maria T. [Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); and others
2016-02-01
Previous observations suggested that Ceres has active, but possibly sporadic, water outgassing as well as possibly varying spectral characteristics over a timescale of months. We used all available data of Ceres collected in the past three decades from the ground and the Hubble Space Telescope, as well as the newly acquired images by the Dawn Framing Camera, to search for spectral and albedo variability on Ceres, on both a global scale and in local regions, particularly the bright spots inside the Occator crater, over timescales of a few months to decades. Our analysis has placed an upper limit on the possible temporal albedo variation on Ceres. Sporadic water vapor venting, or any possibly ongoing activity on Ceres, is not significant enough to change the albedo or the area of the bright features in the Occator crater by >15%, or the global albedo by >3% over the various timescales that we searched. Recently reported spectral slope variations can be explained by changing Sun–Ceres–Earth geometry. The active area on Ceres is less than 1 km{sup 2}, too small to cause global albedo and spectral variations detectable in our data. Impact ejecta due to impacting projectiles of tens of meters in size like those known to cause observable changes to the surface albedo on Asteroid Scheila cannot cause detectable albedo change on Ceres due to its relatively large size and strong gravity. The water vapor activity on Ceres is independent of Ceres’ heliocentric distance, ruling out the possibility of the comet-like sublimation process as a possible mechanism driving the activity.
International Nuclear Information System (INIS)
Yang, J.; Kuikka, J.T.; Vanninen, E.; Laensimies, E.; Kauppinen, T.; Patomaeki, L.
1999-01-01
Photon scatter is one of the most important factors degrading the quantitative accuracy of SPECT images. Many scatter correction methods have been proposed. The single isotope method was proposed by us. Aim: We evaluate the scatter correction method of improving the quality of images by acquiring emission and transmission data simultaneously with single isotope scan. Method: To evaluate the proposed scatter correction method, a contrast and linearity phantom was studied. Four female patients with fibromyalgia (FM) syndrome and four with chronic back pain (BP) were imaged. Grey-to-cerebellum (G/C) and grey-to-white matter (G/W) ratios were determined by one skilled operator for 12 regions of interest (ROIs) in each subject. Results: The linearity of activity response was improved after the scatter correction (r=0.999). The y-intercept value of the regression line was 0.036 (p [de
Jo, D. S.; Park, R.; Kim, J.
2015-12-01
A nested version of 3-D chemical transport model (GEOS-Chem v9-01-02) is evaluated over East Asia during the Distributed Regional Aerosol Gridded Observation Networks (DRAGON)-Asia 2012 campaign period, focusing on fine-mode aerosol optical depth (fAOD) and single scattering albedo (SSA). Both are important to assess the effect of anthropogenic aerosols on climate. We compare the daily mean simulated optical properties of aerosols with the observations from DRAGON-Asia campaign for March-May, 2012 (provided in level 2.0: cloud screened and quality assured). We find that the model reproduces the observed daily variability of fAOD (R=0.67), but overestimates the magnitude by 30%, which is in general consistent with other global model comparisons from ACCMIP. However, a significant high bias in the model is found compared to the observed SSA at 440 nm, which is important for determining the sign of aerosol radiative forcing. In order to understand causes for this gap we conduct several sensitivity tests by changing source magnitudes and input parameters of aerosols, affecting the aerosol optical properties under various atmospheric conditions, which allows us to reduce the gap and to find the optimal values in the model.
Thermal neutron albedo measurements for multilithic reflectors
International Nuclear Information System (INIS)
Mehboob, Khurram; Ahmed, Raheel; Ali, Majid; Tabassam, Uzma
2013-01-01
Highlights: • Measurement of thermal neuron albedo for multilithic reflectors. • Modeling of experiments in MATLAB. • Comparison of numerical calculated and experimental values. • Study of thermal neutron albedo in different multilayered shielding. - Abstract: An experimental measurement of the thermal neutron (0.025 eV) albedo (αth) has been carried out for multilithic shielding by using Am–Be neutron source and BF 3 detector. The measured saturation value for the thermal albedo of paraffin wax has been found to be 0.734 ± 0.020, which is in close agreement to the corresponding value 0.83 quoted in the literature. The thermal neutron albedo has been measured for the multilayered shielding in copper–wood, copper–aluminum, wood–paraffin and paraffin–iron combinations in horizontal geometric configurations. Modeling and numerical simulation have been carried out by developing a MATLAB code which solves the diffusion equation in order to calculate the experimental results. Good agreement has been found between the numerical calculated and experimental results. The uncertainties in the measurements have also been calculated based on error propagation of the underlying Poisson distribution
The New Global Gapless GLASS Albedo Product from 1981 to 2014
Dou, B.; Liu, Q.; Qu, Y.; Wang, L.; Feng, Y.; Nie, A.; Li, X.; Zhang, J.; Niu, H.; Cai, E.; Zhao, L.
2016-12-01
Long-time series and various spatial resolution albedo products are needed for climate change and environmental studies at both global and regional scale. To meet these requirements, GLASS (Global LAnd Surface Satellites) gapless albedo product from 1981 to 2010 was firstly released in 2012 and widely used in long-term earth change researches. However, only shortwave albedo product in spatial resolution of 0.05 degree and 1 km were provided, which limits extensive applications for visible and near-infrared bands. Thus, new GLASS albedo product are produced and comprehensively enhanced in time series, algorithm and product content. Five major updates are conducted: 1) Time region is expanded from 1981-2010 to 1981-2014; 2) Physically ART (radiative transfer theory) and TCOWA (Three-Component Ocean Water Albedo) models rather than previous RTLSR (Rose-Thick Li-Sparse Reciprocal kernel combination) model are adopted for snow and inland water albedo estimation, respectively; 3) global shortwave, visible, and near-infrared albedos in spatial resolution of 0.05 degree and 1 km are released; 4) Clear-sky albedo is provided beyond the traditional black-sky albedo and white sky-albedo for amateurish user; 5) 250 m albedo product is provided in part of global for regional application. In this study, we firstly detail the updates of this inspiring product. Then the product is compared with the previous GLASS albedo product and preliminary assessed against field measurements under various land covers. Significant improvements are reported for snow and water albedo. The results demonstrate that the new GLASS albedo product is a gapless, long-term continuous, and self-consistent data-set. Comparing to previous GLASS albedo product, lower black-sky albedo and higher white-sky albedo are proved for permanent snow-cover region. Moreover, higher albedo of inland water and seasonal snow-cover mountain are captured. This product brings new chance and view to understanding long
Resonance estimates for single spin asymmetries in elastic electron-nucleon scattering
International Nuclear Information System (INIS)
Barbara Pasquini; Marc Vanderhaeghen
2004-01-01
We discuss the target and beam normal spin asymmetries in elastic electron-nucleon scattering which depend on the imaginary part of two-photon exchange processes between electron and nucleon. We express this imaginary part as a phase space integral over the doubly virtual Compton scattering tensor on the nucleon. We use unitarity to model the doubly virtual Compton scattering tensor in the resonance region in terms of γ* N → π N electroabsorption amplitudes. Taking those amplitudes from a phenomenological analysis of pion electroproduction observables, we present results for beam and target normal single spin asymmetries for elastic electron-nucleon scattering for beam energies below 1 GeV and in the 1-3 GeV region, where several experiments are performed or are in progress
International Nuclear Information System (INIS)
Sohrabi, M.; Katouzi, M.
1992-01-01
The response of the AEOI Neutriran Albedo Neutron Personnel Dosemeter (NANPD) which can also be used for other albedo dosemeter types was determined on 18 different phantom configurations. The effects of type, geometry, material, thickness, dosemeter-to-phantom angle in particular with the presence of legs were investigated using a Pu-Be neutron source. It was concluded that the slab phantoms (single or double) and circular and elliptical cylinder phantoms seemed to provide a better response, whereas the ICRU sphere geometry does not seem to be appropriate for the calibration of albedo dosemeters. It is interesting to note that the presence of legs maintains the constancy of the response in a situation when a radiation worker bends down during work. (author)
Dang, Cheng; Brandt, Richard E.; Warren, Stephen G.
2015-06-01
The reduction of snow spectral albedo by black carbon (BC) and mineral dust, both alone and in combination, is computed using radiative transfer modeling. Broadband albedo is shown for mass fractions covering the full range from pure snow to pure BC and pure dust, and for snow grain radii from 5 µm to 2500 µm, to cover the range of possible grain sizes on planetary surfaces. Parameterizations are developed for opaque homogeneous snowpacks for three broad bands used in general circulation models and several narrower bands. They are functions of snow grain radius and the mass fraction of BC and/or dust and are valid up to BC content of 10 ppm, needed for highly polluted snow. A change of solar zenith angle can be mimicked by changing grain radius. A given mass fraction of BC causes greater albedo reduction in coarse-grained snow; BC and grain radius can be combined into a single variable to compute the reduction of albedo relative to pure snow. The albedo reduction by BC is less if the snow contains dust, a common situation on mountain glaciers and in agricultural and grazing lands. Measured absorption spectra of mineral dust are critically reviewed as a basis for specifying dust properties for modeling. The effect of dust on snow albedo at visible wavelengths can be represented by an "equivalent BC" amount, scaled down by a factor of about 200. Dust has little effect on the near-IR albedo because the near-IR albedo of pure dust is similar to that of pure snow.
Single Crystal Diffuse Neutron Scattering
Directory of Open Access Journals (Sweden)
Richard Welberry
2018-01-01
Full Text Available Diffuse neutron scattering has become a valuable tool for investigating local structure in materials ranging from organic molecular crystals containing only light atoms to piezo-ceramics that frequently contain heavy elements. Although neutron sources will never be able to compete with X-rays in terms of the available flux the special properties of neutrons, viz. the ability to explore inelastic scattering events, the fact that scattering lengths do not vary systematically with atomic number and their ability to scatter from magnetic moments, provides strong motivation for developing neutron diffuse scattering methods. In this paper, we compare three different instruments that have been used by us to collect neutron diffuse scattering data. Two of these are on a spallation source and one on a reactor source.
International Nuclear Information System (INIS)
Stark, Julian; Rothe, Thomas; Kienle, Alwin; Kieß, Steffen; Simon, Sven
2016-01-01
Single cell nuclei were investigated using two-dimensional angularly and spectrally resolved scattering microscopy. We show that even for a qualitative comparison of experimental and theoretical data, the standard Mie model of a homogeneous sphere proves to be insufficient. Hence, an accelerated finite-difference time-domain method using a graphics processor unit and domain decomposition was implemented to analyze the experimental scattering patterns. The measured cell nuclei were modeled as single spheres with randomly distributed spherical inclusions of different size and refractive index representing the nucleoli and clumps of chromatin. Taking into account the nuclear heterogeneity of a large number of inclusions yields a qualitative agreement between experimental and theoretical spectra and illustrates the impact of the nuclear micro- and nanostructure on the scattering patterns. (paper)
Stark, Julian; Rothe, Thomas; Kieß, Steffen; Simon, Sven; Kienle, Alwin
2016-04-07
Single cell nuclei were investigated using two-dimensional angularly and spectrally resolved scattering microscopy. We show that even for a qualitative comparison of experimental and theoretical data, the standard Mie model of a homogeneous sphere proves to be insufficient. Hence, an accelerated finite-difference time-domain method using a graphics processor unit and domain decomposition was implemented to analyze the experimental scattering patterns. The measured cell nuclei were modeled as single spheres with randomly distributed spherical inclusions of different size and refractive index representing the nucleoli and clumps of chromatin. Taking into account the nuclear heterogeneity of a large number of inclusions yields a qualitative agreement between experimental and theoretical spectra and illustrates the impact of the nuclear micro- and nanostructure on the scattering patterns.
Hydraulic and mechanical behavior of landfill clay liner containing SSA in contact with leachate.
Zhang, Qian; Lu, Haijun; Liu, Junzhu; Wang, Weiwei; Zhang, Xiong
2018-05-01
Sewage sludge ash (SSA) produced by municipal sludge can be used as a modified additive for clay liner, and improves the working performance of landfill clay liner in contact with leachate. Under the action of landfill leachate, the permeability, shear strength, phase composition, and pore structure of the modified clay are investigated through the flexible wall permeability test, triaxial shear test, thermal gravimetric and differential thermal analysis, and low-temperature nitrogen adsorption test, respectively. The hydraulic conductivity of the modified clay containing 0-5% SSA is in the range of 3.94 × 10 -8 -1.16 × 10 -7 cm/s, and the pollutant concentration of the sample without SSA was higher than others. The shear strength of the modified clay is more than that of the traditional clay liner, the cohesion rate of modified clay increases from 32.5 to 199.91 kPa, and the internal friction angle decreases from 32.5° to 15.6°. Furthermore, the weight loss rates of the samples are 15.69%, 17.92%, 18.06%, and 20.68%, respectively, when the SSA content increases from 0% to 5%. The total pore volume and average pore diameter of the modified clay decrease with the increase in the SSA content, respectively. However, the specific area of the modified clay increases with the increase in the SSA content.
Simulations of tropical rainforest albedo: is canopy wetness important?
Directory of Open Access Journals (Sweden)
Silvia N.M. Yanagi
Full Text Available Accurate information on surface albedo is essential for climate modelling, especially for regions such as Amazonia, where the response of the regional atmospheric circulation to the changes on surface albedo is strong. Previous studies have indicated that models are still unable to correctly reproduce details of the seasonal variation of surface albedo. Therefore, it was investigated the role of canopy wetness on the simulated albedo of a tropical rainforest by modifying the IBIS canopy radiation transfer code to incorporate the effects of canopy wetness on the vegetation reflectance. In this study, simulations were run using three versions of the land surface/ecosystem model IBIS: the standard version, the same version recalibrated to fit the data of albedo on tropical rainforests and a modified version that incorporates the effects of canopy wetness on surface albedo, for three sites in the Amazon forest at hourly and monthly scales. The results demonstrated that, at the hourly time scale, the incorporation of canopy wetness on the calculations of radiative transfer substantially improves the simulations results, whereas at the monthly scale these changes do not substantially modify the simulated albedo.
Albedo of the ice covered Weddell and Bellingshausen Seas
A. I. Weiss; J. C. King; T. A. Lachlan-Cope; R. S. Ladkin
2012-01-01
This study investigates the surface albedo of the sea ice areas adjacent to the Antarctic Peninsula during the austral summer. Aircraft measurements of the surface albedo, which were conducted in the sea ice areas of the Weddell and Bellingshausen Seas show significant differences between these two regions. The averaged surface albedo varied between 0.13 and 0.81. The ice cover of the Bellingshausen Sea consisted mainly of first year ice and the sea surface showed an averaged sea ice albedo o...
Surface albedo measurements in Mexico City metropolitan area
Energy Technology Data Exchange (ETDEWEB)
Castro, T; Mar, B; Longoria, R; Ruiz Suarez, L. G [Centro de Ciencias de la Atmosfera, UNAM, Mexico, D.F. (Mexico); Morales, L [Instituto de Geografia, UNAM, Mexico, D.F. (Mexico)
2001-04-01
Optical and thermal properties of soils are important input data for the meteorological and photochemical modules of air quality models. As development of these models increase on spatial resolution good albedo data become more important. In this paper measurements of surface albedo of UV (295-385 nm) and visible (450-550 nm) radiation are reported for different urban and rural surfaces in the vicinity of Mexico City. It was found for the downtown zone and average albedo value of 0.05 which is in very good agreement with reported values for urban surfaces. Our albedo values measured in UV region for grey cement and green grass are of 0.10 and 0.009, respectively, and quite similar to those found at the literature of 0.11 and 0.008 for those type of surfaces. [Spanish] Las propiedades opticas y termicas de suelos son datos importantes para los modulos meteorologicos y fotoquimicos de los modelos de calidad del aire. Conforme aumenta la resolucion espacial del modelo se vuelve mas importante contar con buenos datos de albedo. En este articulo se presentan mediciones de albedo superficial de radiacion Ultravioleta (295-385 nm) y visible (450-550 nm) para diferentes superficies urbanas. Los valores medidos de albedo en la region UV para cemento gris y pasto verde son de 0.10 y 0.009, respectivamente, y son muy similares a los reportados en la literatura, 0.11 y 0.008 para este tipo de superficies.
Evaluation of coarse scale land surface remote sensing albedo product over rugged terrain
Wen, J.; Xinwen, L.; You, D.; Dou, B.
2017-12-01
Satellite derived Land surface albedo is an essential climate variable which controls the earth energy budget and it can be used in applications such as climate change, hydrology, and numerical weather prediction. The accuracy and uncertainty of surface albedo products should be evaluated with a reliable reference truth data prior to applications. And more literatures investigated the validation methods about the albedo validation in a flat or homogenous surface. However, the albedo performance over rugged terrain is still unknow due to the validation method limited. A multi-validation strategy is implemented to give a comprehensive albedo validation, which will involve the high resolution albedo processing, high resolution albedo validation based on in situ albedo, and the method to upscale the high resolution albedo to a coarse scale albedo. Among them, the high resolution albedo generation and the upscale method is the core step for the coarse scale albedo validation. In this paper, the high resolution albedo is generated by Angular Bin algorithm. And a albedo upscale method over rugged terrain is developed to obtain the coarse scale albedo truth. The in situ albedo located 40 sites in mountain area are selected globally to validate the high resolution albedo, and then upscaled to the coarse scale albedo by the upscale method. This paper takes MODIS and GLASS albedo product as a example, and the prelimarily results show the RMSE of MODIS and GLASS albedo product over rugged terrain are 0.047 and 0.057, respectively under the RMSE with 0.036 of high resolution albedo.
BOREAS TF-01 SSA-OA Soil Characteristics Data
National Aeronautics and Space Administration — Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil respiration,...
BOREAS TF-01 SSA-OA Soil Characteristics Data
National Aeronautics and Space Administration — ABSTRACT: Data collected in support of the effort to characterize and interpret soil information at the SSA-OA tower site in 1994. Data collected include soil...
Arnott, W. P.; Miranda, G. P.; Gaffney, J. S.; Marley, N. A.
2007-05-01
Four photoacoustic spectrometers (PAS) for aerosol light scattering and absorption measurements were deployed in and near Mexico City in March 2006 as part of the Megacity Impacts on Regional and Global Environments (MIRAGE). The four sites included: an urban site at Instituto Mexicano del Petroleo (Mexican Oil Institute, denoted by IMP); a suburban site at the Technological University of Tecamac; a rural site at "La Biznaga" ranch; and a site at the Paseo de Cortes (altitude 3,810 meters ASL) in the rural area above Amecameca in the State of Mexico, on the saddle between the volcanoes Popocatepetl and Iztaccihuatl. A similar campaign was held in Las Vegas, Nevada, USA in January-February, 2003. The IMP site gave in-situ characterization of the Mexico City plume under favorable wind conditions while the other sites provided characterization of the plume, mixed in with any local sources. The second and third sites are north of Mexico City, and the fourth site is south. The PAS used at IMP operates at 532 nm, and conveniently allowed for characterization of gaseous absorption at this wavelength as well. Instruments at the second and third sites operate at 870 nm, and the one at the fourth site at 780 nm. Light scattering measurements are accomplished within the PAS by the reciprocal nephelometery method. In the urban site the aerosol absorption coefficient typically varies between 20 and 180 Mm-1 during the course of the day and significant diurnal variation of the aerosol single scattering albedo was observed probably as a consequence of secondary aerosol formation. Comparisons with TSI nephelometer scattering at the T0 site will be presented. We will present the diurnal variation of the scattering and absorption as well as the single scattering albedo and fraction of absorption due to gases at the IMP site and compare with Las Vegas diurnal variation. Mexico City 'breaths' more during the course of the day than Las Vegas, Nevada in part because the latitude of
Single- and coupled-channel radial inverse scattering with supersymmetric transformations
International Nuclear Information System (INIS)
Baye, Daniel; Sparenberg, Jean-Marc; Pupasov-Maksimov, Andrey M; Samsonov, Boris F
2014-01-01
The present status of the three-dimensional inverse-scattering method with supersymmetric transformations is reviewed for the coupled-channel case. We first revisit in a pedagogical way the single-channel case, where the supersymmetric approach is shown to provide a complete, efficient and elegant solution to the inverse-scattering problem for the radial Schrödinger equation with short-range interactions. A special emphasis is put on the differences between conservative and non-conservative transformations, i.e. transformations that do or do not conserve the behaviour of solutions of the radial Schrödinger equation at the origin. In particular, we show that for the zero initial potential, a non-conservative transformation is always equivalent to a pair of conservative transformations. These single-channel results are illustrated on the inversion of the neutron–proton triplet eigenphase shifts for the S- and D-waves. We then summarize and extend our previous works on the coupled-channel case, i.e. on systems of coupled radial Schrödinger equations, and stress remaining difficulties and open questions of this problem by putting it in perspective with the single-channel case. We mostly concentrate on two-channel examples to illustrate general principles while keeping mathematics as simple as possible. In particular, we discuss the important difference between the equal-threshold and different-threshold problems. For equal thresholds, conservative transformations can provide non-diagonal Jost and scattering matrices. Iterations of such transformations in the two-channel case are studied and shown to lead to practical algorithms for inversion. A convenient particular technique where the mixing parameter can be fitted without modifying the eigenphases is developed with iterations of pairs of conjugate transformations. This technique is applied to the neutron–proton triplet S–D scattering matrix, for which exactly-solvable matrix potential models are constructed
Near-ground cooling efficacies of trees and high-albedo surfaces
Energy Technology Data Exchange (ETDEWEB)
Levinson, Ronnen M. [Univ. of California, Berkeley, CA (United States). Dept. of Mechanical Engineering
1997-05-01
Daytime summer urban heat islands arise when the prevalence of dark-colored surfaces and lack of vegetation make a city warmer than neighboring countryside. Two frequently-proposed summer heat island mitigation measures are to plant trees and to increase the albedo (solar reflectivity) of ground surfaces. This dissertation examines the effects of these measures on the surface temperature of an object near the ground, and on solar heating of air near the ground. Near-ground objects include people, vehicles, and buildings. The variation of the surface temperature of a near-ground object with ground albedo indicates that a rise in ground albedo will cool a near-ground object only if the object`s albedo exceeds a critical value. This critical value of object albedo depends on wind speed, object geometry, and the height of the atmospheric thermal boundary layer. It ranges from 0.15 to 0.37 for a person. If an object has typical albedo of 0.3, increasing the ground albedo by.
On geometric optics and surface waves for light scattering by spheres
International Nuclear Information System (INIS)
Liou, K.N.; Takano, Y.; Yang, P.
2010-01-01
A geometric optics approach including surface wave contributions has been developed for homogeneous and concentrically coated spheres. In this approach, a ray-by-ray tracing program was used for efficient computation of the extinction and absorption cross sections. The present geometric-optics surface-wave (GOS) theory for light scattering by spheres considers the surface wave contribution along the edge of a particle as a perturbation term to the geometric-optics core that includes Fresnel reflection-refraction and Fraunhofer diffraction. Accuracies of the GOS approach for spheres have been assessed through comparison with the results determined from the exact Lorenz-Mie (LM) theory in terms of the extinction efficiency, single-scattering albedo, and asymmetry factor in the size-wavelength ratio domain. In this quest, we have selected a range of real and imaginary refractive indices representative of water/ice and aerosol species and demonstrated close agreement between the results computed by GOS and LM. This provides the foundation to conduct physically reliable light absorption and scattering computations based on the GOS approach for aerosol aggregates associated with internal and external mixing states employing spheres as building blocks.
Intercomparison measurements with albedo neutron dosimeters
International Nuclear Information System (INIS)
Alberts, W.G.; Kluge, H.
1994-01-01
Since the introduction of the albedo dosimeter as the official personal neutron dosimeter the dosimetry services concerned have participated in intercomparison measurements at the PTB. Their albedo dosimeters were irradiated in reference fields produced by unmoderated and D 2 O-moderated 252 Cf neutron sources in the standard irradiation facility of the PTB. Six fields with fluences different in energy and angle distribution could be realised in order to determine the response of the albedo dosimeter. The dose equivalent values evaluated by the services were compared with the reference values of the PTB for the directional dose equivalent H'(10). The results turned out to be essentially dependent on the evaluation method and the choice of the calibration factors. (orig.) [de
Quantitative and Isolated Measurement of Far-Field Light Scattering by a Single Nanostructure
Kim, Donghyeong; Jeong, Kwang-Yong; Kim, Jinhyung; Ee, Ho-Seok; Kang, Ju-Hyung; Park, Hong-Gyu; Seo, Min-Kyo
2017-11-01
Light scattering by nanostructures has facilitated research on various optical phenomena and applications by interfacing the near fields and free-propagating radiation. However, direct quantitative measurement of far-field scattering by a single nanostructure on the wavelength scale or less is highly challenging. Conventional back-focal-plane imaging covers only a limited solid angle determined by the numerical aperture of the objectives and suffers from optical aberration and distortion. Here, we present a quantitative measurement of the differential far-field scattering cross section of a single nanostructure over the full hemisphere. In goniometer-based far-field scanning with a high signal-to-noise ratio of approximately 27.4 dB, weak scattering signals are efficiently isolated and detected under total-internal-reflection illumination. Systematic measurements reveal that the total and differential scattering cross sections of a Au nanorod are determined by the plasmonic Fabry-Perot resonances and the phase-matching conditions to the free-propagating radiation, respectively. We believe that our angle-resolved far-field measurement scheme provides a way to investigate and evaluate the physical properties and performance of nano-optical materials and phenomena.
ALBEDO PATTERN RECOGNITION AND TIME-SERIES ANALYSES IN MALAYSIA
Directory of Open Access Journals (Sweden)
S. A. Salleh
2012-07-01
Full Text Available Pattern recognition and time-series analyses will enable one to evaluate and generate predictions of specific phenomena. The albedo pattern and time-series analyses are very much useful especially in relation to climate condition monitoring. This study is conducted to seek for Malaysia albedo pattern changes. The pattern recognition and changes will be useful for variety of environmental and climate monitoring researches such as carbon budgeting and aerosol mapping. The 10 years (2000–2009 MODIS satellite images were used for the analyses and interpretation. These images were being processed using ERDAS Imagine remote sensing software, ArcGIS 9.3, the 6S code for atmospherical calibration and several MODIS tools (MRT, HDF2GIS, Albedo tools. There are several methods for time-series analyses were explored, this paper demonstrates trends and seasonal time-series analyses using converted HDF format MODIS MCD43A3 albedo land product. The results revealed significance changes of albedo percentages over the past 10 years and the pattern with regards to Malaysia's nebulosity index (NI and aerosol optical depth (AOD. There is noticeable trend can be identified with regards to its maximum and minimum value of the albedo. The rise and fall of the line graph show a similar trend with regards to its daily observation. The different can be identified in term of the value or percentage of rises and falls of albedo. Thus, it can be concludes that the temporal behavior of land surface albedo in Malaysia have a uniform behaviours and effects with regards to the local monsoons. However, although the average albedo shows linear trend with nebulosity index, the pattern changes of albedo with respects to the nebulosity index indicates that there are external factors that implicates the albedo values, as the sky conditions and its diffusion plotted does not have uniform trend over the years, especially when the trend of 5 years interval is examined, 2000 shows high
Early Spring Post-Fire Snow Albedo Dynamics in High Latitude Boreal Forests Using Landsat-8 OLI Data
Wang, Zhuosen; Erb, Angela M.; Schaaf, Crystal B.; Sun, Qingsong; Liu, Yan; Yang, Yun; Shuai, Yanmin; Casey, Kimberly A.; Roman, Miguel O.
2016-01-01
Taking advantage of the improved radiometric resolution of Landsat-8 OLI which, unlike previous Landsat sensors, does not saturate over snow, the progress of fire recovery progress at the landscape scale (less than 100 m) is examined. High quality Landsat-8 albedo retrievals can now capture the true reflective and layered character of snow cover over a full range of land surface conditions and vegetation densities. This new capability particularly improves the assessment of post-fire vegetation dynamics across low- to high-burn severity gradients in Arctic and boreal regions in the early spring, when the albedos during recovery show the greatest variation. We use 30 m resolution Landsat-8 surface reflectances with concurrent coarser resolution (500 m) MODIS high quality full inversion surface Bidirectional Reflectance Distribution Functions (BRDF) products to produce higher resolution values of surface albedo. The high resolution full expression shortwave blue sky albedo product performs well with an overall RMSE of 0.0267 between tower and satellite measures under both snow-free and snow-covered conditions. While the importance of post-fire albedo recovery can be discerned from the MODIS albedo product at regional and global scales, our study addresses the particular importance of early spring post-fire albedo recovery at the landscape scale by considering the significant spatial heterogeneity of burn severity, and the impact of snow on the early spring albedo of various vegetation recovery types. We found that variations in early spring albedo within a single MODIS gridded pixel can be larger than 0.6. Since the frequency and severity of wildfires in Arctic and boreal systems is expected to increase in the coming decades, the dynamics of albedo in response to these rapid surface changes will increasingly impact the energy balance and contribute to other climate processes and physical feedback mechanisms. Surface radiation products derived from Landsat-8 data will
Crump, Katie E; Bainbridge, Brian; Brusko, Sarah; Turner, Lauren S; Ge, Xiuchun; Stone, Victoria; Xu, Ping; Kitten, Todd
2014-06-01
Streptococcus sanguinis colonizes teeth and is an important cause of infective endocarditis. Our prior work showed that the lipoprotein SsaB is critical for S. sanguinis virulence for endocarditis and belongs to the LraI family of conserved metal transporters. In this study, we demonstrated that an ssaB mutant accumulates less manganese and iron than its parent. A mutant lacking the manganese-dependent superoxide dismutase, SodA, was significantly less virulent than wild-type in a rabbit model of endocarditis, but significantly more virulent than the ssaB mutant. Neither the ssaB nor the sodA mutation affected sensitivity to phagocytic killing or efficiency of heart valve colonization. Animal virulence results for all strains could be reproduced by growing bacteria in serum under physiological levels of O(2). SodA activity was reduced, but not eliminated in the ssaB mutant in serum and in rabbits. Growth of the ssaB mutant in serum was restored upon addition of Mn(2+) or removal of O(2). Antioxidant supplementation experiments suggested that superoxide and hydroxyl radicals were together responsible for the ssaB mutant's growth defect. We conclude that manganese accumulation mediated by the SsaB transport system imparts virulence by enabling cell growth in oxygen through SodA-dependent and independent mechanisms. © 2014 John Wiley & Sons Ltd.
Takahashi, S; Kurita, Y; Ikeda, T; Miyamoto, M; Uemiya, S; Oumi, Y
2016-10-18
The synthesis of a novel layered silicate SSA-1 (SSA: silicate synthesized with a quaternary amine) was achieved in the SiO 2 -H 2 O-TEAOH (TEAOH: tetraethylammonium hydroxide - as an organic structural directing agent) system. The crystal structure of SSA-1 involved two silicate layers composed of bre [10T]-type CBU (Composite Building Unit) and TEAOH in interlayers. The topotactic transformation of SSA-1 by calcination was examined, resulting in a porous material (PML-1: porous material transformed from a layered silicate) with a 108 m 2 g -1 BET surface area and 0.035 cm 3 g -1 pore volume. PML-1 is a siliceous microporous material with silanols in the framework and possesses unique properties, such as hydrophilicity, in spite of all its silica composition. The most reasonable crystal structure of PML-1 was successfully determined on the basis of the crystal structure of SSA-1 by a combination of manual modelling, PXRD pattern simulation, DFT optimization and Rietveld analysis. Additionally, an interlayer expanded siliceous zeolite SSA-1 (IEZ-SSA-1) was also successfully prepared by silylation using trichloro(methyl)silane under acidic conditions. IEZ-SSA-1 showed hydrophilicity or hydrophobicity properties by changing the functional group of the pillar part in the interlayer. Additionally, IEZ-SSA-1 showed a large gas adsorption property (537 m 2 g -1 and 0.21 cm 3 g -1 ).
NEOWISE REACTIVATION MISSION YEAR TWO: ASTEROID DIAMETERS AND ALBEDOS
Energy Technology Data Exchange (ETDEWEB)
Nugent, C. R.; Cutri, R. M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Mainzer, A.; Bauer, J.; Kramer, E. A.; Masiero, J.; Sonnett, S. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Grav, T. [Planetary Science Institute, Tucson, AZ (United States); Wright, E. L., E-mail: cnugent@ipac.caltech.edu [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States)
2016-09-01
The Near-Earth Object Wide-Field Infrared Survey Explorer (NEOWISE) mission continues to detect, track, and characterize minor planets. We present diameters and albedos calculated from observations taken during the second year since the spacecraft was reactivated in late 2013. These include 207 near-Earth asteroids (NEAs) and 8885 other asteroids. Of the NEAs, 84% NEAs did not have previously measured diameters and albedos by the NEOWISE mission. Comparison of sizes and albedos calculated from NEOWISE measurements with those measured by occultations, spacecraft, and radar-derived shapes shows accuracy consistent with previous NEOWISE publications. Diameters and albedos fall within ±∼20% and ±∼40%, 1-sigma, respectively, of those measured by these alternate techniques. NEOWISE continues to preferentially discover near-Earth objects which are large (>100 m), and have low albedos.
Systematic Sustainability Assessment (SSA) Tool for Hydroelectric Project in Malaysia
Turan, Faiz Mohd; Johan, Kartina
2017-08-01
Sustainably developed and managed hydropower has enormous potential to contribute to global sustainability goals. It is known that hydroelectricity contributing small amounts to greenhouse gas emissions and other atmospheric pollutants. However, developing the remaining hydroelectric potential offers many challenges, and public pressure and expectations on the environmental and social performance of hydroelectric tend to increase over time. This paper aims to develop Systematic Sustainability Assessment (SSA) Tool that promotes and guides more sustainable hydroelectric projects in the context of Malaysia. The proposed SSA tool which not only provide a quality and quantitative report of sustainability performance but also act as Self-Assessment Report (SAR) to provide roadmap to achieve greater level of sustainability in project management for continuous improvement. It is expected to provide a common language that allow government, civil society, financial institutions and the hydroelectric sector to talk about and evaluate sustainability issues. The advantage of SSA tool is it can be used at any stage of hydroelectric development, from the earliest planning stages right through to operation.
Monte Carlo Modelling of Single-Crystal Diffuse Scattering from Intermetallics
Directory of Open Access Journals (Sweden)
Darren J. Goossens
2016-02-01
Full Text Available Single-crystal diffuse scattering (SCDS reveals detailed structural insights into materials. In particular, it is sensitive to two-body correlations, whereas traditional Bragg peak-based methods are sensitive to single-body correlations. This means that diffuse scattering is sensitive to ordering that persists for just a few unit cells: nanoscale order, sometimes referred to as “local structure”, which is often crucial for understanding a material and its function. Metals and alloys were early candidates for SCDS studies because of the availability of large single crystals. While great progress has been made in areas like ab initio modelling and molecular dynamics, a place remains for Monte Carlo modelling of model crystals because of its ability to model very large systems; important when correlations are relatively long (though still finite in range. This paper briefly outlines, and gives examples of, some Monte Carlo methods appropriate for the modelling of SCDS from metallic compounds, and considers data collection as well as analysis. Even if the interest in the material is driven primarily by magnetism or transport behaviour, an understanding of the local structure can underpin such studies and give an indication of nanoscale inhomogeneity.
Ramachandran, S; Srivastava, Rohit
2016-06-01
Mixing can influence the optical, physical, and chemical characteristics of aerosols, which in turn can modify their life cycle and radiative effects. Assumptions on the mixing state can lead to uncertain estimates of aerosol radiative effects. To examine the effect of mixing on the aerosol characteristics, and their influence on radiative effects, aerosol mixing states are determined over four environmentally distinct locations (Karachi, Gwangju, Osaka, and Singapore) in Asia, an aerosol hot spot region, using measured spectral aerosol optical properties and optical properties model. Aerosol optical depth (AOD), single scattering albedo (SSA), and asymmetry parameter (g) exhibit spectral, spatial, and temporal variations. Aerosol mixing states exhibit large spatial and temporal variations consistent with aerosol characteristics and aerosol type over each location. External mixing of aerosol species is unable to reproduce measured SSA over Asia, thus providing a strong evidence that aerosols exist in mixed state. Mineral dust (MD) (core)-Black carbon (BC) (shell) is one of the most preferred aerosol mixing states. Over locations influenced by biomass burning aerosols, BC (core)-water soluble (WS, shell) is a preferred mixing state, while dust gets coated by anthropogenic aerosols (BC, WS) over urban regions influenced by dust. MD (core)-sea salt (shell) mixing is found over Gwangju corroborating the observations. Aerosol radiative forcing exhibits large seasonal and spatial variations consistent with features seen in aerosol optical properties and mixing states. TOA forcing is less negative/positive for external mixing scenario because of lower SSA. Aerosol radiative forcing in Karachi is a factor of 2 higher when compared to Gwangju, Osaka, and Singapore. The influence of g on aerosol radiative forcing is insignificant. Results emphasize that rather than prescribing one single aerosol mixing state in global climate models regionally and temporally varying aerosol
Energy Technology Data Exchange (ETDEWEB)
Litaize, O
2000-07-01
The goal of this thesis is to study the neutron propagation by reflection from lacunar medium interfaces. The most efficient method to calculate this type of propagation is to use the concept of albedo. Actual version of NARCISSE code uses a simple formulation of angular differential albedos and so, can only treat single reflections. Multiple reflections treatment needs the knowledge of neutron spectrum after reflection. This energetic information is contained in double angular and energy differential albedos. The first step of this study consists to generate these albedos for various materials. Several methods have been tested and the Monte Carlo method was retained. A new estimator has been developed and validated in the Mote Carlo transport code TRIPOLI-4. It computes, during the simulation of the neutron history, the angular and energy reflection probability at each collision site. The second step consists to generate an interpolation scheme and albedo libraries for various materials. A new version of NARCISSE was developed to use these libraries and the interpolation module. Spectrum and dose rates comparisons were made between codes to validate these albedos. The neutron propagation by multiple reflections can be studied now, by using this new version of Narcisse. (author)
Energy Technology Data Exchange (ETDEWEB)
Litaize, O
2000-07-01
The goal of this thesis is to study the neutron propagation by reflection from lacunar medium interfaces. The most efficient method to calculate this type of propagation is to use the concept of albedo. Actual version of NARCISSE code uses a simple formulation of angular differential albedos and so, can only treat single reflections. Multiple reflections treatment needs the knowledge of neutron spectrum after reflection. This energetic information is contained in double angular and energy differential albedos. The first step of this study consists to generate these albedos for various materials. Several methods have been tested and the Monte Carlo method was retained. A new estimator has been developed and validated in the Mote Carlo transport code TRIPOLI-4. It computes, during the simulation of the neutron history, the angular and energy reflection probability at each collision site. The second step consists to generate an interpolation scheme and albedo libraries for various materials. A new version of NARCISSE was developed to use these libraries and the interpolation module. Spectrum and dose rates comparisons were made between codes to validate these albedos. The neutron propagation by multiple reflections can be studied now, by using this new version of Narcisse. (author)
International Nuclear Information System (INIS)
Litaize, O.
2000-01-01
The goal of this thesis is to study the neutron propagation by reflection from lacunar medium interfaces. The most efficient method to calculate this type of propagation is to use the concept of albedo. Actual version of NARCISSE code uses a simple formulation of angular differential albedos and so, can only treat single reflections. Multiple reflections treatment needs the knowledge of neutron spectrum after reflection. This energetic information is contained in double angular and energy differential albedos. The first step of this study consists to generate these albedos for various materials. Several methods have been tested and the Monte Carlo method was retained. A new estimator has been developed and validated in the Mote Carlo transport code TRIPOLI-4. It computes, during the simulation of the neutron history, the angular and energy reflection probability at each collision site. The second step consists to generate an interpolation scheme and albedo libraries for various materials. A new version of NARCISSE was developed to use these libraries and the interpolation module. Spectrum and dose rates comparisons were made between codes to validate these albedos. The neutron propagation by multiple reflections can be studied now, by using this new version of Narcisse. (author)
Do the Asian Drivers undermine the export-oriented industrialisation in SSA?
Kaplinsky, Raphael; Morris, Mike
2008-01-01
An increase in outward orientation in general, and in export-oriented manufacturing in particular is widely indicated as a suitable developmental path for SSA. The logic for this is drawn both from the demonstration effect of China and the earlier generation of Asian NICs, and from theory. However, the entry of China (and to a lesser extent India) into the global economy as a significant exporter of manufactures poses severe problems for export-oriented growth in SSA. This can be seen from SS...
Spectral Analysis within the Virtual Observatory: The GAVO Service TheoSSA
Ringat, E.
2012-03-01
In the last decade, numerous Virtual Observatory organizations were established. One of these is the German Astrophysical Virtual Observatory (GAVO) that e.g. provides access to spectral energy distributions via the service TheoSSA. In a pilot phase, these are based on the Tübingen NLTE Model-Atmosphere Package (TMAP) and suitable for hot, compact stars. We demonstrate the power of TheoSSA in an application to the sdOB primary of AA Doradus by comparison with a “classical” spectral analysis.
First experimental observation of double-photon Compton scattering using single gamma detector
International Nuclear Information System (INIS)
Sandhu, B.S.; Saddi, M.B.; Singh, B.; Ghumman, B.S.
2003-01-01
Full text: The phenomenon of double-photon Compton scattering has been successfully observed using single gamma detector, a technique avoiding the use of complicated slow-fast coincidence set-up used till now for observing this higher order process. Here doubly differentiated collision cross-section integrated over direction of one of the two final photons, the direction of other one being kept fixed, has been measured experimentally for 0.662 MeV incident gamma photons. The energy spectra of the detected photons are observed as a long tail to the single-photon Compton line on the lower side of the full energy peak in the recorded scattered energy spectrum. The present results are in agreement with theory of this process
Cull, S. C.; Arvidson, R. E.; Seelos, F.; Wolff, M. J.
2010-03-01
Using data from CRISM's Emission Phase Function observations, we attempt to constrain Phoenix soil scattering properties, including soil grain size, single-scattering albedo, and surface phase function.
Directory of Open Access Journals (Sweden)
Huiru Zhao
2018-03-01
Full Text Available Carbon dioxide (CO2 emissions forecasting is becoming more important due to increasing climatic problems, which contributes to developing scientific climate policies and making reasonable energy plans. Considering that the influential factors of CO2 emissions are multiplex and the relationships between factors and CO2 emissions are complex and non-linear, a novel CO2 forecasting model called SSA-LSSVM, which utilizes the Salp Swarm Algorithm (SSA to optimize the two parameters of the least squares support sector machine (LSSVM model, is proposed in this paper. The influential factors of CO2 emissions, including the gross domestic product (GDP, population, energy consumption, economic structure, energy structure, urbanization rate, and energy intensity, are regarded as the input variables of the SSA-LSSVM model. The proposed model is verified to show a better forecasting performance compared with the selected models, including the single LSSVM model, the LSSVM model optimized by the particle swarm optimization algorithm (PSO-LSSVM, and the back propagation (BP neural network model, on CO2 emissions in China from 2014 to 2016. The comparative analysis indicates the SSA-LSSVM model is greatly superior and has the potential to improve the accuracy and reliability of CO2 emissions forecasting. CO2 emissions in China from 2017 to 2020 are forecast combined with the 13th Five-Year Plan for social, economic and energy development. The comparison of CO2 emissions of China in 2020 shows that structural factors significantly affect CO2 emission forecasting results. The average annual growth of CO2 emissions slows down significantly due to a series of policies and actions taken by the Chinese government, which means China can keep the promise that greenhouse gas emissions will start to drop after 2030.
Directory of Open Access Journals (Sweden)
J. Lee
2012-08-01
Full Text Available New over-ocean aerosol models are developed by integrating the inversion data from the Aerosol Robotic Network (AERONET sun/sky radiometers with a database for the optical properties of tri-axial ellipsoid particles. The new aerosol models allow more accurate retrieval of aerosol optical depth (AOD from the Moderate Resolution Imaging Spectroradiometer (MODIS in the case of high AOD (AOD > 0.3. The aerosol models are categorized by using the fine-mode fraction (FMF at 550 nm and the single-scattering albedo (SSA at 440 nm from the AERONET inversion data to include a variety of aerosol types found around the globe. For each aerosol model, the changes in the aerosol optical properties (AOPs as functions of AOD are considered to better represent aerosol characteristics. Comparisons of AODs between AERONET and MODIS for the period from 2003 to 2010 show that the use of the new aerosol models enhances the AOD accuracy with a Pearson coefficient of 0.93 and a regression slope of 0.99 compared to 0.92 and 0.85 calculated using the MODIS Collection 5 data. Moreover, the percentage of data within an expected error of ± (0.03 + 0.05 × AOD is increased from 62% to 64% for overall data and from 39% to 5% for AOD > 0.3. Errors in the retrieved AOD are further characterized with respect to the Ångström exponent (AE, scattering angle (Θ, SSA, and air mass factor (AMF. Due to more realistic AOPs assumptions, the new algorithm generally reduces systematic errors in the retrieved AODs compared with the current operational algorithm. In particular, the underestimation of fine-dominated AOD and the scattering angle dependence of dust-dominated AOD are significantly mitigated as results of the new algorithm's improved treatment of aerosol size distribution and dust particle nonsphericity.
Sewage sludge ash (SSA in high performance concrete: characterization and application
Directory of Open Access Journals (Sweden)
C. M. A. Fontes
Full Text Available ABSTRACT Sewage sludge originated from the process of treatment of wastewater has become an environmental issue for three main reasons: contains pathogens, heavy metals and organic compounds that are harmful to the environmental and human health; high volumes are daily generated; and shortage of landfill sites for proper disposal. This research deals with the viability study of sewage sludge utilization, after calcination process, as mineral admixture in the production of concrete. High-performance concretes were produced with replacement content of 5% and 10% by weight of Portland cement with sewage sludge ash (SSA. The influence of this ash was analyzed through physical and mechanical tests. Analysis showed that the mixtures containing SSA have lower values of compressive strength than the reference. The results of absorptivity, porosity and accelerated penetration of chloride ions, presents that mixtures containing ash showed reductions compared to the reference. This indicates that SSA provided refinement of the pore structure, which was confirmed by mercury intrusion porosimetry test.
Pinty, Bernard; Andredakis, Ioannis; Clerici, Marco; Kaminski, Thomas; Taberner, Malcolm; Stephen, Plummer
2011-01-01
We present results from the application of an inversion method conducted using MODIS derived broadband visible and near-infrared surface albedo products. This contribution is an extension of earlier efforts to optimally retrieve land surface fluxes and associated two- stream model parameters based on the Joint Research Centre Two-stream Inversion Package (JRC-TIP). The discussion focuses on products (based on the mean and one-sigma values of the Probability Distribution Functions (PDFs)) obtained during the summer and winter and highlight specific issues related to snowy conditions. This paper discusses the retrieved model parameters including the effective Leaf Area Index (LAI), the background brightness and the scattering efficiency of the vegetation elements. The spatial and seasonal changes exhibited by these parameters agree with common knowledge and underscore the richness of the high quality surface albedo data sets. At the same time, the opportunity to generate global maps of new products, such as the background albedo, underscores the advantages of using state of the art algorithmic approaches capable of fully exploiting accurate satellite remote sensing datasets. The detailed analyses of the retrieval uncertainties highlight the central role and contribution of the LAI, the main process parameter to interpret radiation transfer observations over vegetated surfaces. The posterior covariance matrix of the uncertainties is further exploited to quantify the knowledge gain from the ingestion of MODIS surface albedo products. The estimation of the radiation fluxes that are absorbed, transmitted and scattered by the vegetation layer and its background is achieved on the basis of the retrieved PDFs of the model parameters. The propagation of uncertainties from the observations to the model parameters is achieved via the Hessian of the cost function and yields a covariance matrix of posterior parameter uncertainties. This matrix is propagated to the radiation
Wang, Zhuosen; Schaaf, Crystal B.; Sun, Qingsong; Kim, JiHyun; Erb, Angela M.; Gao, Feng; Román, Miguel O.; Yang, Yun; Petroy, Shelley; Taylor, Jeffrey R.; Masek, Jeffrey G.; Morisette, Jeffrey T.; Zhang, Xiaoyang; Papuga, Shirley A.
2017-07-01
Seasonal vegetation phenology can significantly alter surface albedo which in turn affects the global energy balance and the albedo warming/cooling feedbacks that impact climate change. To monitor and quantify the surface dynamics of heterogeneous landscapes, high temporal and spatial resolution synthetic time series of albedo and the enhanced vegetation index (EVI) were generated from the 500 m Moderate Resolution Imaging Spectroradiometer (MODIS) operational Collection V006 daily BRDF/NBAR/albedo products and 30 m Landsat 5 albedo and near-nadir reflectance data through the use of the Spatial and Temporal Adaptive Reflectance Fusion Model (STARFM). The traditional Landsat Albedo (Shuai et al., 2011) makes use of the MODIS BRDF/Albedo products (MCD43) by assigning appropriate BRDFs from coincident MODIS products to each Landsat image to generate a 30 m Landsat albedo product for that acquisition date. The available cloud free Landsat 5 albedos (due to clouds, generated every 16 days at best) were used in conjunction with the daily MODIS albedos to determine the appropriate 30 m albedos for the intervening daily time steps in this study. These enhanced daily 30 m spatial resolution synthetic time series were then used to track albedo and vegetation phenology dynamics over three Ameriflux tower sites (Harvard Forest in 2007, Santa Rita in 2011 and Walker Branch in 2005). These Ameriflux sites were chosen as they are all quite nearby new towers coming on line for the National Ecological Observatory Network (NEON), and thus represent locations which will be served by spatially paired albedo measures in the near future. The availability of data from the NEON towers will greatly expand the sources of tower albedometer data available for evaluation of satellite products. At these three Ameriflux tower sites the synthetic time series of broadband shortwave albedos were evaluated using the tower albedo measurements with a Root Mean Square Error (RMSE) less than 0.013 and a
Sea Ice, Clouds, Sunlight, and Albedo: The Umbrella Versus the Blanket
Perovich, D. K.
2017-12-01
The Arctic sea ice cover has undergone a major decline in recent years, with reductions in ice extent, ice thickness, and ice age. Understanding the feedbacks and forcing driving these changes is critical in improving predictions. The surface radiation budget plays a central role in summer ice melt and is governed by clouds and surface albedo. Clouds act as an umbrella reducing the downwelling shortwave, but also serve as a blanket increasing the downwelling longwave, with the surface albedo also determining the net balance. Using field observations from the SHEBA program, pairs of clear and cloudy days were selected for each month from May through September and the net radiation flux was calculated for different surface conditions and albedos. To explore the impact of albedo we calculated a break even albedo, where the net radiation for cloudy skies is the same as clear skies. For albedos larger than the break-even value the net radiation flux is smaller under clear skies compared to cloudy skies. Break-even albedos ranged from 0.30 in September to 0.58 in July. For snow covered or bare ice, clear skies always resulted in less radiative heat input. In contrast, leads always had, and ponds usually had, more radiative heat input under clear skies than cloudy skies. Snow covered ice had a net radiation flux that was negative or near zero under clear skies resulting in radiative cooling. We combined the albedo of individual ice types with the area of those ice types to calculate albedos averaged over a 50 km x 50 km area. The July case had the smallest areally averaged albedo of 0.50. This was less than the breakeven albedo, so cloudy skies had a smaller net radiation flux than clear skies. For the cases from the other four months, the areally averaged albedo was greater than the break-even albedo. The areally averaged net radiation flux was negative under clear skies for the May and September cases.
Directory of Open Access Journals (Sweden)
A. A. Marks
2013-07-01
Full Text Available The response of the albedo of bare sea ice and snow-covered sea ice to the addition of black carbon is calculated. Visible light absorption and light-scattering cross-sections are derived for a typical first-year and multi-year sea ice with both "dry" and "wet" snow types. The cross-sections are derived using data from a 1970s field study that recorded both reflectivity and light penetration in Arctic sea ice and snow overlying sea ice. The variation of absorption cross-section over the visible wavelengths suggests black carbon is the dominating light-absorbing impurity. The response of first-year and multi-year sea ice albedo to increasing black carbon, from 1 to 1024 ng g−1, in a top 5 cm layer of a 155 cm-thick sea ice was calculated using a radiative-transfer model. The albedo of the first-year sea ice is more sensitive to additional loadings of black carbon than the multi-year sea ice. An addition of 8 ng g−1 of black carbon causes a decrease to 98.7% of the original albedo for first-year sea ice compared to a decrease to 99.7% for the albedo of multi-year sea ice, at a wavelength of 500 nm. The albedo of sea ice is surprisingly unresponsive to additional black carbon up to 100 ng g−1 . Snow layers on sea ice may mitigate the effects of black carbon in sea ice. Wet and dry snow layers of 0.5, 1, 2, 5 and 10 cm depth were added onto the sea ice surface. The albedo of the snow surface was calculated whilst the black carbon in the underlying sea ice was increased. A layer of snow 0.5 cm thick greatly diminishes the effect of black carbon in sea ice on the surface albedo. The albedo of a 2–5 cm snow layer (less than the e-folding depth of snow is still influenced by the underlying sea ice, but the effect of additional black carbon in the sea ice is masked.
Global Cooling: Effect of Urban Albedo on Global Temperature
Energy Technology Data Exchange (ETDEWEB)
Akbari, Hashem; Menon, Surabi; Rosenfeld, Arthur
2007-05-22
In many urban areas, pavements and roofs constitute over 60% of urban surfaces (roof 20-25%, pavements about 40%). The roof and the pavement albedo can be increased by about 0.25 and 0.10, respectively, resulting in a net albedo increase for urban areas of about 0.1. Many studies have demonstrated building cooling-energy savings in excess of 20% upon raising roof reflectivity from an existing 10-20% to about 60%. We estimate U.S. potential savings in excess of $1 billion (B) per year in net annual energy bills. Increasing albedo of urban surfaces can reduce the summertime urban temperature and improve the urban air quality. Increasing the urban albedo has the added benefit of reflecting more of the incoming global solar radiation and countering the effect of global warming. We estimate that increasing albedo of urban areas by 0.1 results in an increase of 3 x 10{sup -4} in Earth albedo. Using a simple global model, the change in air temperature in lowest 1.8 km of the atmosphere is estimated at 0.01K. Modelers predict a warming of about 3K in the next 60 years (0.05K/year). Change of 0.1 in urban albedo will result in 0.01K global cooling, a delay of {approx}0.2 years in global warming. This 0.2 years delay in global warming is equivalent to 10 Gt reduction in CO2 emissions.
Lupus systémique et atteinte rénale: Apport des anticorps anti-SSA ...
African Journals Online (AJOL)
-SSA dans 12 cas (40%).Cinq patients (62.5%) ayant une atteinte rénale avaient des anticorps anti DNA négatifs. Parmi ces patients avec atteinte rénale, 37.5% avaient des anticorps anti SSA sans anticorps anti DNA. La moitié des patients ...
Intercomparison and validation of snow albedo parameterization schemes in climate models
Energy Technology Data Exchange (ETDEWEB)
Pedersen, Christina A.; Winther, Jan-Gunnar [Norwegian Polar Institute, Tromsoe (Norway)
2005-09-01
Snow albedo is known to be crucial for heat exchange at high latitudes and high altitudes, and is also an important parameter in General Circulation Models (GCMs) because of its strong positive feedback properties. In this study, seven GCM snow albedo schemes and a multiple linear regression model were intercompared and validated against 59 years of in situ data from Svalbard, the French Alps and six stations in the former Soviet Union. For each site, the significant meteorological parameters for modeling the snow albedo were identified by constructing the 95% confidence intervals. The significant parameters were found to be: temperature, snow depth, positive degree day and a dummy of snow depth, and the multiple linear regression model was constructed to include these. Overall, the intercomparison showed that the modeled snow albedo varied more than the observed albedo for all models, and that the albedo was often underestimated. In addition, for several of the models, the snow albedo decreased at a faster rate or by a greater magnitude during the winter snow metamorphosis than the observed albedo. Both the temperature dependent schemes and the prognostic schemes showed shortcomings. (orig.)
Changes in Snow Albedo Resulting from Snow Darkening Caused by Black Carbon
Engels, J.; Kloster, S.; Bourgeois, Q.
2014-12-01
We investigate the potential impact of snow darkening caused by pre-industrial and present-day black carbon (BC) emissions on snow albedo and subsequently climate. To assess this impact, we implemented the effect of snow darkening caused by BC emitted from natural as well as anthropogenic sources into the Max Planck Institute for Meteorology Earth System Model (MPI-M ESM). Considerable amounts of BC are emitted e.g. from fires and are transported through the atmosphere for several days before being removed by rain or snow precipitation in snow covered regions. Already very small quantities of BC reduce the snow reflectance significantly, with consequences for snow melting and snow spatial coverage. We implemented the snow albedo reduction caused by BC contamination and snow aging in the one layer land surface component (JSBACH) of the atmospheric general circulation model ECHAM6, developed at MPI-M. For this we used the single-layer simulator of the SNow, Ice, and Aerosol Radiation (SNICAR-Online (Flanner et al., 2007); http://snow.engin.umich.edu) model to derive snow albedo values for BC in snow concentrations ranging between 0 and 1500 ng(BC)/g(snow) for different snow grain sizes for the visible (0.3 - 0.7 μm) and near infrared range (0.7 - 1.5 μm). As snow grains grow over time, we assign different snow ages to different snow grain sizes (50, 150, 500, and 1000 μm). Here, a radius of 50 μm corresponds to new snow, whereas a radius of 1000 μm corresponds to old snow. The deposition rates of BC on snow are prescribed from previous ECHAM6-HAM simulations for two time periods, pre-industrial (1880-1889) and present-day (2000-2009), respectively. We perform a sensitivity study regarding the scavenging of BC by snow melt. To evaluate the newly implemented albedo scheme we will compare the modeled black carbon in snow concentrations to observed ones. Moreover, we will show the impact of the BC contamination and snow aging on the simulated snow albedo. The
Imaging through scattering media by Fourier filtering and single-pixel detection
Jauregui-Sánchez, Y.; Clemente, P.; Lancis, J.; Tajahuerce, E.
2018-02-01
We present a novel imaging system that combines the principles of Fourier spatial filtering and single-pixel imaging in order to recover images of an object hidden behind a turbid medium by transillumination. We compare the performance of our single-pixel imaging setup with that of a conventional system. We conclude that the introduction of Fourier gating improves the contrast of images in both cases. Furthermore, we show that the combination of single-pixel imaging and Fourier spatial filtering techniques is particularly well adapted to provide images of objects transmitted through scattering media.
Tundra vegetation effects on pan-Arctic albedo
International Nuclear Information System (INIS)
Loranty, Michael M; Goetz, Scott J; Beck, Pieter S A
2011-01-01
Recent field experiments in tundra ecosystems describe how increased shrub cover reduces winter albedo, and how subsequent changes in surface net radiation lead to altered rates of snowmelt. These findings imply that tundra vegetation change will alter regional energy budgets, but to date the effects have not been documented at regional or greater scales. Using satellite observations and a pan-Arctic vegetation map, we examined the effects of shrub vegetation on albedo across the terrestrial Arctic. We included vegetation classes dominated by low shrubs, dwarf shrubs, tussock-dominated graminoid tundra, and non-tussock graminoid tundra. Each class was further stratified by bioclimate subzones. Low-shrub tundra had higher normalized difference vegetation index values and earlier albedo decline in spring than dwarf-shrub tundra, but for tussock tundra, spring albedo declined earlier than for low-shrub tundra. Our results illustrate how relatively small changes in vegetation properties result in differences in albedo dynamics, regardless of shrub growth, that may lead to differences in net radiation upwards of 50 W m -2 at weekly time scales. Further, our findings imply that changes to the terrestrial Arctic energy budget during this important seasonal transition are under way regardless of whether recent satellite observed productivity trends are the result of shrub expansion. We conclude that a better understanding of changes in vegetation productivity and distribution in Arctic tundra is essential for accurately quantifying and predicting carbon and energy fluxes and associated climate feedbacks.
Thermoluminescence albedo-neutron dosimetry
International Nuclear Information System (INIS)
Strand, T.; Storruste, A.
1986-10-01
The report discusses neutron detection with respect to dosimetry and compares different thermoluminescent dosimetry materials for neutron dosimetry. Construction and calibration of a thermoluminescence albedo neutron dosemeter, developed by the authors, is described
Using Remote Sensing to Quantify Roof Albedo in Seven California Cities
Ban-Weiss, G. A.; Woods, J.; Millstein, D.; Levinson, R.
2013-12-01
Cool roofs reflect sunlight and therefore can reduce cooling energy use in buildings. Further, since roofs cover about 20-25% of cities, wide spread deployment of cool roofs could mitigate the urban heat island effect and partially counter urban temperature increases associated with global climate change. Accurately predicting the potential for increasing urban albedo using reflective roofs and its associated energy use and climate benefits requires detailed knowledge of the current stock of roofs at the city scale. Until now this knowledge has been limited due to a lack of availability of albedo data with sufficient spatial coverage, spatial resolution, and spectral information. In this work we use a novel source of multiband aerial imagery to derive the albedos of individual roofs in seven California cities: Los Angeles, Long Beach, San Diego, Bakersfield, Sacramento, San Francisco, and San Jose. The radiometrically calibrated, remotely sensed imagery has high spatial resolution (1 m) and four narrow (less than 0.1 μm wide) band reflectances: blue, green, red, and near-infrared. To derive the albedo of roofs in each city, we first locate roof pixels within GIS building outlines. Next we use laboratory measurements of the solar spectral reflectances of 190 roofing products to empirically relate solar reflectance (albedo) to reflectances in the four narrow bands; the root-mean-square of the residuals for the albedo prediction is 0.016. Albedos computed from remotely sensed reflectances are calibrated to ground measurements of roof albedo in each city. The error (both precision and accuracy) of albedo values is presented for each city. The area-weighted mean roof albedo (× standard deviation) for each city ranges from 0.17 × 0.08 (Los Angeles) to 0.29 × 0.15 (San Diego). In each city most roofs have low albedo in the range of 0.1 to 0.3. Roofs with albedo greater than 0.4 comprise less than 3% of total roofs and 7% of total roof area in each city. The California
Li, Jing; Jiang, Yiwei; Xia, Xiangao; Hu, Yongyun
2018-03-01
Previously, it was widely documented that an overall decrease in surface solar radiation occurred in China at least until 2005, in contrast to the general background of ‘global brightening’. Increased anthropogenic aerosol emissions were speculated to be the source of the reduction. In this study, we extend the trend analysis to the most recent decade from 2005-2015 and find that surface solar radiation has shifted from ‘dimming’ to ‘brightening’ over East China, with the largest increase over the northeast and southeast parts. Meanwhile, satellite and ground observation both indicate a reduction in aerosol optical depth (AOD) during the same period, whereas no significant trends in cloud amount show up. Detailed analysis using co-located radiation and aerosol observation at the XiangHe station in North China suggests that both AOD and single scattering albedo (SSA) changes contribute to the radiation trends. AOD reduction contributes to the increase of direct solar radiation, also decreasing the diffuse radiation, while the increase of SSA serves to increase the diffuse fraction. Simple calculations using a radiative transfer model confirm that the two effects combined explain changes in the global solar radiation and its components effectively. Our results have implications for potential climate effects with the reduction of China’s aerosol emissions, and the necessity to monitor aerosol composition in addition to its loading.
Long-term record of top-of-atmosphere albedo generated from AVHRR data
Song, Z.
2017-12-01
Top-of-Atmosphere (TOA) albedo is a fundamental component of Earth's energy budget. Previously, long-term accurate TOA albedo products did not exist due to the lack of stable broadband observations. With a new albedo estimation methodology based on multispectral observations, TOA albedo since 1981 has been retrieved using data from the Advanced Very High Resolution Radiometer (AVHRR), which provides the longest record of satellite observations across the globe. To develop the long-term TOA albedo record, the instantaneous TOA albedo was calculated by the direct estimation method, which was built on training data pairs from coincident AVHRR TOA reflectance and Moderate Resolution Imaging Spectroradiometer (MODIS) TOA albedo. The instantaneous TOA albedo was then converted to daily mean and monthly mean albedo based on the diurnal curves from geostationary satellites. The TOA albedo results (AVHRR-TAL) were compared with Clouds and the Earth's Radiant Energy System (CERES) flux products for 2007. The monthly mean AVHRR-TAL agreed well with the CERES products, with a root mean square difference (RMSD) of 0.032 and a bias of 0.013. In addition, AVHRR-TAL showed similar seasonal variations to those seen in the CERES products. Further analysis on long-term time series showed good consistency between the two datasets (R2 > 0.95 and relative RMSD < 4%) from 2000 to 2015. Although some calibration issues remain to be solved, our datasets show the potential ability to observe the global TOA albedo from 1981 to the present.
International Nuclear Information System (INIS)
Schuch, L.A.
1978-11-01
The calibration factors and the reproducibility of an Albedo Dosimeter designed for personal neutron monitoring were determined. These factor were obtained simulating the dosimeter reading and the equivalent dose in the locality by a convenient combination of responses of the Bonner Sphere Spectrometer. The results obtained in the simulation were verified experimentally for different spectra employing the Am-Be, bare 252 Cf source and 253 Cf source with graphite sields of varying thickness. Different standards were used in the procedures necessary for the determination of the calibration factors. An Am-Be neutron source, standardized by the activation of a manganese sulphate bath was used as a primary standard. As a secondary standard, for the measurement of the neutron fluence, a De Pangher Long Counter was used and the scattering effects were determined using the shadow cone method. The other monitors such as the Rem-Counter and the Bonner Sphere Spectrometer were also calibrated with reference to the secondary standard with a view to comparing the results obtained with those furnished by the Albedo Dosimeter. (Author) [pt
Spring–summer albedo variations of Antarctic sea ice from 1982 to 2009
International Nuclear Information System (INIS)
Shao, Zhu-De; Ke, Chang-Qing
2015-01-01
This study examined the spring–summer (November, December, January and February) albedo averages and trends using a dataset consisting of 28 years of homogenized satellite data for the entire Antarctic sea ice region and for five longitudinal sectors around Antarctica: the Weddell Sea (WS), the Indian Ocean sector (IO), the Pacific Ocean sector (PO), the Ross Sea (RS) and the Bellingshausen–Amundsen Sea (BS). Time series data of the sea ice concentrations and sea surface temperatures were used to analyse their relations to the albedo. The results indicated that the sea ice albedo increased slightly during the study period, at a rate of 0.314% per decade, over the Antarctic sea ice region. The sea ice albedos in the PO, the IO and the WS increased at rates of 2.599% per decade (confidence level 99.86%), 0.824% per decade and 0.413% per decade, respectively, and the steepest increase occurred in the PO. However, the sea ice albedo in the BS decreased at a rate of −1.617% per decade (confidence level 95.05%) and was near zero in the RS. The spring–summer average albedo over the Antarctic sea ice region was 50.24%. The highest albedo values were mainly found on the continental coast and in the WS; in contrast, the lowest albedo values were found on the outer edge of the sea ice, the RS and the Amery Ice Shelf. The average albedo in the western Antarctic sea ice region was distinctly higher than that in the east. The albedo was significantly positively correlated with sea ice concentration (SIC) and was significantly negatively correlated with sea surface temperature (SST); these scenarios held true for all five longitudinal sectors. Spatially, the higher surface albedos follow the higher SICs and lower SST patterns. The increasing albedo means that Antarctic sea ice region reflects more solar radiation and absorbs less, leading to a decrease in temperature and much snowfall on sea ice, and further resulted in an increase in albedo. Conversely, the decreasing
Albedo's determination by the method of neutron impulse
International Nuclear Information System (INIS)
Flores Calderon, J.E.
1982-01-01
Experiments with non-stationary neutron transport in large cavity moderators (l>>Σsub(tr) -1 ) (where l is the characteristic cavity length and Σsub(tr) -1 the macroscopic transport section of the moderator) led to the method reported in this study which, based on neutron impulses for determining albedo of thermal neutrons, gave a precision greater by an order of magnitude over previous methods. A sufficient time interval after introduction of the neutron flux into the moderator chamber decreased exponentially the decay constant L, which was itself related to albedo by a function called f. Numerical calculations of albedo were assisted. (author)
Thermal-neutron multiple scattering: critical double scattering
International Nuclear Information System (INIS)
Holm, W.A.
1976-01-01
A quantum mechanical formulation for multiple scattering of thermal-neutrons from macroscopic targets is presented and applied to single and double scattering. Critical nuclear scattering from liquids and critical magnetic scattering from ferromagnets are treated in detail in the quasielastic approximation for target systems slightly above their critical points. Numerical estimates are made of the double scattering contribution to the critical magnetic cross section using relevant parameters from actual experiments performed on various ferromagnets. The effect is to alter the usual Lorentzian line shape dependence on neutron wave vector transfer. Comparison with corresponding deviations in line shape resulting from the use of Fisher's modified form of the Ornstein-Zernike spin correlations within the framework of single scattering theory leads to values for the critical exponent eta of the modified correlations which reproduce the effect of double scattering. In addition, it is shown that by restricting the range of applicability of the multiple scattering theory from the outset to critical scattering, Glauber's high energy approximation can be used to provide a much simpler and more powerful description of multiple scattering effects. When sufficiently close to the critical point, it provides a closed form expression for the differential cross section which includes all orders of scattering and has the same form as the single scattering cross section with a modified exponent for the wave vector transfer
Higher albedos and size distribution of large transneptunian objects
Lykawka, Patryk Sofia; Mukai, Tadashi
2005-11-01
Transneptunian objects (TNOs) orbit beyond Neptune and do offer important clues about the formation of our solar system. Although observations have been increasing the number of discovered TNOs and improving their orbital elements, very little is known about elementary physical properties such as sizes, albedos and compositions. Due to TNOs large distances (>40 AU) and observational limitations, reliable physical information can be obtained only from brighter objects (supposedly larger bodies). According to size and albedo measurements available, it is evident the traditionally assumed albedo p=0.04 cannot hold for all TNOs, especially those with approximately absolute magnitudes H⩽5.5. That is, the largest TNOs possess higher albedos (generally >0.04) that strongly appear to increase as a function of size. Using a compilation of published data, we derived empirical relations which can provide estimations of diameters and albedos as a function of absolute magnitude. Calculations result in more accurate size/albedo estimations for TNOs with H⩽5.5 than just assuming p=0.04. Nevertheless, considering low statistics, the value p=0.04 sounds still convenient for H>5.5 non-binary TNOs as a group. We also discuss about physical processes (e.g., collisions, intrinsic activity and the presence of tenuous atmospheres) responsible for the increase of albedo among large bodies. Currently, all big TNOs (>700 km) would be capable to sustain thin atmospheres or icy frosts composed of CH 4, CO or N 2 even for body bulk densities as low as 0.5 g cm -3. A size-dependent albedo has important consequences for the TNOs size distribution, cumulative luminosity function and total mass estimations. According to our analysis, the latter can be reduced up to 50% if higher albedos are common among large bodies. Lastly, by analyzing orbital properties of classical TNOs ( 42AUbodies. For both populations, distinct absolute magnitude distributions are maximized for an inclination threshold
Surface Albedo Darkening from wildfires in Northern Sub-Saharan Africa
Gatebe, C. K.; Ichoku, C. M.; Poudal, R.; Roman, M. O.; Wilcox, E.
2014-01-01
Wildfires are recognized as a key physical disturbance of terrestrial ecosystems and a major source of atmospheric trace gases and aerosols. They are known to produce changes in landscape patterns and lead to changes in surface albedo that can persist for long periods. Here, we estimate the darkening of surface albedo due to wildfires in different land cover ecosystems in the Northern Sub-Saharan Africa using data from the Moderate Resolution Imaging Spectroradiometer (MODIS). We determined a decrease in albedo after fires over most land cover types (e.g. woody savannas: (-0.00352 0.00003) and savannas: (- 0.003910.00003), which together accounted for >86% of the total MODIS fire count between 2003 and 2011). Grasslands had a higher value (-0.00454 0.00003) than the savannas, but accounted for only about 5% of the total fire count. A few other land cover types (e.g. Deciduous broad leaf: (0.00062 0.00015), and barren: 0.00027 0.00019), showed an increase in albedo after fires, but accounted for less than 1% of the total fires. Albedo change due to wildfires is more important during the fire season (October-February). The albedo recovery progresses rapidly during the first year after fires, where savannas show the greatest recovery (>77%) within one year, while deciduous broadleaf, permanent wetlands and barren lands show the least one-year recovery (56%). The persistence of surface albedo darkening in most land cover types is limited to about six to seven years, after which at least 98% of the burnt pixels recover to their pre-fire albedo.
DEFF Research Database (Denmark)
Baer, Alan N; McAdams DeMarco, Mara; Shiboski, Stephen C
2015-01-01
phenotypic features. Among SICCA participants classified with SS on the basis of the American-European Consensus Group or American College of Rheumatology criteria, only 2% required the anti-SSB-alone test result to meet these criteria. CONCLUSIONS: The presence of anti-SSB, without anti-SSA antibodies, had...... participants, 2061 (63%) had negative anti-SSA/anti-SSB, 1162 (35%) had anti-SSA with or without anti-SSB, and 74 (2%) anti-SSB alone. Key SS phenotypic features were more prevalent and had measures indicative of greater disease activity in those participants with anti-SSA, either alone or with anti-SSB, than...... in those with anti-SSB alone or negative SSA/SSB serology. These between-group differences were highly significant and not explained by confounding by age, race/ethnicity or gender. Participants with anti-SSB alone were comparable to those with negative SSA/SSB serology in their association with these key...
Matrix albedo for discrete ordinates infinite-medium boundary condition
International Nuclear Information System (INIS)
Mathews, K.; Dishaw, J.
2007-01-01
Discrete ordinates problems with an infinite exterior medium (reflector) can be more efficiently computed by eliminating grid cells in the exterior medium and applying a matrix albedo boundary condition. The albedo matrix is a discretized bidirectional reflection distribution function (BRDF) that accounts for the angular quadrature set, spatial quadrature method, and spatial grid that would have been used to model a portion of the exterior medium. The method is exact in slab geometry, and could be used as an approximation in multiple dimensions or curvilinear coordinates. We present an adequate method for computing albedo matrices and demonstrate their use in verifying a discrete ordinates code in slab geometry by comparison with Ganapol's infinite medium semi-analytic TIEL benchmark. With sufficient resolution in the spatial and angular grids and iteration tolerance to yield solutions converged to 6 digits, the conventional (scalar) albedo boundary condition yielded 2-digit accuracy at the boundary, but the matrix albedo solution reproduced the benchmark scalar flux at the boundary to all 6 digits. (authors)
Albedos of Jovian Trojans, Hildas and Centaurs
Romanishin, William; Tegler, Stephen C.
2017-10-01
We present distributions of optical V band albedos for samples of outer solar system minor bodies including Centaurs, Jovian Trojans and Hildas. Diameters come almost entirely from the NEOWISE catalog (Mainzer etal 2016- Planetary Data System). Optical photometry (H values) for about 2/3 of the approximately 2700 objects studied are from PanStarrrs (Veres et al 2015 Icarus 261, 34). The PanStarrs optical photometry is supplemented by H values from JPL Horizons (corrected to be on the same photometric system as the PanStarrs data) for the objects in the NEOWISE catalog that are not in the PanStarrs catalog. We compare the albedo distributions of various pairs of subsamples using the nonparametric Wilcoxon rank sum test. Examples of potentially interesting comparisons include: (1) The Hildas are 15-25% darker than the Trojans at a very high level of statistical significance. If the Hildas and Trojans started out with similar surfaces, the Hildas may have darkened due to the effects of gardening as they pass through zone III of the asteroid belt. (2) The median albedo of the gray Centaurs lies between that of the L4 and L5 Trojan groups (3) The median L5 Trojan cloud albedo is about 10% darker than that of the L4 cloud at a high level of significance. However, the modes of the L4 and L5 albedo distributions are very similar, perhaps indicating the presence of a distinct brighter component in the L4 cloud that is not found in the L5 cloud.
Relating black carbon content to reduction of snow albedo
Brandt, R. E.; Warren, S. G.; Clarke, A. D.
2011-12-01
In remote snow of the Northern Hemisphere, the levels of soot pollution are in the parts-per-billion (ppb) range, where the effect on albedo is at the level of a few percent. A reduction of albedo by 1-2% is significant for climate but is difficult to detect experimentally, because snow albedo depends on several other variables. In our work to quantify the climatic effect of black carbon (BC) in snow, we therefore do not directly measure the albedo reduction. Instead, we use a two-step procedure: (1) We collect snow samples, melt and filter them, and analyze the filters spectrophotometrically for BC concentration. (2) We use the BC amount from the filter measurement, together with snow grain size, in a radiative transfer model to compute the albedo reduction. Our radiative transfer model uses the discrete ordinates algorithm DISORT 2.0. We have chosen a representative BC size distribution and optical constants, and have incorporated those of mineral dust as well. While a given mass of BC causes over an order of magnitude more snow albedo reduction compared to dust, a snowpack containing dust mutes the albedo-reducing effect of BC. Because the computed reduction of snow albedo is model-based, it requires experimental verification. We doubt that direct measurement of albedo-reduction will be feasible in nature, because of the vertical variation of both snow grain size and soot content, and because the natural soot content is small. We conclude that what is needed is an artificial snowpack, with uniform grain size and large uniform soot content (ppm not ppb), to produce a large signal on albedo. We have chosen to pursue this experiment outdoors rather than in the laboratory, for the following reasons: (1) The snowpack in the field of view is uniformly illuminated if the source of radiation is the Sun. (2) Visible radiation penetrates into the snow, so photons emerge horizontally distant from where they entered. In the limited width of a laboratory snowpack, radiation
Rauch, T.; Reindl, N.
2014-04-01
In the framework of the Virtual Observatory (VO), the German Astrophysical Virtual Observatory GAVO project provides easy access to theoretical spectral energy distributions (SEDs) within the registered GAVO service TheoSSA (http://dc.g-vo.org/theossa). TheoSSA is based on the well established Tübingen NLTE Model-Atmosphere Package (TMAP) for hot, compact stars. This includes central stars of planetary nebulae. We show examples of TheoSSA in operation.
Effect of diffraction on stimulated Brillouin scattering from a single laser hot spot
International Nuclear Information System (INIS)
Eliseev, V.V.; Rozmus, W.; Tikhonchuk, V.T.; Capjack, C.E.
1996-01-01
A single laser hot spot in an underdense plasma is represented as a focused Gaussian laser beam. Stimulated Brillouin scattering (SBS) from such a Gaussian beam with small f/numbers 2-4 has been studied in a three-dimensional slab geometry. It is shown that the SBS reflectivity from a single laser hot spot is much lower than that predicted by a simple three wave coupling model because of the diffraction of the scattered light from the spatially localized ion acoustic wave. SBS gain per one Rayleigh length of the incident laser beam is proposed as a quantitative measure of this effect. Diffraction-limited SBS from a randomized laser beam is also discussed. copyright 1996 American Institute of Physics
Continuous versus discontinuous albedo representations in a simple diffusive climate model
Simmons, P. A.; Griffel, D. H.
1988-07-01
A one-dimensional annually and zonally averaged energy-balance model, with diffusive meridional heat transport and including icealbedo feedback, is considered. This type of model is found to be very sensitive to the form of albedo used. The solutions for a discontinuous step-function albedo are compared to those for a more realistic smoothly varying albedo. The smooth albedo gives a closer fit to present conditions, but the discontinuous form gives a better representation of climates in earlier epochs.
Possible role of anti-SSA/Ro antibodies in the pathogenesis of pulmonary hypertension
Directory of Open Access Journals (Sweden)
Kelsey Guerreso
2016-01-01
Conclusion: It is known that pulmonary hypertension has association with autoimmune diseases, however no clear markers yet exist. Anti-SSA/Ro antibodies have been rarely described in cases of pulmonary disease, and less so in pulmonary hypertension. This case describes a unique association between isolated pulmonary hypertension and anti-SSA/Ro antibody, thereby illustrating the need to investigate this autoantibody and others in the pathogenesis of autoimmune pulmonary hypertension.
Albedo of the ice-covered Weddell and Bellingshausen Sea
A. I. Weiss; J. C. King; T. A. Lachlan-Cope; R. S. Ladkin
2011-01-01
This study investigates the surface albedo of the sea ice areas adjacent to the Antarctic Peninsula during the austral summer. Aircraft measurements of the surface albedo which were conducted in the sea ice areas of the Weddell and Bellingshausen Sea show significant differences between these two regions. The averaged surface albedo varied between 0.13 and 0.81. The ice cover of the Bellingshausen Sea consisted mainly of first year ice and the sea surface showed an averaged sea ice albed...
Zhang, Ming; Ma, Yingying; Gong, Wei; Liu, Boming; Shi, Yifan; Chen, ZhongYong
2018-06-01
Poor air quality episodes are common in central China. Here, based on 10 years of ground-based sun-photometric observations, aerosol optical and radiative forcing characteristics were analyzed in Wuhan, the biggest metropolis in central China. Aerosol optical depth (AOD) in the last decade declined significantly, while the Ångström exponent (AE) showed slight growth. Single scattering albedo (SSA) at 440 nm reached the lowest value (0.87) in winter and highest value (0.93) in summer. Aerosol parameters derived from sun-photometric observations were used as input in a radiative transfer model to calculate aerosol radiative forcing (ARF) on the surface in ultraviolet (UV), visible (VIS), near-infrared (NIR), and shortwave (SW) spectra. ARFSW sustained decreases (the absolute values) over the last 10 years. In terms of seasonal variability, due to the increases in multiple scattering effects and attenuation of the transmitted radiation as AOD increased, ARF in summer displayed the largest value (-73.94 W/m2). After eliminating the influence of aerosol loading, the maximum aerosol radiative forcing efficiency in SW range (ARFESW) achieved a value of -64.5 W/m2/AOD in April. The ARFE change in each sub-interval spectrum was related to the change in SSA and effective radius of fine mode particles (Refff), that is, ARFE increased with the decreases in SSA and Refff. The smallest contribution of ARFENIR to ARFESW was 34.11% under strong absorbing and fine particle conditions, and opposite results were found for the VIS range, whose values were always over 51.82%. Finally, due to the serious air pollution and frequency of haze day, aerosol characteristics in haze and clear days were analyzed. The percentage of ARFENIR increased from 35.71% on clear-air days to 37.63% during haze periods, while both the percentage of ARFEUV and ARFENIR in ARFESW kept decreasing. The results of this paper should help us to better understand the effect of aerosols on solar spectral radiation
Influence of the atmospheric aerosol and air pollution on solar albedo of the earth. Vol. 4
International Nuclear Information System (INIS)
Mayhoub, A.B.; Mohamed, K.S.
1996-01-01
The effect of increasing atmospheric aerosol and air pollutant concentration on the solar albedo and consequently upon the heat budget near the earth's surface is studied. The magnitude of aerosol absorption coefficient to back-scattering coefficient B ab /B bs is calculated. This study will be used to estimate atmospheric stability categories and other meteorological parameters which are affected by thermal state radiation balance of the atmosphere as mixing and inversion height of Inshas nuclear reactor site. Consequently, concentration distribution of radioactive release from Inshas can be evaluated.. 4 figs., 5 tabs
Influence of the atmospheric aerosol and air pollution on solar albedo of the earth. Vol. 4
Energy Technology Data Exchange (ETDEWEB)
Mayhoub, A B; Mohamed, K S [Mathematics and Theoretical Physics Department, Nuclear Research Center, Atomic Energy Auhtority, Cairo, (Egypt)
1996-03-01
The effect of increasing atmospheric aerosol and air pollutant concentration on the solar albedo and consequently upon the heat budget near the earth`s surface is studied. The magnitude of aerosol absorption coefficient to back-scattering coefficient B{sub ab}/B{sub bs} is calculated. This study will be used to estimate atmospheric stability categories and other meteorological parameters which are affected by thermal state radiation balance of the atmosphere as mixing and inversion height of Inshas nuclear reactor site. Consequently, concentration distribution of radioactive release from Inshas can be evaluated.. 4 figs., 5 tabs.
Energy Technology Data Exchange (ETDEWEB)
Garvey, G.T., E-mail: garvey@lanl.gov [Los Alamos National Laboratory, P.O. Box 1663, Los Alamos, NM 87545 (United States); Harris, D.A., E-mail: dharris@fnal.gov [Fermi National Accelerator Laboratory, P.O. Box 500, Batavia, IL, 60510-5011 (United States); Tanaka, H.A., E-mail: tanaka@phas.ubc.ca [Institute of Particle Physics and Department of Physics and Astronomy, University of British Columbia, 6224 Agricultural Road, Vancouver, BC V6T 1Z1 (Canada); Tayloe, R., E-mail: rtayloe@indiana.edu [Department of Physics, Indiana University, 727 E. Third St., Bloomington, IN 47405-7105 (United States); Zeller, G.P., E-mail: gzeller@fnal.gov [Fermi National Accelerator Laboratory, P.O. Box 500, Batavia, IL, 60510-5011 (United States)
2015-06-15
The study of neutrino–nucleus interactions has recently seen rapid development with a new generation of accelerator-based neutrino experiments employing medium and heavy nuclear targets for the study of neutrino oscillations. A few unexpected results in the study of quasi-elastic scattering and single photon production have spurred a revisiting of the underlying nuclear physics and connections to electron–nucleus scattering. A thorough understanding and resolution of these issues is essential for future progress in the study of neutrino oscillations. A recent workshop hosted by the Institute of Nuclear Theory at the University of Washington (INT-13-54W) examined experimental and theoretical developments in neutrino–nucleus interactions and related measurements from electron and pion scattering. We summarize the discussions at the workshop pertaining to the aforementioned issues in quasi-elastic scattering and single photon production, particularly where there was consensus on the highest priority issues to be resolved and the path towards resolving them.
Sizing of single evaporating droplet with Near-Forward Elastic Scattering Spectroscopy
Woźniak, M.; Jakubczyk, D.; Derkachov, G.; Archer, J.
2017-11-01
We have developed an optical setup and related numerical models to study evolution of single evaporating micro-droplets by analysis of their spectral properties. Our approach combines the advantages of the electrodynamic trapping with the broadband spectral analysis with the supercontinuum laser illumination. The elastically scattered light within the spectral range of 500-900 nm is observed by a spectrometer placed at the near-forward scattering angles between 4.3 ° and 16.2 ° and compared with the numerically generated lookup table of the broadband Mie scattering. Our solution has been successfully applied to infer the size evolution of the evaporating droplets of pure liquids (diethylene and ethylene glycol) and suspensions of nanoparticles (silica and gold nanoparticles in diethylene glycol), with maximal accuracy of ± 25 nm. The obtained results have been compared with the previously developed sizing techniques: (i) based on the analysis of the Mie scattering images - the Mie Scattering Lookup Table Method and (ii) the droplet weighting. Our approach provides possibility to handle levitating objects with much larger size range (radius from 0.5 μm to 30 μm) than with the use of optical tweezers (typically radius below 8 μm) and analyse them with much wider spectral range than with commonly used LED sources.
Aerosol optical properties during firework, biomass burning and dust episodes in Beijing
Yu, Xingna; Shi, Chanzhen; Ma, Jia; Zhu, Bin; Li, Mei; Wang, Jing; Yang, Suying; Kang, Na
2013-12-01
In order to characterize the aerosol optical properties during different pollution episodes that occurred in Beijing, the aerosol loading, scattering, and size distributions are presented using solar and sky radiance measurements from 2001 to 2010 in this paper. A much higher aerosol loading than the background level was observed during the pollution episodes. The average aerosol optical depth (AOD) is largest during dust episodes coupled with the lowest Ångström exponent (α), while higher AOD and lower α were more correlated with firework and biomass burning days. The total mean AOD at 440, 675, 870 and 1020 nm were 0.24, 0.49, 0.64 and 1.38 in the clean, firework display, biomass burning and dust days, respectively. The mean α for dust days was 0.51 and exceeded 1.1 for the remaining episodes. The size distribution of the dusty periods was dominated by the coarse mode, but the coarse mode was similar magnitude to the fine mode during the firework and biomass burning days. The volume concentration of the coarse mode during the dust days increased by a magnitude of more than 2-8 times that derived in the other three aerosol conditions, suggesting that dust is the major contributor of coarse mode particles in Beijing. The single scattering albedo (SSA) values also increased during the pollution episodes. The overall mean SSA at the four wavelengths were 0.865, 0.911, 0.922 and 0.931 in clean, firework display, biomass burning, and dust days in Beijing, respectively. However, in the blue spectral range, the dust aerosols exhibited pronounced absorption.
Change in Urban Albedo in London: A Multi-scale Perspective
Susca, T.; Kotthaus, S.; Grimmond, S.
2013-12-01
Urbanization-induced change in land use has considerable implications for climate, air quality, resources and ecosystems. Urban-induced warming is one of the most well-known impacts. This directly and indirectly can extend beyond the city. One way to reduce the size of this is to modify the surface atmosphere exchanges through changing the urban albedo. As increased rugosity caused by the morphology of a city results in lower albedo with constant material characteristics, the impacts of changing the albedo has impacts across a range of scales. Here a multi-scale assessment of the potential effects of the increase in albedo in London is presented. This includes modeling at the global and meso-scale informed by local and micro-scale measurements. In this study the first order calculations are conducted for the impact of changing the albedo (e.g. a 0.01 increase) on the radiative exchange. For example, when incoming solar radiation and cloud cover are considered, based on data retrieved from NASA (http://power.larc.nasa.gov/) for ~1600 km2 area of London, would produce a mean decrease in the instantaneous solar radiative forcing on the same surface of 0.40 W m-2. The nature of the surface is critical in terms of considering the impact of changes in albedo. For example, in the Central Activity Zone in London pavement and building can vary from 10 to 100% of the plan area. From observations the albedo is seen to change dramatically with changes in building materials. For example, glass surfaces which are being used increasingly in the central business district results in dramatic changes in albedo. Using the documented albedo variations determined across different scales the impacts are considered. For example, the effect of the increase in urban albedo is translated into the corresponding amount of avoided emission of carbon dioxide that produces the same effect on climate. At local scale, the effect that the increase in urban albedo can potentially have on local
Polarized Raman scattering study of PSN single crystals and epitaxial thin films
Directory of Open Access Journals (Sweden)
J. Pokorný
2015-06-01
Full Text Available This paper describes a detailed analysis of the dependence of Raman scattering intensity on the polarization of the incident and inelastically scattered light in PbSc0.5Nb0.5O3 (PSN single crystals and epitaxially compressed thin films grown on (100-oriented MgO substrates. It is found that there are significant differences between the properties of the crystals and films, and that these differences can be attributed to the anticipated structural differences between these two forms of the same material. In particular, the scattering characteristics of the oxygen octahedra breathing mode near 810 cm-1 indicate a ferroelectric state for the crystals and a relaxor state for the films, which is consistent with the dielectric behaviors of these materials.
Clear-sky narrowband albedos derived from VIRS and MODIS
Sun-Mack, Sunny; Minnis, Patrick; Chen, Yan; Arduini, Robert F.
2004-02-01
The Clouds and Earth"s Radiant Energy System (CERES) project is using multispectral imagers, the Visible Infrared Scanner (VIRS) on the tropical Rainfall Measuring Mission (TRMM) satellite and the Moderate Resolution Imaging Spectroradiometer (MODIS) on Terra, operating since spring 2000, and Aqua, operating since summer 2002, to provide cloud and clear-sky properties at various wavelengths. This paper presents the preliminary results of an analysis of the CERES clear-sky reflectances to derive a set top-of-atmosphere clear sky albedo for 0.65, 0.86, 1.6, 2.13 μm, for all major surface types using the combined MODIS and VIRS datasets. The variability of snow albedo with surface type is examined using MODIS data. Snow albedo was found to depend on the vertical structure of the vegetation. At visible wavelengths, it is least for forested areas and greatest for smooth desert and tundra surfaces. At 1.6 and 2.1-μm, the snow albedos are relatively insensitive to the underlying surface because snow decreases the reflectance. Additional analyses using all of the MODIS results will provide albedo models that should be valuable for many remote sensing, simulation and radiation budget studies.
International Nuclear Information System (INIS)
Jones, S.K.
1992-01-01
Antinuclear antibodies are useful markers of connective tissue disease. In this study, UVB but not UVA induced the expression of Ro/SSA antigen on keratinocyte surfaces in vitro. This expression was also found with the extractable nuclear antigens RnP and Sm, but not with single or double-stranded DNA. The expression was prevented by blocking protein synthesis, suggesting that it was an active process. The results suggest that UVB exposure may result in the expression of Ro/SSA antigen on the surfaces of basal keratinocytes in vivo. This antigen could then bind circulating antibody leading to the cutaneous lesions in neonatal and subacute cutaneous lupus erythematosus. (Author)
The influence of inter-annually varying albedo on regional climate and drought
Meng, Xianhong
2013-05-05
Albedo plays an important role in land-atmosphere interactions and local climate. This study presents the impact on simulating regional climate, and the evolution of a drought, when using the default climatological albedo as is usually done in regional climate modelling, or using the actual observed albedo which is rarely done. Here, time-varying satellite derived albedo data is used to update the lower boundary condition of the Weather Research and Forecasting regional climate model in order to investigate the influence of observed albedo on regional climate simulations and also potential changes to land-atmosphere feedback over south-east Australia. During the study period from 2000 to 2008, observations show that albedo increased with an increasingly negative precipitation anomaly, though it lagged precipitation by several months. Compared to in-situ observations, using satellite observed albedo instead of the default climatological albedo provided an improvement in the simulated seasonal mean air temperature. In terms of precipitation, both simulations reproduced the drought that occurred from 2002 through 2006. Using the observed albedo produced a drier simulation overall. During the onset of the 2002 drought, albedo changes enhanced the precipitation reduction by 20 % on average, over locations where it was active. The area experiencing drought increased 6.3 % due to the albedo changes. Two mechanisms for albedo changes to impact land-atmosphere drought feedback are investigated. One accounts for the increased albedo, leading to reduced turbulent heat flux and an associated decrease of moist static energy density in the planetary boundary layer; the other considers that enhanced local radiative heating, due to the drought, favours a deeper planetary boundary layer, subsequently decreasing the moist static energy density through entrainment of the free atmosphere. Analysis shows that drought related large-scale changes in the regional climate favour a
Colorimetry and magnitudes of asteroids
Bowell, E.; Lumme, K.
1979-01-01
In the present paper, 1500 UBV observations are analyzed by a new rather general multiple scattering theory which provided clear insight into previously poorly-recognized optical nature of asteroid surfaces. Thus, phase curves are shown to consist of a surface-texture controlled component, due to singly scattered light, and a component due to multiple scattering. Phase curve shapes can be characterized by a single parameter, the multiple scattering factor, Q. As Q increases, the relative importance of the opposition effect diminishes. Asteroid surfaces are particulate and strikingly similar to texture, being moderately porous and moderately rough on a scale greater than the wavelength of light. In concequence, Q (and also the phase coefficient) correlate well with geometric albedo, and there exists a purely photometric means of determining albedos and diameters.
Valdé s, Felipe; Andriulli, Francesco P.; Bagci, Hakan; Michielssen, Eric
2013-01-01
Single-source time-domain electric-and magnetic-field integral equations for analyzing scattering from homogeneous penetrable objects are presented. Their temporal discretization is effected by using shifted piecewise polynomial temporal basis
2012-07-25
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0090] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...
2012-09-06
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0016] Privacy Act of 1974, as Amended; Computer Matching Program (Social Security Administration (SSA)/Department of Veterans Affairs (VA.... SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503...
Absorption line profiles in a moving atmosphere - A single scattering linear perturbation theory
Hays, P. B.; Abreu, V. J.
1989-01-01
An integral equation is derived which linearly relates Doppler perturbations in the spectrum of atmospheric absorption features to the wind system which creates them. The perturbation theory is developed using a single scattering model, which is validated against a multiple scattering calculation. The nature and basic properties of the kernels in the integral equation are examined. It is concluded that the kernels are well behaved and that wind velocity profiles can be recovered using standard inversion techniques.
BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data
National Aeronautics and Space Administration — ABSTRACT: The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains...
BOREAS TF-02 SSA-OA Tethersonde Meteorological and Ozone Data
National Aeronautics and Space Administration — The BOREAS TF-02 team collected various trace gas and energy flux data along with meteorological parameters at the SSA-OA site. This data set contains meteorological...
Energy Technology Data Exchange (ETDEWEB)
Iorga, G. [Faculty of Chemistry, University of Bucharest, Bucharest (Romania)]. E-mail: giorga@gw-chimie.math.unibuc.ro; Stefan, S. [Faculty of Physics, University of Bucharest, Bucharest (Romania)
2007-07-15
Both the enhancement of the aerosol number concentration and the relative dispersion of the cloud droplet size distribution (spectral dispersion) on a regional scale can modify the cloud reflectivity. This work is focused on the role that pre-cloud aerosol plays in cloud reflectivity. Log-normal aerosol size distributions were used to describe two aerosol types: marine and rural. The number of aerosols that activate to droplets was obtained based on Abdul-Razzak and Ghan's (2000) activation parameterization. The cloud albedo taking into account the spectral dispersion effect in the parameterization of cloud effective radius and in the scattering asymmetry factor has been estimated. Two different scaling factors to account for dispersion were used. The sensitivity of cloud albedo to spectral dispersion-cloud droplet number concentration relationship in connection to the changes in liquid water content (LWC), and the cloud droplet effective radius has been also investigated. We obtained higher values of effective radius when dispersion is taken into account, with respect to the base case (without considering dispersion). The inferred absolute differences in effective radius values between calculations with each of the scaling factors are below 0.8 {mu}m as LWC ranges between 0.1 and 1.0 g m-3. The optical depth decreased by up to 14% (marine), and up to 29% (continental) when dispersion is considered in both effective radius and asymmetry factor ({beta}LDR scaling factor). Correspondingly, the relative change in cloud albedo is up to 6% (marine) and up to 11% (continental) clouds. For continental clouds, the calculated effective radius when dispersion is considered fits well within the measured range of effective radius in SCAR-B project. The calculated cloud albedo when dispersion is considered shows better agreement with the estimated cloud albedo from measured effective radius in SCAR-B project than the cloud albedo calculated without dispersion. In cleaner
International Nuclear Information System (INIS)
Rosenberg, L.; Spruch, L.
1996-01-01
Levinson close-quote s theorem relates the zero-energy phase shift δ for potential scattering in a given partial wave l, by a spherically symmetric potential that falls off sufficiently rapidly, to the number of bound states of that l supported by the potential. An extension of this theorem is presented that applies to single-channel scattering by a compound system initially in its ground state. As suggested by Swan [Proc. R. Soc. London Ser. A 228, 10 (1955)], the extended theorem differs from that derived for potential scattering; even in the absence of composite bound states δ may differ from zero as a consequence of the Pauli principle. The derivation given here is based on the introduction of a continuous auxiliary open-quote open-quote length phase close-quote close-quote η, defined modulo π for l=0 by expressing the scattering length as A=acotη, where a is a characteristic length of the target. Application of the minimum principle for the scattering length determines the branch of the cotangent curve on which η lies and, by relating η to δ, an absolute determination of δ is made. The theorem is applicable, in principle, to single-channel scattering in any partial wave for e ± -atom and nucleon-nucleus systems. In addition to a knowledge of the number of composite bound states, information (which can be rather incomplete) concerning the structure of the target ground-state wave function is required for an explicit, absolute, determination of the phase shift δ. As for Levinson close-quote s original theorem for potential scattering, no additional information concerning the scattering wave function or scattering dynamics is required. copyright 1996 The American Physical Society
Seasonal differences in the vertical profiles of aerosol optical properties over rural Oklahoma
Directory of Open Access Journals (Sweden)
E. Andrews
2011-10-01
Full Text Available A small airplane made 597 aerosol optical property (light absorption and light scattering vertical profile measurements over a rural Oklahoma site between March 2000 and December 2007. The aerosol profiles obtained during these 8 yr of measurements suggest significant seasonal differences in aerosol loading (scattering and absorption. The highest amounts of scattering and absorbing aerosol are observed during the summer and the lowest loading occurs during the winter. The relative contribution of aerosol absorption is highest in the winter (i.e., single scattering albedo is lowest in winter, particularly aloft. Aerosol absorption generally decreased with altitude below ~1.5 km and then was relatively constant or decreased more gradually above that. Aerosol scattering decreased sharply with altitude below ~1.5 km but, unlike absorption, also decreased at higher altitudes, albeit less sharply. Scattering Ångström exponents suggest that the aerosol was dominated by sub-micron aerosol during the summer at all altitudes, but that larger particles were present, especially in the spring and winter above 1 km. The seasonal variability observed for aerosol loading is consistent with AERONET aerosol optical depth (AOD although the AOD values calculated from in situ adjusted to ambient conditions and matching wavelengths are up to a factor of two lower than AERONET AOD values depending on season. The column averaged single scattering albedo derived from in situ airplane measurements are similar in value to the AERONET single scattering albedo inversion product but the seasonal patterns are different – possibly a consequence of the strict constraints on obtaining single scattering albedo from AERONET data. A comparison of extinction Ångström exponent and asymmetry parameter from the airplane and AERONET platforms suggests similar seasonal variability with smaller particles observed in the summer and fall and larger particles observed in spring and
Variation of Arctic's Sea-ice Albedo between 2000 and 2016 by fusion of MISR and MODIS data
Muller, Jan-Peter; Kharbouche, Said
2017-04-01
Many research studies have demonstrated that sea-ice plays a key role in climate change and global warming. Most of these studies are based either on ground in-situ data or on remotely sensed data. The latter data are provided mainly by active (SAR and LiDAR) sensors such as Cryosat2, ERS1/2, ENVISAT, Radarsat1/2, ICESat as well as passive sensors such as SSM/I. Nevertheless, the contribution of such active optical sensors data is limited to parameters such as thickness and sea-ice concentration from which albedo may be inferred. The creation of high quality albedo for sea-ice using optical satellites is confronted with two main obstacles: 1) the Arctic is a very cloudy region and, high quality albedo requires multi-angle observations over a relatively short period; 2) cloud masking over sea-ice is a very difficult task, especially for sensor with low spectral resolution. To overcome the above two obstacles, we discuss in a separate report the generation of this fused daily, weekly, fortnightly and monthly product at 1km and 5km resolution on a polar stereographic grid [1]. The limited swath (380km) of MISR means that not all of the Arctic is covered on a daily basis so composites on different time-steps were produced. The results show that sea-ice albedo has been in continuous decline since 2000 with thinner sea-ice and greater leads and open water as well as more ponding at earlier times in the year. The implications of these results are discussed in terms of the sea-ice climate feedback. Animated visualisations of the albedo patterns each year, the decline in average and the increase in standard deviation in albedo for every single day for all 17 years will be shown to demonstrate the effects of climate change over sea-ice albedo. References [1] Kharbouche & Muller, Production of Arctic sea-ice albedo by fusion of MISR and MODIS data. This conference. Acknowledgements This work was supported by www.QA4ECV.eu, a project of European Union's Seventh Framework
Albedo-adjusted fast-neutron diffusion coefficients in reactor reflectors
International Nuclear Information System (INIS)
Terney, W.B.
1975-01-01
In the newer, larger pressurized-water reactor cores, the calculated power distributions are fairly sensitive to the number of neutron groups used and to the treatment of the reflector cross sections. Comparisons between transport and diffusion calculations show that the latter substantially underpredict the reflector albedos in the fast (top) group and that the power distribution is shifted toward the core center when compared to 4-group transport theory results. When the fast-neutron diffusion coefficients are altered to make the transport- and diffusion-theory albedos agree, the power distributions are also brought into agreement. An expression for the fast-neutron diffusion coefficients in reflector regions has been derived such that the diffusion calculation reproduces the albedo obtained from a transport solution. In addition, a correction factor for mesh effects applicable to coarse mesh problems is presented. The use of the formalism gives the correct albedos and improved power distributions. (U.S.)
Changes in the Albedo of the Pegasus and Phoenix Runways, 2000-2017
2017-07-18
by the net heat transfer into the runway surface during the brief but intense peak of austral summer. The flux of downwelling shortwave solar energy...snow; and as ERDC/CRREL TR-17-10 2 mentioned above, the presence of melt water in the snow further reduces albedo and increases heating of the snow...interpolating over all possible angles, end member albedo cases (“white sky” and “black sky”) can be modeled . The actual albedo or “blue sky” albedo falls
Seasonal albedo of an urban/rural landscape from satellite observations
Brest, Christopher L.
1987-01-01
Using data from 27 calibrated Landsat observations of the Hartford, Connecticut area, the spatial distribution and seasonal variation of surface reflectance and albedo were examined. Mean values of visible reflectance, near-IR reflectance, and albedo are presented (for both snow-free and snow-cover observations) according to 14 land use/land cover categories. A diversity of albedo values was found to exist in this type of environment, associated with land cover. Many land-cover categories display a seasonal dependence, with intracategory seasonal differences being of comparable magnitude to intercategory differences. Key factors in determining albedo (and its seasonal dynamics) are the presence or absence of vegetation and the canopy structure. Snow-cover/snow-free differences range from a few percent (for urban land covers) to over 40 percent (for low-canopy vegetation).
Personal neutron monitoring using TLD albedo combined with etched tracks detector
Energy Technology Data Exchange (ETDEWEB)
Tsujimura, N.; Momose, T. [Japan Nuclear Cycle Development Institute, Ibarakiken (Japan)
2002-07-01
The albedo dosimetry has been carried out in personal neutron monitoring in the MOX fuel plant of JNC Tokai Works, however, it has shortcomings mainly due to the inherently poor energy response. This paper describes our efforts to overcome these difficulties in practical use of albedo dosemeters. The following four subjects are presented: (1) the neutron energy response functions of albedo TLD obtained from the mono-energetic neutron irradiation experiments and the Monte-Carlo calculations, (2) the location- dependent correction factors calculated from the response functions and neutron energy spectra measured in the workplaces, (3) the results of the international personal neutron dosimetry intercomparison program, and (4) the operational comparison program of TLD albedo and etched tracks detector worn by workers engaged in the fabrication process of the MOX fuel plant. Finally, the characteristics of the combination neutron dosemeter using TLD albedo and solid state etched track detector are summarized.
Diurnal variations in the UV albedo of arctic snow
Directory of Open Access Journals (Sweden)
O. Meinander
2008-11-01
Full Text Available The relevance of snow for climate studies is based on its physical properties, such as high surface reflectivity. Surface ultraviolet (UV albedo is an essential parameter for various applications based on radiative transfer modeling. Here, new continuous measurements of the local UV albedo of natural Arctic snow were made at Sodankylä (67°22'N, 26°39'E, 179 m a.s.l. during the spring of 2007. The data were logged at 1-min intervals. The accumulation of snow was up to 68 cm. The surface layer thickness varied from 0.5 to 35 cm with the snow grain size between 0.2 and 2.5 mm. The midday erythemally weighted UV albedo ranged from 0.6 to 0.8 in the accumulation period, and from 0.5 to 0.7 during melting. During the snow melt period, under cases of an almost clear sky and variable cloudiness, an unexpected diurnal decrease of 0.05 in albedo soon after midday, and recovery thereafter, was detected. This diurnal decrease in albedo was found to be asymmetric with respect to solar midday, thus indicating a change in the properties of the snow. Independent UV albedo results with two different types of instruments confirm these findings. The measured temperature of the snow surface was below 0°C on the following mornings. Hence, the reversible diurnal change, evident for ~1–2 h, could be explained by the daily metamorphosis of the surface of the snowpack, in which the temperature of the surface increases, melting some of the snow to liquid water, after which the surface freezes again.
The seasonal cycle of snow cover, sea ice and surface albedo
Robock, A.
1980-01-01
The paper examines satellite data used to construct mean snow cover caps for the Northern Hemisphere. The zonally averaged snow cover from these maps is used to calculate the seasonal cycle of zonally averaged surface albedo. The effects of meltwater on the surface, solar zenith angle, and cloudiness are parameterized and included in the calculations of snow and ice albedo. The data allows a calculation of surface albedo for any land or ocean 10 deg latitude band as a function of surface temperature ice and snow cover; the correct determination of the ice boundary is more important than the snow boundary for accurately simulating the ice and snow albedo feedback.
Energy Technology Data Exchange (ETDEWEB)
Yang, J.; Kuikka, J.T.; Vanninen, E.; Laensimies, E. [Kuopio Univ. Hospital (Finland). Dept. of Clinical Physiology and Nuclear Medicine; Kauppinen, T.; Patomaeki, L. [Kuopio Univ. (Finland). Dept. of Applied Physics
1999-05-01
Photon scatter is one of the most important factors degrading the quantitative accuracy of SPECT images. Many scatter correction methods have been proposed. The single isotope method was proposed by us. Aim: We evaluate the scatter correction method of improving the quality of images by acquiring emission and transmission data simultaneously with single isotope scan. Method: To evaluate the proposed scatter correction method, a contrast and linearity phantom was studied. Four female patients with fibromyalgia (FM) syndrome and four with chronic back pain (BP) were imaged. Grey-to-cerebellum (G/C) and grey-to-white matter (G/W) ratios were determined by one skilled operator for 12 regions of interest (ROIs) in each subject. Results: The linearity of activity response was improved after the scatter correction (r=0.999). The y-intercept value of the regression line was 0.036 (p<0.0001) after scatter correction and the slope was 0.954. Pairwise correlation indicated the agreement between nonscatter corrected and scatter corrected images. Reconstructed slices before and after scatter correction demonstrate a good correlation in the quantitative accuracy of radionuclide concentration. G/C values have significant correlation coefficients between original and corrected data. Conclusion: The transaxial images of human brain studies show that the scatter correction using single isotope in simultaneous transmission and emission tomography provides a good scatter compensation. The contrasts were increased on all 12 ROIs. The scatter compensation enhanced details of physiological lesions. (orig.) [Deutsch] Die Photonenstreuung gehoert zu den wichtigsten Faktoren, die die quantitative Genauigkeit von SPECT-Bildern vermindern. Es wurde eine ganze Reihe von Methoden zur Streuungskorrektur vorgeschlagen. Von uns wurde die Einzelisotopen-Methode empfohlen. Ziel: Wir untersuchten die Streuungskorrektur-Methode zur Verbesserung der Bildqualitaet durch simultane Gewinnung von Emissions
Testing the Prediction of Iron Alteration Minerals on Low Albedo Asteroids
Jarvis, K. S.; Vilas, Faith; Howell, E.; Kelley, M.; Cochran, A.
1999-01-01
Absorption features centered near 0.60 - 0.65 and 0.80 - 0.90 micron were identified in the spectra of three low-albedo main-belt (165, 368, 877) and two low-albedo outer-belt (225, 334) asteroids (Vilas et al., Icarus, v. 109,274,1994). The absorption features were attributed to charge transfer transitions in iron alteration minerals such as goethite, hematite, and jarosite, all products of aqueous alteration. Concurrently, Jarvis et al. (LPSC XXIV, 715, 1993) presented additional spectra of low-albedo asteroids that had absorption features centered near 0.60 - 0.65 micron without the longer wavelength feature. Since these two features in iron oxides originate from the same ground state, and the longer wavelength feature requires less energy to exist, the single shorter wavelength feature cannot be caused by the iron alteration minerals. In addition, spectra of minerals such as hematite and goethite show a rapid increase in reflectance beginning near 0.5 micron absent in the low-albedo asteroid spectra. The absence of this rise has been attributed to its suppresion from opaques in the surface material. Spectra on more than one night were available for only one of these five asteroids, 225 Henrietta, and showed good repeatability of the 0.65-micron feature. We have acquired additional spectra of all five asteroids in order to test the repeatability of the 0.65-micron feature, and the presence and repeatability of the features centered near 0.8 - 0.9 micron. We specifically will test the possibility that longer wavelength features could be caused by incomplete removal of telluric water. Asteroid 877 Walkure is a member of the Nysa-Hertha family, and will be compared to spectra of other members of that family. Data were acquired in 1996 and 1999 on the 2.1-m telescope with a facility cassegrain spectrograph, McDonald Observatory, Univ. Of Texas, and the 1.5-m telescope with facility cassegrain spectrograph at CTIO. This research is supported by the NASA Planetary
Simulation and Analysis of Topographic Effect on Land Surface Albedo over Mountainous Areas
Hao, D.; Wen, J.; Xiao, Q.
2017-12-01
Land surface albedo is one of the significant geophysical variables affecting the Earth's climate and controlling the surface radiation budget. Topography leads to the formation of shadows and the redistribution of incident radiation, which complicates the modeling and estimation of the land surface albedo. Some studies show that neglecting the topography effect may lead to significant bias in estimating the land surface albedo for the sloping terrain. However, for the composite sloping terrain, the topographic effects on the albedo remain unclear. Accurately estimating the sub-topographic effect on the land surface albedo over the composite sloping terrain presents a challenge for remote sensing modeling and applications. In our study, we focus on the development of a simplified estimation method for land surface albedo including black-sky albedo (BSA) and white-sky albedo (WSA) of the composite sloping terrain at a kilometer scale based on the fine scale DEM (30m) and quantitatively investigate and understand the topographic effects on the albedo. The albedo is affected by various factors such as solar zenith angle (SZA), solar azimuth angle (SAA), shadows, terrain occlusion, and slope and aspect distribution of the micro-slopes. When SZA is 30°, the absolute and relative deviations between the BSA of flat terrain and that of rugged terrain reaches 0.12 and 50%, respectively. When the mean slope of the terrain is 30.63° and SZA=30°, the absolute deviation of BSA caused by SAA can reach 0.04. The maximal relative and relative deviation between the WSA of flat terrain and that of rugged terrain reaches 0.08 and 50%. These results demonstrate that the topographic effect has to be taken into account in the albedo estimation.
2011-09-08
...; Comment Request; The SSA-NIH Collaboration To Improve the Disability Determination Process: Validation of... Collection: Title: The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information Collection Request: NEW. Need and Use of Information Collection...
2013-02-21
... 1310 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0007] Privacy Act of 1974, as Amended...
2010-08-18
... 1310 AGENCY: Social Security Administration (SSA) ACTION: Notice of a renewal of an existing computer..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0035] Privacy Act of 1974, as Amended...
2013-08-20
... 1016 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0022] Privacy Act of 1974, as Amended...
2013-03-15
... 1021 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of existing computer... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0073] Privacy Act of 1974, as Amended...
Growing season carries stronger contributions to albedo dynamics on the Tibetan plateau.
Tian, Li; Chen, Jiquan; Zhang, Yangjian
2017-01-01
The Tibetan Plateau has experienced higher-than-global-average climate warming in recent decades, resulting in many significant changes in ecosystem structure and function. Among them is albedo, which bridges the causes and consequences of land surface processes and climate. The plateau is covered by snow/ice and vegetation in the non-growing season (nGS) and growing season (GS), respectively. Based on the MODIS products, we investigated snow/ice cover and vegetation greenness in relation to the spatiotemporal changes of albedo on the Tibetan Plateau from 2000 through 2013. A synchronous relationship was found between the change in GSNDVI and GSalbedo over time and across the Tibetan landscapes. We found that the annual average albedo had a decreasing trend, but that the albedo had slightly increased during the nGS and decreased during the GS. Across the landscapes, the nGSalbedo fluctuated in a synchronous pattern with snow/ice cover. Temporally, monthly snow/ice coverage also had a high correspondence with albedo, except in April and October. We detected clear dependencies of albedo on elevation. With the rise in altitude, the nGSalbedo decreased below 4000 m, but increased for elevations of 4500-5500 m. Above 5500 m, the nGSalbedo decreased, which was in accordance with the decreased amount of snow/ice coverage and the increased soil moisture on the plateau. More importantly, the decreasing albedo in the most recent decade appeared to be caused primarily by lowered growing season albedo.
Growing season carries stronger contributions to albedo dynamics on the Tibetan plateau.
Directory of Open Access Journals (Sweden)
Li Tian
Full Text Available The Tibetan Plateau has experienced higher-than-global-average climate warming in recent decades, resulting in many significant changes in ecosystem structure and function. Among them is albedo, which bridges the causes and consequences of land surface processes and climate. The plateau is covered by snow/ice and vegetation in the non-growing season (nGS and growing season (GS, respectively. Based on the MODIS products, we investigated snow/ice cover and vegetation greenness in relation to the spatiotemporal changes of albedo on the Tibetan Plateau from 2000 through 2013. A synchronous relationship was found between the change in GSNDVI and GSalbedo over time and across the Tibetan landscapes. We found that the annual average albedo had a decreasing trend, but that the albedo had slightly increased during the nGS and decreased during the GS. Across the landscapes, the nGSalbedo fluctuated in a synchronous pattern with snow/ice cover. Temporally, monthly snow/ice coverage also had a high correspondence with albedo, except in April and October. We detected clear dependencies of albedo on elevation. With the rise in altitude, the nGSalbedo decreased below 4000 m, but increased for elevations of 4500-5500 m. Above 5500 m, the nGSalbedo decreased, which was in accordance with the decreased amount of snow/ice coverage and the increased soil moisture on the plateau. More importantly, the decreasing albedo in the most recent decade appeared to be caused primarily by lowered growing season albedo.
Aerosol Optical Properties in Southeast Asia From AERONET Observations
Eck, T. F.; Holben, B. N.; Boonjawat, J.; Le, H. V.; Schafer, J. S.; Reid, J. S.; Dubovik, O.; Smirnov, A.
2003-12-01
There is little published data available on measured optical properties of aerosols in the Southeast Asian region. The AERONET project and collaborators commenced monitoring of aerosol optical properties in February 2003 at four sites in Thailand and two sites in Viet Nam to measure the primarily anthropogenic aerosols generated by biomass burning and fossil fuel combustion/ industrial emissions. Automatic sun/sky radiometers at each site measured spectral aerosol optical depth in 7 wavelengths from 340 to 1020 nm and combined with directional radiances in the almucantar, retrievals were made of spectral single scattering albedo and aerosol size distributions. Angstrom exponents, size distributions and spectral single scattering albedo of primarily biomass burning aerosols at rural sites are compared to measurements made at AERONET sites in other major biomass burning regions in tropical southern Africa, South America, and in boreal forest regions. Additionally, the aerosol single scattering albedo and size distributions measured in Bangkok, Thailand are compared with those measured at other urban sites globally. The influences of aerosols originating from other regions outside of Southeast Asia are analyzed using trajectory analyses. Specifically, cases of aerosol transport and mixing from Southern China and from India are presented.
MERIS albedo climatology for FRESCO+ O2 A-band cloud retrieval
Directory of Open Access Journals (Sweden)
Y. Zhou
2011-03-01
Full Text Available A new global albedo climatology for Oxygen A-band cloud retrievals is presented. The climatology is based on MEdium Resolution Imaging Spectrometer (MERIS Albedomap data and its favourable impact on the derivation of cloud fraction is demonstrated for the FRESCO+ (Fast Retrieval Scheme for Clouds from the Oxygen A-band algorithm. To date, a relatively coarse resolution (1° × 1° surface reflectance dataset from GOME (Global Ozone Monitoring Experiment Lambert-equivalent reflectivity (LER is used in FRESCO+. The GOME LER climatology does not account for the usually higher spatial resolution of UV/VIS instruments designed for trace gas remote sensing which introduces several artefacts, e.g. in regions with sharp spectral contrasts like coastlines or over bright surface targets. Therefore, MERIS black-sky albedo (BSA data from the period October 2002 to October 2006 were aggregated to a grid of 0.25° × 0.25° for each month of the year and for different spectral channels. In contrary to other available surface reflectivity datasets, MERIS includes channels at 754 nm and 775 nm which are located close to the spectral windows required for O2 A-band cloud retrievals. The MERIS BSA in the near-infrared compares well to Moderate Resolution Imaging Spectroradiometer (MODIS derived BSA with an average difference lower than 1% and a correlation coefficient of 0.98. However, when relating MERIS BSA to GOME LER a distinctly lower correlation (0.80 and enhanced scatter is found. Effective cloud fractions from two exemplary months (January and July 2006 of Scanning Imaging Absorption Spectrometer for Atmospheric Chartography (SCIAMACHY data were subsequently derived with FRESCO+ and compared to those from the Heidelberg Iterative Cloud Retrieval Utilities (HICRU algorithm. The MERIS climatology generally improves FRESCO+ effective cloud fractions. In particular small cloud fractions are in better agreement with HICRU. This is of importance for atmospheric
Sun, B.; Yang, P.; Kattawar, G. W.; Zhang, X.
2017-12-01
The ice cloud single-scattering properties can be accurately simulated using the invariant-imbedding T-matrix method (IITM) and the physical-geometric optics method (PGOM). The IITM has been parallelized using the Message Passing Interface (MPI) method to remove the memory limitation so that the IITM can be used to obtain the single-scattering properties of ice clouds for sizes in the geometric optics regime. Furthermore, the results associated with random orientations can be analytically achieved once the T-matrix is given. The PGOM is also parallelized in conjunction with random orientations. The single-scattering properties of a hexagonal prism with height 400 (in units of lambda/2*pi, where lambda is the incident wavelength) and an aspect ratio of 1 (defined as the height over two times of bottom side length) are given by using the parallelized IITM and compared to the counterparts using the parallelized PGOM. The two results are in close agreement. Furthermore, the integrated single-scattering properties, including the asymmetry factor, the extinction cross-section, and the scattering cross-section, are given in a completed size range. The present results show a smooth transition from the exact IITM solution to the approximate PGOM result. Because the calculation of the IITM method has reached the geometric regime, the IITM and the PGOM can be efficiently employed to accurately compute the single-scattering properties of ice cloud in a wide spectral range.
Measuring the complex field scattered by single submicron particles
Energy Technology Data Exchange (ETDEWEB)
Potenza, Marco A. C., E-mail: marco.potenza@unimi.it; Sanvito, Tiziano [Department of Physics, University of Milan, via Celoria, 16 – I-20133 Milan (Italy); CIMAINA, University of Milan, via Celoria, 16 – I-20133 Milan (Italy); EOS s.r.l., viale Ortles 22/4, I-20139 Milan (Italy); Pullia, Alberto [Department of Physics, University of Milan, via Celoria, 16 – I-20133 Milan (Italy)
2015-11-15
We describe a method for simultaneous measurements of the real and imaginary parts of the field scattered by single nanoparticles illuminated by a laser beam, exploiting a self-reference interferometric scheme relying on the fundamentals of the Optical Theorem. Results obtained with calibrated spheres of different materials are compared to the expected values obtained through a simplified analytical model without any free parameters, and the method is applied to a highly polydisperse water suspension of Poly(D,L-lactide-co-glycolide) nanoparticles. Advantages with respect to existing methods and possible applications are discussed.
The effect of scattering on single photon transmission of optical angular momentum
International Nuclear Information System (INIS)
Andrews, D L
2011-01-01
Schemes for the communication and registration of optical angular momentum depend on the fidelity of transmission between optical system components. It is known that electron spin can be faithfully relayed between exciton states in quantum dots; it has also been shown by several theoretical and experimental studies that the use of beams conveying orbital angular momentum can significantly extend the density and efficiency of such information transfer. However, it remains unclear to what extent the operation of such a concept at the single photon level is practicable—especially where this involves optical propagation through a material system, in which forward scattering events can intervene. The possibility of transmitting and decoding angular momentum over nanoscale distances itself raises other important issues associated with near-field interrogation. This paper provides a framework to address these and related issues. A quantum electrodynamical representation is constructed and used to pursue the consequences of individual photons, from a Laguerre–Gaussian beam, undergoing single and multiple scattering events in the course of propagation. In this context, issues concerning orbital angular momentum conservation, and its possible compromise, are tackled by identifying the relevant components of the electromagnetic scattering and coupling tensors, using an irreducible Cartesian basis. The physical interpretation broadly supports the fidelity of quantum information transmission, but it also identifies potential limitations of principle
The effect of scattering on single photon transmission of optical angular momentum
Andrews, D. L.
2011-06-01
Schemes for the communication and registration of optical angular momentum depend on the fidelity of transmission between optical system components. It is known that electron spin can be faithfully relayed between exciton states in quantum dots; it has also been shown by several theoretical and experimental studies that the use of beams conveying orbital angular momentum can significantly extend the density and efficiency of such information transfer. However, it remains unclear to what extent the operation of such a concept at the single photon level is practicable—especially where this involves optical propagation through a material system, in which forward scattering events can intervene. The possibility of transmitting and decoding angular momentum over nanoscale distances itself raises other important issues associated with near-field interrogation. This paper provides a framework to address these and related issues. A quantum electrodynamical representation is constructed and used to pursue the consequences of individual photons, from a Laguerre-Gaussian beam, undergoing single and multiple scattering events in the course of propagation. In this context, issues concerning orbital angular momentum conservation, and its possible compromise, are tackled by identifying the relevant components of the electromagnetic scattering and coupling tensors, using an irreducible Cartesian basis. The physical interpretation broadly supports the fidelity of quantum information transmission, but it also identifies potential limitations of principle.
2010-10-12
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0015] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match Number 1016 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...
2012-05-08
...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0010] Privacy Act of 1974, as Amended...
2011-12-12
... Collaboration to Improve the Disability Determination Process: Validation of IRT-CAT tools. Type of Information...; Comment Request; The SSA-NIH Collaboration to Improve the Disability Determination Process: Validation of... being developed to assist in the SSA disability determination process. The utilization of CAT technology...
2010-04-09
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0066] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Internal Revenue Service (IRS))--Match 1305 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...
2010-02-22
... Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503), amended the Privacy... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0006] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Veterans Affairs/Veterans Benefits Administration (VA/ VBA...
2010-09-28
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0040] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Railroad Retirement Board (RRB))--Match Number 1006 AGENCY: Social Security...: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L.) 100-503), amended the...
Anthropogenic desertification by high-albedo pollution Observations and modeling
Otterman, J.; Rosenberg, N. W.; Rosenberg, E.
1974-01-01
ERTS-1 MSS albedo data of Western Negev, Sinai and the Gaza strip are presented. A sharp contrast in albedo exists across the Negev-Sinai and Negev-Gaza strip borders. Anthropogenic desertification has occurred on the Arab side due to overgrazing and Bedouin agriculture, whereas natural vegetation grows much more abundantly on the Israeli side.
Albedo enhancement over land to counteract global warming: impacts on hydrological cycle
Energy Technology Data Exchange (ETDEWEB)
Bala, Govindasamy; Nag, Bappaditya [Indian Institute of Science, Divecha Center for Climate Change and Center for Atmospheric and Oceanic Sciences, Bangalore (India)
2012-09-15
A recent modelling study has shown that precipitation and runoff over land would increase when the reflectivity of marine clouds is increased to counter global warming. This implies that large scale albedo enhancement over land could lead to a decrease in runoff over land. In this study, we perform simulations using NCAR CAM3.1 that have implications for Solar Radiation Management geoengineering schemes that increase the albedo over land. We find that an increase in reflectivity over land that mitigates the global mean warming from a doubling of CO{sub 2} leads to a large residual warming in the southern hemisphere and cooling in the northern hemisphere since most of the land is located in northern hemisphere. Precipitation and runoff over land decrease by 13.4 and 22.3%, respectively, because of a large residual sinking motion over land triggered by albedo enhancement over land. Soil water content also declines when albedo over land is enhanced. The simulated magnitude of hydrological changes over land are much larger when compared to changes over oceans in the recent marine cloud albedo enhancement study since the radiative forcing over land needed (-8.2 W m{sup -2}) to counter global mean radiative forcing from a doubling of CO{sub 2} (3.3 W m{sup -2}) is approximately twice the forcing needed over the oceans (-4.2 W m{sup -2}). Our results imply that albedo enhancement over oceans produce climates closer to the unperturbed climate state than do albedo changes on land when the consequences on land hydrology are considered. Our study also has important implications for any intentional or unintentional large scale changes in land surface albedo such as deforestation/afforestation/reforestation, air pollution, and desert and urban albedo modification. (orig.)
Resonant stimulation of Raman scattering from single-crystal thiophene/phenylene co-oligomers
International Nuclear Information System (INIS)
Yanagi, Hisao; Marutani, Yusuke; Matsuoka, Naoki; Hiramatsu, Toru; Ishizumi, Atsushi; Sasaki, Fumio; Hotta, Shu
2013-01-01
Amplified Raman scattering was observed from single crystals of thiophene/phenylene co-oligomers (TPCOs). Under ns-pulsed excitation, the TPCO crystals exhibited amplified spontaneous emission (ASE) at resonant absorption wavelengths. With increasing excitation wavelength to the 0-0 absorption edge, the stimulated resonant Raman peaks appeared both in the 0-1 and 0-2 ASE band regions. When the excitation wavelength coincided with the 0-1 ASE band energy, the Raman peaks selectively appeared in the 0-2 ASE band. Such unusual enhancement of the 0-2 Raman scattering was ascribed to resonant stimulation via vibronic coupling with electronic transitions in the uniaxially oriented TPCO molecules
The Ångström Exponent and Turbidity of Soot Component in the ...
African Journals Online (AJOL)
OPAC) using FORTRAN program to model the effect of soot on optical depth, scattering coefficient, absorption coefficient, single scattering albedo, extinction coefficient and asymmetry parameter at spectral range of 0.25 to 1.00 ƒÝm for eight ...
Field measurement of albedo for limited extent test surfaces
Energy Technology Data Exchange (ETDEWEB)
Sailor, David J. [Portland State University, Department of Mechanical and Materials Engineering, P.O. Box 751-ME, Portland, OR 97207 (United States); Resh, Kyle; Segura, Del [Tulane University, Department of Mechanical Engineering, 400 Lindy Boggs Center, New Orleans, LA 70118 (United States)
2006-05-15
A new method is introduced for field measurement of surface albedo. This method consists of the use of a cylindrical shade ring made of opaque fabric with a known (low) albedo placed over a test surface. The albedo measurement is accomplished using two small pyranometers situated so that the downward-facing pyranometer receives radiation only from the test surface and the shade ring. The upward-facing pyranometer simultaneously records the incoming solar radiation. The radiation received by the downward-facing pyramometer is a combination of reflected radiation from shaded and unshaded portions of these two surfaces, requiring detailed accounting of the resulting view factor geometries. The method presented here improves upon past approaches by allowing for smaller sample sizes, minimizing errors associated with reflective properties of the surroundings, and allowing for accurate measurements even under partially cloudy skies. In addition to these methodological improvements we introduce an approach for estimating the uncertainty in the resulting albedo measurements. Results from field measurements are presented to validate the measurement protocol, and to compare its accuracy with the accuracy of a published standard. (author)
Mimicking biochar-albedo feedback in complex Mediterranean agricultural landscapes
International Nuclear Information System (INIS)
Bozzi, E; Genesio, L; Miglietta, F; Toscano, P; Pieri, M
2015-01-01
Incorporation of charcoal produced by biomass pyrolysis (biochar) in agricultural soils is a potentially sustainable strategy for climate change mitigation. However, some side effects of large-scale biochar application need to be investigated. In particular a massive use of a low-reflecting material on large cropland areas may impact the climate via changes in surface albedo. Twelve years of MODIS-derived albedo data were analysed for three pairs of selected agricultural sites in central Italy. In each pair bright and dark coloured soil were identified, mimicking the effect of biochar application on the land surface albedo of complex agricultural landscapes. Over this period vegetation canopies never completely masked differences in background soil colour. This soil signal, expressed as an albedo difference, induced a local instantaneous radiative forcing of up to 4.7 W m −2 during periods of high solar irradiance. Biochar mitigation potential might therefore be reduced up to ∼30%. This study proves the importance of accounting for crop phenology and crop management when assessing biochar mitigation potential and provides more insights into the analysis of its environmental feedback. (letter)
Sumlin, Benjamin J.; Heinson, Yuli W.; Shetty, Nishit; Pandey, Apoorva; Pattison, Robert S.; Baker, Stephen; Hao, Wei Min; Chakrabarty, Rajan K.
2018-02-01
Constraining the complex refractive indices, optical properties and size of brown carbon (BrC) aerosols is a vital endeavor for improving climate models and satellite retrieval algorithms. Smoldering wildfires are the largest source of primary BrC, and fuel parameters such as moisture content, source depth, geographic origin, and fuel packing density could influence the properties of the emitted aerosol. We measured in situ spectral (375-1047 nm) optical properties of BrC aerosols emitted from smoldering combustion of Boreal and Indonesian peatlands across a range of these fuel parameters. Inverse Lorenz-Mie algorithms used these optical measurements along with simultaneously measured particle size distributions to retrieve the aerosol complex refractive indices (m = n + iκ). Our results show that the real part n is constrained between 1.5 and 1.7 with no obvious functionality in wavelength (λ), moisture content, source depth, or geographic origin. With increasing λ from 375 to 532 nm, κ decreased from 0.014 to 0.003, with corresponding increase in single scattering albedo (SSA) from 0.93 to 0.99. The spectral variability of κ follows the Kramers-Kronig dispersion relation for a damped harmonic oscillator. For λ ≥ 532 nm, both κ and SSA showed no spectral dependency. We discuss differences between this study and previous work. The imaginary part κ was sensitive to changes in FPD, and we hypothesize mechanisms that might help explain this observation.
Directory of Open Access Journals (Sweden)
D. Goto
2011-05-01
Full Text Available Aerosols have great impacts on atmospheric environment, human health, and earth's climate. Therefore, information on their spatial and temporal distribution is of paramount importance. Despite numerous studies have examined the variation and trends of BC and AOD over India, only very few have focused on their spatial distribution or even correlating the observations with model simulations. In the present study, a three-dimensional aerosol transport-radiation model coupled with a general circulation model. SPRINTARS, simulated atmospheric aerosol distributions including BC and aerosol optical properties, i.e., aerosol optical thickness (AOT, Ångström Exponent (AE, and single scattering albedo (SSA. The simulated results are compared with both BC measurements by aethalometer and aerosol optical properties measured by ground-based skyradiometer and by satellite sensor, MODIS/Terra over Hyderabad, which is a tropical urban area of India, for the year 2008. The simulated AOT and AE in Hyderabad are found to be comparable to ground-based measured ones. The simulated SSA tends to be higher than the ground-based measurements. Both these comparisons of aerosol optical properties between the simulations with different emission inventories and the measurements indicate that, firstly the model uncertainties derived from aerosol emission inventory cannot explain the gaps between the simulations and the measurements and secondly the vertical transport of BC and the treatment of BC-containing particles can be the main issue in the global model to solve the gap.
Houspanossian, J.; Kuppel, S.; Gimenez, R.; Jobbagy, E. G.; Nosetto, M. D.
2014-12-01
The increase in surface albedo inherent to land clearing and cultivation (land-cover change, LCC) in the subtropical dry forests of the South American Chaco offsets part of the radiative forcing (RF) of the related carbon emissions. The magnitude of these albedo changes, however, is also dependent on shifts in agricultural practices (land-management change, LMC) and will influence the net effect on Earth's radiation balance as well as other potential feedbacks on climate. We quantified the surface albedo changes between 2001 and 2013 and the consequent shifts in the radiation balance resulting from LCC and LMC, using MODIS imagery a columnar radiation model parameterized with satellite data. Agricultural systems replacing dry forests presented a large variety of managements, ranging from pasture systems with remnant trees to different grain crops, displaying a wide range of phenologies. Cultivated lands showed higher and more variable albedo values (mean = 0.162, Standard Deviation = 0.013, n = 10,000 pixels) than the dry forests they replace (mean = 0.113, SD = 0.010, n = 10,000). These albedo contrasts resulted in a cooling RF of deforestation of -10.1 W m-2 on average, but both livestock and grain crop production systems showed large differences among the different land management options. For instance, livestock systems based on open pasture lands showed higher albedo change and RF (0.06 and -16.3 W m-2, respectively) than silvopastoral systems (0.02 and -4.4 W m-2). Similarly in cropping systems, the replacement of double-cropping by single summer crops, a widespread process in the region lately, resulted in higher albedo change (0.06 vs. 0.08) and RF (-16.3 vs. -22.3 W m-2). Although the effects of LCC on climate are widely acknowledged, those of LMC are still scarcely understood. In the Chaco region, the latter could play an important role and offer a yet-overlooked pathway to influence the radiative balance of our planet.
Energy Technology Data Exchange (ETDEWEB)
Waidyawansa, Dinayadura Buddhini [Ohio Univ., Athens, OH (United States)
2013-08-01
The beam normal single spin asymmetry generated in the scattering of transversely polarized electrons from unpolarized nucleons is an observable of the imaginary part of the two-photon exchange process. Moreover, it is a potential source of false asymmetry in parity violating electron scattering experiments. The Q{sub weak} experiment uses parity violating electron scattering to make a direct measurement of the weak charge of the proton. The targeted 4% measurement of the weak charge of the proton probes for parity violating new physics beyond the Standard Model. The beam normal single spin asymmetry at Q{sub weak} kinematics is at least three orders of magnitude larger than 5 ppb precision of the parity violating asymmetry. To better understand this parity conserving background, the Q{sub weak} Collaboration has performed elastic scattering measurements with fully transversely polarized electron beam on the proton and aluminum. This dissertation presents the analysis of the 3% measurement (1.3% statistical and 2.6% systematic) of beam normal single spin asymmetry in electronproton scattering at a Q2 of 0.025 (GeV/c)2. It is the most precise existing measurement of beam normal single spin asymmetry available at the time. A measurement of this precision helps to improve the theoretical models on beam normal single spin asymmetry and thereby our understanding of the doubly virtual Compton scattering process.
Sea ice roughness: the key for predicting Arctic summer ice albedo
Landy, J.; Ehn, J. K.; Tsamados, M.; Stroeve, J.; Barber, D. G.
2017-12-01
Although melt ponds on Arctic sea ice evolve in stages, ice with smoother surface topography typically allows the pond water to spread over a wider area, reducing the ice-albedo and accelerating further melt. Building on this theory, we simulated the distribution of meltwater on a range of statistically-derived topographies to develop a quantitative relationship between premelt sea ice surface roughness and summer ice albedo. Our method, previously applied to ICESat observations of the end-of-winter sea ice roughness, could account for 85% of the variance in AVHRR observations of the summer ice-albedo [Landy et al., 2015]. Consequently, an Arctic-wide reduction in sea ice roughness over the ICESat operational period (from 2003 to 2008) explained a drop in ice-albedo that resulted in a 16% increase in solar heat input to the sea ice cover. Here we will review this work and present new research linking pre-melt sea ice surface roughness observations from Cryosat-2 to summer sea ice albedo over the past six years, examining the potential of winter roughness as a significant new source of sea ice predictability. We will further evaluate the possibility for high-resolution (kilometre-scale) forecasts of summer sea ice albedo from waveform-level Cryosat-2 roughness data in the landfast sea ice zone of the Canadian Arctic. Landy, J. C., J. K. Ehn, and D. G. Barber (2015), Albedo feedback enhanced by smoother Arctic sea ice, Geophys. Res. Lett., 42, 10,714-10,720, doi:10.1002/2015GL066712.
2012-06-01
...; Computer Matching Program (SSA/ Department of Homeland Security (DHS))--Match Number 1010 AGENCY: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program that... amended by the Computer Matching and Privacy Protection Act of 1988, as amended, and the regulations and...
2013-02-21
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0067] Privacy Act of 1974; Computer Matching... Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching program... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...
2012-08-17
...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer-matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0021] Privacy Act of 1974, as Amended...
2013-11-21
...: Social Security Administration (SSA). ACTION: Notice of a renewal of an existing computer matching... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L 100-503), amended the... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2013-0059] Privacy Act of 1974, as Amended...
2010-06-09
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0077] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Office of Personnel Management (OPM))--Match 1307 AGENCY: Social Security... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Public Law (Pub. L.) 100-503...
A Single Image Dehazing Method Using Average Saturation Prior
Directory of Open Access Journals (Sweden)
Zhenfei Gu
2017-01-01
Full Text Available Outdoor images captured in bad weather are prone to yield poor visibility, which is a fatal problem for most computer vision applications. The majority of existing dehazing methods rely on an atmospheric scattering model and therefore share a common limitation; that is, the model is only valid when the atmosphere is homogeneous. In this paper, we propose an improved atmospheric scattering model to overcome this inherent limitation. By adopting the proposed model, a corresponding dehazing method is also presented. In this method, we first create a haze density distribution map of a hazy image, which enables us to segment the hazy image into scenes according to the haze density similarity. Then, in order to improve the atmospheric light estimation accuracy, we define an effective weight assignment function to locate a candidate scene based on the scene segmentation results and therefore avoid most potential errors. Next, we propose a simple but powerful prior named the average saturation prior (ASP, which is a statistic of extensive high-definition outdoor images. Using this prior combined with the improved atmospheric scattering model, we can directly estimate the scene atmospheric scattering coefficient and restore the scene albedo. The experimental results verify that our model is physically valid, and the proposed method outperforms several state-of-the-art single image dehazing methods in terms of both robustness and effectiveness.
Inclusion of Solar Elevation Angle in Land Surface Albedo Parameterization Over Bare Soil Surface.
Zheng, Zhiyuan; Wei, Zhigang; Wen, Zhiping; Dong, Wenjie; Li, Zhenchao; Wen, Xiaohang; Zhu, Xian; Ji, Dong; Chen, Chen; Yan, Dongdong
2017-12-01
Land surface albedo is a significant parameter for maintaining a balance in surface energy. It is also an important parameter of bare soil surface albedo for developing land surface process models that accurately reflect diurnal variation characteristics and the mechanism behind the solar spectral radiation albedo on bare soil surfaces and for understanding the relationships between climate factors and spectral radiation albedo. Using a data set of field observations, we conducted experiments to analyze the variation characteristics of land surface solar spectral radiation and the corresponding albedo over a typical Gobi bare soil underlying surface and to investigate the relationships between the land surface solar spectral radiation albedo, solar elevation angle, and soil moisture. Based on both solar elevation angle and soil moisture measurements simultaneously, we propose a new two-factor parameterization scheme for spectral radiation albedo over bare soil underlying surfaces. The results of numerical simulation experiments show that the new parameterization scheme can more accurately depict the diurnal variation characteristics of bare soil surface albedo than the previous schemes. Solar elevation angle is one of the most important factors for parameterizing bare soil surface albedo and must be considered in the parameterization scheme, especially in arid and semiarid areas with low soil moisture content. This study reveals the characteristics and mechanism of the diurnal variation of bare soil surface solar spectral radiation albedo and is helpful in developing land surface process models, weather models, and climate models.
Quantifying the missing link between forest albedo and productivity in the boreal zone
Hovi, Aarne; Liang, Jingjing; Korhonen, Lauri; Kobayashi, Hideki; Rautiainen, Miina
2016-11-01
Albedo and fraction of absorbed photosynthetically active radiation (FAPAR) determine the shortwave radiation balance and productivity of forests. Currently, the physical link between forest albedo and productivity is poorly understood, yet it is crucial for designing optimal forest management strategies for mitigating climate change. We investigated the relationships between boreal forest structure, albedo and FAPAR using a radiative transfer model called Forest Reflectance and Transmittance model FRT and extensive forest inventory data sets ranging from southern boreal forests to the northern tree line in Finland and Alaska (N = 1086 plots). The forests in the study areas vary widely in structure, species composition, and human interference, from intensively managed in Finland to natural growth in Alaska. We show that FAPAR of tree canopies (FAPARCAN) and albedo are tightly linked in boreal coniferous forests, but the relationship is weaker if the forest has broadleaved admixture, or if canopies have low leaf area and the composition of forest floor varies. Furthermore, the functional shape of the relationship between albedo and FAPARCAN depends on the angular distribution of incoming solar irradiance. We also show that forest floor can contribute to over 50 % of albedo or total ecosystem FAPAR. Based on our simulations, forest albedos can vary notably across the biome. Because of larger proportions of broadleaved trees, the studied plots in Alaska had higher albedo (0.141-0.184) than those in Finland (0.136-0.171) even though the albedo of pure coniferous forests was lower in Alaska. Our results reveal that variation in solar angle will need to be accounted for when evaluating climate effects of forest management in different latitudes. Furthermore, increasing the proportion of broadleaved trees in coniferous forests is the most important means of maximizing albedo without compromising productivity: based on our findings the potential of controlling forest
NLCD - MODIS land cover- albedo dataset for the continental United States
U.S. Environmental Protection Agency — The NLCD-MODIS land cover-albedo database integrates high-quality MODIS albedo observations with areas of homogeneous land cover from NLCD. The spatial resolution...
Sun, Tianze; Che, Huizheng; Qi, Bing; Wang, Yaqiang; Dong, Yunsheng; Xia, Xiangao; Wang, Hong; Gui, Ke; Zheng, Yu; Zhao, Hujia; Ma, Qianli; Du, Rongguang; Zhang, Xiaoye
2018-03-01
The climatological variation of aerosol properties and the planetary boundary layer (PBL) during 2013-2015 over the Yangtze River Delta (YRD) region were investigated by employing ground-based Micro Pulse Lidar (MPL) and CE-318 sun-photometer observations. Combining Moderate Resolution Imaging Spectroradiometer (MODIS) and Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observation (CALIPSO) satellite products, enhanced haze pollution events affected by different types of aerosol over the YRD region were analyzed through vertical structures, spatial distributions, backward trajectories, and the potential source contribution function (PSCF) model. The results show that aerosols in the YRD are dominated by fine-mode particles, except in March. The aerosol optical depth (AOD) in June and September is higher due to high single scattering albedo (SSA) from hygroscopic growth, but it is lower in July and August due to wet deposition from precipitation. The PBL height (PBLH) is greater (means ranging from 1.23 to 1.84 km) and more variable in the warmer months of March to August, due to the stronger diurnal cycle and exchange of heat. Northern fine-mode pollutants are brought to the YRD at a height of 1.5 km. The SSA increases, blocking the radiation to the surface, and cooling the surface, thereby weakening turbulence, lowering the PBL, and in turn accelerating the accumulation of pollutants, creating a feedback to the cooling effect. Originated from the deserts in Xinjiang and Inner Mongolia, long-range transported dust masses are seen at heights of about 2 km over the YRD region with an SSA440 nm below 0.84, which heat air and raise the PBL, accelerating the diffusion of dust particles. Regional transport from biomass-burning spots to the south of the YRD region bring mixed aerosol particles at a height below 1.5 km, resulting in an SSA440 nm below 0.89. During the winter, the accumulation of the local emission layer is facilitated by stable weather conditions
Impacts of Synoptic Weather Patterns on Snow Albedo at Sites in New England
Adolph, A. C.; Albert, M. R.; Lazarcik, J.; Dibb, J. E.; Amante, J.; Price, A. N.
2015-12-01
Winter snow in the northeastern United States has changed over the last several decades, resulting in shallower snow packs, fewer days of snow cover and increasing precipitation falling as rain in the winter. In addition to these changes which cause reductions in surface albedo, increasing winter temperatures also lead to more rapid snow grain growth, resulting in decreased snow reflectivity. We present in-situ measurements and analyses to test the sensitivity of seasonal snow albedo to varying weather conditions at sites in New England. In particular, we investigate the impact of temperature on snow albedo through melt and grain growth, the impact of precipitation event frequency on albedo through snow "freshening," and the impact of storm path on snow structure and snow albedo. Over three winter seasons between 2013 and 2015, in-situ snow characterization measurements were made at three non-forested sites across New Hampshire. These near-daily measurements include spectrally resolved albedo, snow optical grain size determined through contact spectroscopy, snow depth, snow density and local meteorological parameters. Combining this information with storm tracks derived from HYSPLIT modeling, we quantify the current sensitivity of northeastern US snow albedo to temperature as well as precipitation type, frequency and path. Our analysis shows that southerly winter storms result in snow with a significantly lower albedo than storms which come from across the continental US or the Atlantic Ocean. Interannual variability in temperature and statewide spatial variability in snowfall rates at our sites show the relative importance of snowfall amount and temperatures in albedo evolution over the course of the winter.
Improvement of Mars surface snow albedo modeling in LMD Mars GCM with SNICAR
Singh, D.; Flanner, M.; Millour, E.
2017-12-01
The current version of Laboratoire de Météorologie Dynamique (LMD) Mars GCM (original-MGCM) uses annually repeating (prescribed) albedo values from the Thermal Emission Spectrometer observations. We integrate the Snow, Ice, and Aerosol Radiation (SNICAR) model with MGCM (SNICAR-MGCM) to prognostically determine H2O and CO2 ice cap albedos interactively in the model. Over snow-covered regions mean SNICAR-MGCM albedo is higher by about 0.034 than original-MGCM. Changes in albedo and surface dust content also impact the shortwave energy flux at the surface. SNICAR-MGCM model simulates a change of -1.26 W/m2 shortwave flux on a global scale. Globally, net CO2 ice deposition increases by about 4% over one Martian annual cycle as compared to original-MGCM simulations. SNICAR integration reduces the net mean global surface temperature, and the global surface pressure of Mars by about 0.87% and 2.5% respectively. Changes in albedo also show a similar distribution as dust deposition over the globe. The SNICAR-MGCM model generates albedos with higher sensitivity to surface dust content as compared to original-MGCM. For snow-covered regions, we improve the correlation between albedo and optical depth of dust from -0.91 to -0.97 with SNICAR-MGCM as compared to original-MGCM. Using new diagnostic capabilities with this model, we find that cryospheric surfaces (with dust) increase the global surface albedo of Mars by 0.022. The cryospheric effect is severely muted by dust in snow, however, which acts to decrease the planet-mean surface albedo by 0.06.
Polarized Raman scattering of single ZnO nanorod
International Nuclear Information System (INIS)
Yu, J. L.; Lai, Y. F.; Wang, Y. Z.; Cheng, S. Y.; Chen, Y. H.
2014-01-01
Polarized Raman scattering measurement on single wurtzite c-plane (001) ZnO nanorod grown by hydrothermal method has been performed at room temperature. The polarization dependence of the intensity of the Raman scattering for the phonon modes A 1 (TO), E 1 (TO), and E 2 high in the ZnO nanorod are obtained. The deviations of polarization-dependent Raman spectroscopy from the prediction of Raman selection rules are observed, which can be attributed to the structure defects in the ZnO nanorod as confirmed by the comparison of the transmission electron microscopy, photoluminescence spectra as well as the polarization dependent Raman signal of the annealed and unannealed ZnO nanorod. The Raman tensor elements of A 1 (TO) and E 1 (TO) phonon modes normalized to that of the E 2 high phonon mode are |a/d|=0.32±0.01, |b/d|=0.49±0.02, and |c/d|=0.23±0.01 for the unannealed ZnO nanorod, and |a/d|=0.33±0.01, |b/d|=0.45±0.01, and |c/d|=0.20±0.01 for the annealed ZnO nanorod, which shows strong anisotropy compared to that of bulk ZnO epilayer
2010-11-05
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...
The Ultraviolet Albedo of Ganymede
McGrath, Melissa; Hendrix, A.
2013-10-01
A large set of ultraviolet images of Ganymede have been acquired with the Hubble Space Telescope over the last 15 years. These images have been used almost exclusively to study Ganymede’s stunning auroral emissions (Feldman et al. 2000; Eviatar et al. 2001; McGrath et al. 2004; Saur et al. 2011; McGrath et al. 2013), and even the most basic information about Ganymede’s UV albedo has yet to be gleaned from these data. We will present a first-cut analysis of both disk-averaged and spatially-resolved UV albedos of Ganymede, with focus on the spatially-resolved Lyman-alpha albedo, which has never been considered previously for this satellite. Ganymede's visibly bright regions are known to be rich in water ice, while the visibly dark regions seem to be more carbonaceous (Carlson et al., 1996). At Lyman-alpha, these two species should also have very different albedo values. References Carlson, R. and 39 co-authors, Near-infrared spectroscopy and spectral mapping of Jupiter and the Galilean satellites: Results from Galileo’s initial orbit, Science, 274, 385-388, 1996. Eviatar, A., D. F. Strobel, B. C. Wolven, P. D. Feldman, M. A. McGrath, and D. J. Williams, Excitation of the Ganymede ultraviolet aurora, Astrophys. J, 555, 1013-1019, 2001. Feldman, P. D., M. A. McGrath, D. F. Strobel, H. W. Moos, K. D. Retherford, and B. C. Wolven, HST/STIS imaging of ultraviolet aurora on Ganymede, Astrophys. J, 535, 1085-1090, 2000. McGrath M. A., Lellouch E., Strobel D. F., Feldman P. D., Johnson R. E., Satellite Atmospheres, Chapter 19 in Jupiter: The Planet, Satellites and Magnetosphere, ed. F. Bagenal, T. Dowling, W. McKinnon, Cambridge University Press, 2004. McGrath M. A., Jia, Xianzhe; Retherford, Kurt; Feldman, Paul D.; Strobel, Darrell F.; Saur, Joachim, Aurora on Ganymede, J. Geophys. Res., doi: 10.1002/jgra.50122, 2013. Saur, J., S. Duling, S., L. Roth, P. D. Feldman, D. F. Strobel, K. D. Retherford, M. A. McGrath, A. Wennmacher, American Geophysical Union, Fall Meeting
Surface albedo in different land-use and cover types in Amazon forest region
Directory of Open Access Journals (Sweden)
Thiago de Oliveira Faria
2018-05-01
Full Text Available Albedo is the portion of energy from the Sun that is reflected by the earth's surface, thus being an important variable that controls climate and energy processes on Earth. Surface albedo is directly related to the characteristics of the Earth’s surface materials, making it a useful parameter to evaluate the effects of original soil cover replacement due to human occupation. This study evaluated the changes in the surface albedo values due to the conversion of vegetation to other land uses and to analyze the applicability of the use of albedo in the spatial delimitation of land-use classes in the transitional region between the Cerrado and Amazon biomes. Surface albedo measurements were obtained from processing of Landsat Thematic Mapper data in the Geographic Information System (GIS, and land-use information were collected using Google Earth high-resolution images. The results show that human activities such as the cultivation of crops and burning have contributed substantially to variations in the surface albedo, and that albedo estimates from Landsat imagery have the potential to help in the recognition and delimitation of features of land use and cover.
Comparison of scatter doses from a multislice and a single slice CT scanner
International Nuclear Information System (INIS)
Burrage, J. W.; Causer, D. A.
2006-01-01
During shielding calculations for a new multislice CT (MSCT) scanner it was found that the manufacturer's data indicated significantly higher external scatter doses than would be generated for a single slice CT (SSCT). Even allowing for increased beam width, the manufacturer's data indicated that the scatter dose per scan was higher by a factor of about 3 to 4. The magnitude of the discrepancy was contrary to expectations and also contrary to a statement by the UK ImPACT group, which indicated that when beam width is taken into account, the scatter doses should be similar. The matter was investigated by comparing scatter doses from an SSCT and an MSCT. Scatter measurements were performed at three points using a standard perspex CTDI phantom, and CT dose indices were also measured to compare scanner output. MSCT measurements were performed with a 40 mm wide beam, SSCT measurements with a 10 mm wide beam. A film badge survey was also performed after the installation of the MSCT scanner to assess the adequacy of lead shielding in the room. It was found that the scatter doses from the MSCT were lower than indicated by the manufacturer's data. MSCT scatter doses were approximately 4 times higher than those from the SSCT, consistent with expectations due to beam width differences. The CT dose indices were similar, and the film badge survey indicated that the existing shielding, which had been adequate for the SSCT, was also adequate for the MSCT
LLL development of a combined etch track: albedo dosimeter
International Nuclear Information System (INIS)
Griffith, R.V.; Fisher, J.C.; Harder, C.A.
1977-01-01
The addition of polycarbonate sheet to albedo detectors for electrochemical etching provides a simple, inexpensive way to reduce the spectral sensitivity of the personnel dosimeter without losing the albedo features of sensitivity and ease of automation. The ECEP technique also provides the dosimetrist with the potential for identifying conditions of body orientation that might otherwise lead to significant error in dosimeter evaluation
Albedo decline on Greenland's Mittivakkat Gletscher in a warming climate
DEFF Research Database (Denmark)
Mernild, Sebastian H; Malmros, Jeppe K.; Yde, Jacob Clement
2015-01-01
Albedo is one of the parameters that govern energy availability for snow and ice surface ablation, and subsequently the surface mass balance conditions of temperate glaciers and ice caps (GIC). Here, we document snow and ice albedo changes for Mittivakkat Gletscher (MG) in Southeast Greenland (20...
Xu, Xiaoguang; Wang, Jun; Zeng, Jing; Spurr, Robert; Liu, Xiong; Dubovik, Oleg; Li, Li; Li, Zhengqiang; Mishchenko, Michael I.; Siniuk, Aliaksandr;
2015-01-01
A new research algorithm is presented here as the second part of a two-part study to retrieve aerosol microphysical properties from the multispectral and multiangular photopolarimetric measurements taken by Aerosol Robotic Network's (AERONET's) new-generation Sun photometer. The algorithm uses an advanced UNified and Linearized Vector Radiative Transfer Model and incorporates a statistical optimization approach.While the new algorithmhas heritage from AERONET operational inversion algorithm in constraining a priori and retrieval smoothness, it has two new features. First, the new algorithmretrieves the effective radius, effective variance, and total volume of aerosols associated with a continuous bimodal particle size distribution (PSD) function, while the AERONET operational algorithm retrieves aerosol volume over 22 size bins. Second, our algorithm retrieves complex refractive indices for both fine and coarsemodes,while the AERONET operational algorithm assumes a size-independent aerosol refractive index. Mode-resolved refractive indices can improve the estimate of the single-scattering albedo (SSA) for each aerosol mode and thus facilitate the validation of satellite products and chemistry transport models. We applied the algorithm to a suite of real cases over Beijing_RADI site and found that our retrievals are overall consistent with AERONET operational inversions but can offer mode-resolved refractive index and SSA with acceptable accuracy for the aerosol composed by spherical particles. Along with the retrieval using both radiance and polarization, we also performed radiance-only retrieval to demonstrate the improvements by adding polarization in the inversion. Contrast analysis indicates that with polarization, retrieval error can be reduced by over 50% in PSD parameters, 10-30% in the refractive index, and 10-40% in SSA, which is consistent with theoretical analysis presented in the companion paper of this two-part study.
DISCUS, Neutron Single to Double Scattering Ratio in Inelastic Scattering Experiment by Monte-Carlo
International Nuclear Information System (INIS)
Johnson, M.W.
1993-01-01
1 - Description of problem or function: DISCUS calculates the ratio of once-scattered to twice-scattered neutrons detected in an inelastic neutron scattering experiment. DISCUS also calculates the flux of once-scattered neutrons that would have been observed if there were no absorption in the sample and if, once scattered, the neutron would emerge without further re-scattering or absorption. Three types of sample geometry are used: an infinite flat plate, a finite flat plate or a finite length cylinder. (The infinite flat plate is included for comparison with other multiple scattering programs.) The program may be used for any sample for which the scattering law is of the form S(/Q/, omega). 2 - Method of solution: Monte Carlo with importance sampling is used. Neutrons are 'forced' both into useful angular trajectories, and useful energy bins. Biasing of the collision point according to the point of entry of the neutron into the sample is also utilised. The first and second order scattered neutron fluxes are calculated in independent histories. For twice-scattered neutron histories a square distribution in Q-omega space is used to sample the neutron coming from the first scattering event, whilst biasing is used for the second scattering event. (A square distribution is used so as to obtain reasonable inelastic-inelastic statistics.) 3 - Restrictions on the complexity of the problem: Unlimited number of detectors. Max. size of (Q, omega) matrix is 39*149. Max. number of points in momentum space for the scattering cross section is 199
Directory of Open Access Journals (Sweden)
Andión, L. G.ª
2006-06-01
Full Text Available The article describes a study conducted to determinecorrosion in reinforcement embedded in Portland cement(PC mortars with different percentages of sewage sludgeash (SSA admixtures. The polarization resistancetechnique was used to determine the steel corrosion rate(Icorr in the test specimens. The samples were subjectedto different environmental conditions and aggressiveagents: 100% relative humidity (RH, accelerated carbonationat 70% RH and seawater immersion. Portlandcement was partially substituted for SSA in the mixes atrates of 0, 10, 20, 30 and 60% (by mass to make thedifferent mortars. The results show that where cementwas replaced by SSA at rates of up to 10% by mass,mortar corrosion performance was comparable to thebehaviour observed in SSA-free mortars (control mortar:0% SSA. Data for higher rates are also shown. From themechanical standpoint, SSA exhibited moderate pozzolanicactivity and the best performance when SSA wasadded at a rate of 10% to mixes with a water/(binder:PC + SSA (w/b ratio of 0.5.Se ha estudiado el nivel de corrosion que presentan lasarmaduras embebidas en morteros fabricados con cementoPortland (CP con diferentes porcentajes de sustitucion deceniza de lodo de depuradora (CLD. Se ha utilizado la tecnicade la Resistencia a la Polarizacion para determinar lavelocidad de corrosion del acero embebido en las muestrasestudiadas. Las muestras se han sometido a diferentes condicionesambientales y agentes agresivos: 100% de humedadrelativa (HR, carbonatacion acelerada al 70% HR einmersion en agua de mar. Para la fabricacion de los distintosmorteros, el cemento Portland ha sido parcialmente sustituidopor CLD en los siguientes porcentajes en masa: 0,10, 20, 30 y 60%. Los resultados muestran que sustitucionesde cemento por CLD de hasta el 10% en masa no alteranel comportamiento frente a la corrosion de los morterosal compararlos con los morteros libres de CLD (morteroscontrol: 0% de sustitucion de cemento por CLD. Se
BOREAS TF-06 SSA-YA Surface Energy Flux and Meteorological Data
National Aeronautics and Space Administration — ABSTRACT: Contains meteorology data collected at the SSA-YA tower flux site by the TF6 group. These data were reported at 10 minute intervals. The flux and ancillary...
ARM Climate Research Facility Spectral Surface Albedo Value-Added Product (VAP) Report
Energy Technology Data Exchange (ETDEWEB)
McFarlane, S; Gaustad, K; Long, C; Mlawer, E
2011-07-15
This document describes the input requirements, output data products, and methodology for the Spectral Surface Albedo (SURFSPECALB) value-added product (VAP). The SURFSPECALB VAP produces a best-estimate near-continuous high spectral resolution albedo data product using measurements from multifilter radiometers (MFRs). The VAP first identifies best estimates for the MFR downwelling and upwelling shortwave irradiance values, and then calculates narrowband spectral albedo from these best-estimate irradiance values. The methodology for finding the best-estimate values is based on a simple process of screening suspect data and backfilling screened and missing data with estimated values when possible. The resulting best-estimate MFR narrowband spectral albedos are used to determine a daily surface type (snow, 100% vegetation, partial vegetation, or 0% vegetation). For non-snow surfaces, a piecewise continuous function is used to estimate a high spectral resolution albedo at 1 min temporal and 10 cm-1 spectral resolution.
2012-04-25
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0084] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1003 AGENCY: Social Security... above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988...
Surface albedo following biochar application in durum wheat
International Nuclear Information System (INIS)
Genesio, L; Miglietta, F; Lugato, E; Baronti, S; Pieri, M; Vaccari, F P
2012-01-01
The agronomic use of charcoal from biomass pyrolysis (biochar) represents an interesting option for increasing soil fertility and sequestering atmospheric CO 2 . However, before moving toward large-scale biochar applications, additional research must evaluate all possible land–atmosphere feedbacks. Despite the increasing number of studies investigating the effect of biochar on soil physical, chemical and biological properties, only a few have been done on surface albedo variations on agricultural lands. The present work had the aim of characterizing the annual albedo cycle for a durum wheat crop in Central Italy, by means of a spectroradiometer measurement campaign. Plots treated with biochar, at a rate of 30–60 t ha −1 , showed a surface albedo decrease of up to 80% (after the application) with respect to the control in bare soil conditions, while this difference tended to decrease during the crop growing season, because of the prevailing effect of canopy development on the radiometer response. After the post-harvesting tillage, the soil treated with biochar again showed a lower surface albedo value (<20–26% than the control), while the measurements taken in the second year after application suggested a clear decrease of biochar influence on soil color. The modeling of the surface energy balance highlighted changes in the partitioning of heat fluxes and in particular a substantial increase of ground heat fluxes on an annual basis. (letter)
Atmospheric effect on the ground-based measurements of broadband surface albedo
Directory of Open Access Journals (Sweden)
T. Manninen
2012-11-01
Full Text Available Ground-based pyranometer measurements of the (clear-sky broadband surface albedo are affected by the atmospheric conditions (mainly by aerosol particles, water vapour and ozone. A new semi-empirical method for estimating the magnitude of the effect of atmospheric conditions on surface albedo measurements in clear-sky conditions is presented. Global and reflected radiation and/or aerosol optical depth (AOD at two wavelengths are needed to apply the method. Depending on the aerosol optical depth and the solar zenith angle values, the effect can be as large as 20%. For the cases we tested using data from the Cabauw atmospheric test site in the Netherlands, the atmosphere caused typically up to 5% overestimation of surface albedo with respect to corresponding black-sky surface albedo values.
Impact of the ozone monitoring instrument row anomaly on the long-term record of aerosol products
Torres, Omar; Bhartia, Pawan K.; Jethva, Hiren; Ahn, Changwoo
2018-05-01
Since about three years after the launch the Ozone Monitoring Instrument (OMI) on the EOS-Aura satellite, the sensor's viewing capability has been affected by what is believed to be an internal obstruction that has reduced OMI's spatial coverage. It currently affects about half of the instrument's 60 viewing positions. In this work we carry out an analysis to assess the effect of the reduced spatial coverage on the monthly average values of retrieved aerosol optical depth (AOD), single scattering albedo (SSA) and the UV Aerosol Index (UVAI) using the 2005-2007 three-year period prior to the onset of the row anomaly. Regional monthly average values calculated using viewing positions 1 through 30 were compared to similarly obtained values using positions 31 through 60, with the expectation of finding close agreement between the two calculations. As expected, mean monthly values of AOD and SSA obtained with these two scattering-angle dependent subsets of OMI observations agreed over regions where carbonaceous or sulphate aerosol particles are the predominant aerosol type. However, over arid regions, where desert dust is the main aerosol type, significant differences between the two sets of calculated regional mean values of AOD were observed. As it turned out, the difference in retrieved desert dust AOD between the scattering-angle dependent observation subsets was due to the incorrect representation of desert dust scattering phase function. A sensitivity analysis using radiative transfer calculations demonstrated that the source of the observed AOD bias was the spherical shape assumption of desert dust particles. A similar analysis in terms of UVAI yielded large differences in the monthly mean values for the two sets of calculations over cloudy regions. On the contrary, in arid regions with minimum cloud presence, the resulting UVAI monthly average values for the two sets of observations were in very close agreement. The discrepancy under cloudy conditions was found
Energy Technology Data Exchange (ETDEWEB)
Azevedo, Fabio Souto de, E-mail: fabio.azevedo@ufrgs.b [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Inst. de Matematica; Sauter, Esequia, E-mail: esequia.sauter@canoas.ifrs.edu.b [Instituto Federal do Rio Grande do Sul (IFRS), Canoas, RS (Brazil); Thompson, Mark; Vilhena, Marco Tulio B., E-mail: mark.thompson@mat.ufrgs.b, E-mail: vilhena@mat.ufrgs.b [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre, RS (Brazil). Programa de Pos-Graduacao em Matematica Aplicada
2011-07-01
In this work we apply the Green Function Decomposition Method the radiative transport equation in a slab. The method consists in converting the radiative transport equation into a integral equation and projecting the integral operators involved into a finite dimensional space. This methodology does not involve an a priori discretization on the angular variable {mu}, requiring only that the kernel is numerically integrated on {mu}. Numerical results are provided for isotropic, linearly anisotropic, and Rayleigh scattering near the unitary albedo. (author)
Rapid assessment of populations trends of invasive species: Singular Spectrum Analysis (SSA
Directory of Open Access Journals (Sweden)
DANA, ED
2010-01-01
Full Text Available Singular Spectrum Analysis (SSA is a powerful analytical approach for biodi-versity management. Its main advan-tages are due to its intuitive processing and visualization, since mathematical workflow is conceptually similar to the widely accepted Principal Components Analysis. Detailed analyses of popula-tion trends with mathematical tools are often difficult to achieve for managers by a number of reasons (large numbers or areas monitored, large number of species, insufficient statistics skills, strong knowledge level in demographic analyses, etc.. SSA has been used since the 1970’s in signal processing to clarify signal vs. noisy information, but it has also been used in climate change analy-sis and other developmental areas. Be-sides, SSA is a rapid-learning method for technicians and managers with medium level of mathematical knowledge. Free software in Unix environment is avail-able. Unfortunately, no free and friendly software is available for Win-dows SO. Although R package may offer solutions for really advanced users, it does not fit real work situations for managers of biological invasions. Cater-pillar (Gistat Group, Ltd is by now, the best option found by the author in terms of price, facility for results inter-pretation and time consumed in learn-ing. The main disadvantage is the poor content of tutorial files
Directory of Open Access Journals (Sweden)
A. A. Marks
2014-09-01
Full Text Available The optical properties of snow/sea ice vary with age and by the processes they were formed, giving characteristic types of snow and sea ice. The response of albedo and light penetration depth (e-folding depth to increasing mass ratio of black carbon is shown to depend on the snow and sea ice type and the thickness of the snow or sea ice. The response of albedo and e-folding depth of three different types of snow (cold polar snow, wind-packed snow and melting snow and three sea ice (multi-year ice, first-year ice and melting sea ice to increasing mass ratio of black carbon is calculated using a coupled atmosphere–snow/sea ice radiative-transfer model (TUV-snow, over the optical wavelengths of 300–800 nm. The snow and sea ice types are effectively defined by a scattering cross-section, density and asymmetry parameter. The relative change in albedo and e-folding depth of each of the three snow and three sea ice types with increasing mass ratio of black carbon is considered relative to a base case of 1 ng g−1 of black carbon. The relative response of each snow and sea ice type is intercompared to examine how different types of snow and sea ice respond relative to each other. The relative change in albedo of a melting snowpack is a factor of four more responsive to additions of black carbon compared to cold polar snow over a black carbon increase from 1 to 50 ng g−1, while the relative change in albedo of a melting sea ice is a factor of two more responsive to additions of black carbon compared to multi-year ice for the same increase in mass ratio of black carbon. The response of e-folding depth is effectively not dependent on snow/sea ice type. The albedo of sea ice is more responsive to increasing mass ratios of black carbon than snow.
Energy Technology Data Exchange (ETDEWEB)
Freitas, B.M.; Silva, A.X. da, E-mail: bfreitas@nuclear.ufrj.br [Coordenacao do Programas de Pos-Graduacao em Engenharia (COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Mauricio, C.L.P. [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)
2016-07-01
The Instituto de Radioprotecao e Dosimetria developed and runs a neutron TLD albedo individual monitoring service. To optimize the dose calculation algorithm and to infer new calibration factors, the response of this dosemeter was simulated. In order to validate this employed methodology, it was applied in the simulation of the problem of the QUADOS (Quality Assurance of Computational Tools for Dosimetry) intercomparison, aimed to evaluate dosimetric problems, one being to calculate the response of a generic albedo dosemeter. The obtained results were compared with those of other modeling and the reference one, with good agreements. (author)
International Nuclear Information System (INIS)
Marinyuk, V V; Sheberstov, S V
2017-01-01
We calculate the total transmission coefficient (transmittance) of a disordered medium with large (compared to the light wavelength) inhomogeneities. To model highly forward scattering in the medium we take advantage of the Gegenbauer kernel phase function. In a subdiffusion thickness range, the transmittance is shown to be sensitive to the specific form of the single-scattering phase function. The effect reveals itself at grazing angles of incidence and originates from small-angle multiple scattering of light. Our results are in a good agreement with numerical solutions to the radiative transfer equation. (paper)
2012-04-25
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0083] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Department of Labor (DOL))--Match Number 1015 AGENCY: Social Security... regarding protections for such persons. The Privacy Act, as amended, regulates the use of computer matching...
International Nuclear Information System (INIS)
Bordenave-Montesquieu, D.; Dagnac, R.
1992-01-01
We studied the single-electron capture as well as the direct processes occurring when a He 2+ ion is scattered by a He target. Doubly differential cross sections were measured for single-electron capture with a collision energy ranging from 2 to 8 keV and a scattering angle varying from 10' to 3 o 30' (laboratory frame). Single-electron capture into excited states of He + was found to be the dominant process, confirming a previous experimental study. Elastic scattering and ionization differential cross sections were measured for E = 6 keV. (Author)
Privette, J. L.; Schaaf, C. B.; Saleous, N.; Liang, S.
2004-12-01
Shortwave broadband albedo is the fundamental surface variable that partitions solar irradiance into energy available to the land biophysical system and energy reflected back into the atmosphere. Albedo varies with land cover, vegetation phenological stage, surface wetness, solar angle, and atmospheric condition, among other variables. For these reasons, a consistent and normalized albedo time series is needed to accurately model weather, climate and ecological trends. Although an empirically-derived coarse-scale albedo from the 20-year NOAA AVHRR record (Sellers et al., 1996) is available, an operational moderate resolution global product first became available from NASA's MODIS sensor. The validated MODIS product now provides the benchmark upon which to compare albedo generated through 1) reprocessing of the historic AVHRR record and 2) operational processing of data from the future National Polar-Orbiting Environmental Satellite System's (NPOESS) Visible/Infrared Imager Radiometer Suite (VIIRS). Unfortunately, different instrument characteristics (e.g., spectral bands, spatial resolution), processing approaches (e.g., latency requirements, ancillary data availability) and even product definitions (black sky albedo, white sky albedo, actual or blue sky albedo) complicate the development of the desired multi-mission (AVHRR to MODIS to VIIRS) albedo time series -- a so-called Climate Data Record. This presentation will describe the different albedo algorithms used with AVHRR, MODIS and VIIRS, and compare their results against field measurements collected over two semi-arid sites in southern Africa. We also describe the MODIS-derived VIIRS proxy data we developed to predict NPOESS albedo characteristics. We conclude with a strategy to develop a seamless Climate Data Record from 1982- to 2020.
The importance of snow albedo for ice sheet evolution over the last glacial cycle
Directory of Open Access Journals (Sweden)
M. Willeit
2018-05-01
Full Text Available The surface energy and mass balance of ice sheets strongly depends on the amount of solar radiation absorbed at the surface, which is mainly controlled by the albedo of snow and ice. Here, using an Earth system model of intermediate complexity, we explore the role played by surface albedo for the simulation of glacial cycles. We show that the evolution of the Northern Hemisphere ice sheets over the last glacial cycle is very sensitive to the representation of snow albedo in the model. It is well known that the albedo of snow depends strongly on snow grain size and the content of light-absorbing impurities. Excluding either the snow aging effect or the dust darkening effect on snow albedo leads to an excessive ice build-up during glacial times and consequently to a failure in simulating deglaciation. While the effect of snow grain growth on snow albedo is well constrained, the albedo reduction due to the presence of dust in snow is much more uncertain because the light-absorbing properties of dust vary widely as a function of dust mineral composition. We also show that assuming slightly different optical properties of dust leads to very different ice sheet and climate evolutions in the model. Conversely, ice sheet evolution is less sensitive to the choice of ice albedo in the model. We conclude that a proper representation of snow albedo is a fundamental prerequisite for a successful simulation of glacial cycles.
Strength of forest-albedo feedback in mid-Holocene climate simulations
Directory of Open Access Journals (Sweden)
J. Otto
2011-09-01
Full Text Available Reconstructions of the mid-Holocene climate, 6000 years before present, suggest that spring temperatures were higher at high northern latitudes compared to the pre-industrial period. A positive feedback between expansion of forest and climate presumably contributed to this warming. In the presence of snow, forests have a lower albedo than grass land. Therefore, the expansion of forest likely favoured a warming in spring, counteracting the lower insolation at the mid-Holocene.
We investigate the sensitivity of the vegetation-atmosphere interaction under mid-Holocene orbital forcing with respect to the strength of the forest-albedo feedback by using a comprehensive coupled atmosphere-vegetation model (ECHAM5/JSBACH. We perform two sets of model simulations: a first set of simulations with a relatively weak reduction of albedo of snow by forest; and a second set of simulations with a relatively strong reduction of the albedo of snow by forest.
We show that the parameterisation of the albedo of snow leads to uncertainties in the temperature signal. Compared to the set with weak snow masking, the simulations with strong snow masking reveal a spring warming that is three times higher, by 0.34 °C north of 60° N. This warming is related to a forest expansion of only 13%.
Global warming and climate forcing by recent albedo changes on Mars
Fenton, L.K.; Geissler, P.E.; Haberle, R.M.
2007-01-01
For hundreds of years, scientists have tracked the changing appearance of Mars, first by hand drawings and later by photographs. Because of this historical record, many classical albedo patterns have long been known to shift in appearance over time. Decadal variations of the martian surface albedo are generally attributed to removal and deposition of small amounts of relatively bright dust on the surface. Large swaths of the surface (up to 56 million km2) have been observed to darken or brighten by 10 per cent or more. It is unknown, however, how these albedo changes affect wind circulation, dust transport and the feedback between these processes and the martian climate. Here we present predictions from a Mars general circulation model, indicating that the observed interannual albedo alterations strongly influence the martian environment. Results indicate enhanced wind stress in recently darkened areas and decreased wind stress in brightened areas, producing a positive feedback system in which the albedo changes strengthen the winds that generate the changes. The simulations also predict a net annual global warming of surface air temperatures by ???0.65 K, enhancing dust lifting by increasing the likelihood of dust devil generation. The increase in global dust lifting by both wind stress and dust devils may affect the mechanisms that trigger large dust storm initiation, a poorly understood phenomenon, unique to Mars. In addition, predicted increases in summertime air temperatures at high southern latitudes would contribute to the rapid and steady scarp retreat that has been observed in the south polar residual ice for the past four Mars years. Our results suggest that documented albedo changes affect recent climate change and large-scale weather patterns on Mars, and thus albedo variations are a necessary component of future atmospheric and climate studies. ??2007 Nature Publishing Group.
Surviving space flight: case study on MELiSSA's CIII nitrifying compartment
Ilgrande, Chiara; Lasseur, Christophe; Mastroleo, Felice; Paille, Christel; Leys, Natalie; Morozova, Julia; Ilyin, Vyacheslav; Clauwaert, Peter; Christiaens, Marlies E. R.; Lindeboom, Ralph E. F.; Vlaeminck, Siegfried; Prat, Delphine; Arroyo, Jose M. C.; Conincx, Ilse; Van Hoey, Olivier; Roume, Hugo; Udert, Kai; Sas, Benedikt
2016-07-01
Space synthetic biology offers key opportunities for long-term space missions. Planets mining, terraformation, space medicine and Life Support technologies would all benefit from an integrative biological approach. However, space is a harsh environment for life: microgravity, temperature, UV and cosmic radiation can affect the health and functionality of microorganisms and plants, possibly preventing the optimal performance of the systems. The European Space Agency's Life Support System (MELiSSA) has been developed as a model for future long term Space missions and Space habitation. MELiSSA is a 5 compartment artificial ecosystem with microorganisms and higher, that aims at completely recycling gas, liquid and solid waste. In this study, the survival and functional activity after Lower Earth Orbit conditions of microbial nitrogen conversions, relevant for MELiSSA's CIII compartment, was tested. Synthetic communities containing Nitrosomonas europeae, Nitrosomonas ureae, Nitrobacter winogradskyi, Nitrospira moscoviensis and Cupriavidus pinatubonensis were exposed to the Lower Earth Orbit conditions of the International Space Station (ISS) for 7 days. Nitrosomonas europeae, Nitrobacter winogradskyi, Cupriavidus pinatubonensis, and three mixed communities (a urine nitrification sludge, a sludge containing aerobic ammonia oxidizing bacteria and anammox bacteria (OLAND), and an aquaculture sludge containing ammonia oxidizing archaea) were exposed to Lower Earth Orbit conditions for 44 days. Survival after both space flights was demonstrated because nitritation, nitratation, denitrification and anammox activity could be restored at a rate comparable to ground storage conditions. Our results validate the potential survival feasibility and suggest future space applications for N-related microorganisms.
2012-06-06
...: Social Security Administration (SSA). ACTION: Notice of a new computer matching program that will expire... protections for such persons. The Privacy Act, as amended, regulates the use of computer matching by Federal... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2012-0015] Privacy Act of 1974, as Amended...
Migration of Frosts from High-Albedo Regions of Pluto: what New Horizons Reveals
Buratti, Bonnie J.; Stern, S. A.; Weaver, Hal A.; Young, Leslie A.; Olkin, Cathy B.; Ennico, Kimberly; Binzel, Richard P.; Zangari, Amanda; Earle, Alissa M.
2015-11-01
With its high eccentricity and obliquity, Pluto should exhibit seasonal volatile transport on its surface. Several lines of evidence support this transport: doubling of Pluto’s atmospheric pressure over the past two decades (Young et al., 2013, Ap. J. 766, L22; Olkin et al., 2015, Icarus 246, 230); changes in its historical rotational light curve, once all variations due to viewing geometry have been modelled (Buratti et al., 2015; Ap. J. 804, L6); and changes in HST albedo maps (Buie et al., 2010, Astron. J. 139, 1128). New Horizons LORRI images reveal that the region of greatest albedo change is not the polar cap(s) of Pluto, but the feature informally named Tombaugh Regio (TR). This feature has a normal reflectance as high as ~0.8 in some places, and it is superposed on older, lower-albedo pre-existing terrain with an albedo of only ~0.10. This contrast is larger than any other body in the Solar System, except for Iapetus. This albedo dichotomy leads to a complicated system of cold-trapping and thermal segregation, beyond the simple picture of seasonal volatile transport. Whatever the origin of TR, it initially acted as a cold trap, as the temperature differential between the high and low albedo regions could be enormous, possibly approaching 20K, based on their albedo differences and assuming their normalized phase curves are similar. This latter assumption will be refined as the full New Horizons data set is returned.Over six decades of ground-based photometry suggest that TR has been decreasing in albedo over the last 25 years. Possible causes include changing insolation angles, or sublimation from the edges where the high-albedo material impinges on a much warmer substrate.Funding by the NASA New Horizons Project acknowledged.
CLARA-SAL: a global 28 yr timeseries of Earth's black-sky surface albedo
Directory of Open Access Journals (Sweden)
A. Riihelä
2013-04-01
Full Text Available We present a novel 28 yr dataset of Earth's black-sky surface albedo, derived from AVHRR instruments. The dataset is created using algorithms to separately derive the surface albedo for different land use areas globally. Snow, sea ice, open water and vegetation are all treated independently. The product features corrections for the atmospheric effect in satellite-observed surface radiances, a BRDF correction for the anisotropic reflectance properties of natural surfaces, and a novel topography correction of geolocation and radiometric accuracy of surface reflectance observations over mountainous areas. The dataset is based on a homogenized AVHRR radiance timeseries. The product is validated against quality-controlled in situ observations of clear-sky surface albedo at various BSRN sites around the world. Snow and ice albedo retrieval validation is given particular attention using BSRN sites over Antarctica, Greenland Climate Network stations on the Greenland Ice Sheet (GrIS, as well as sea ice albedo data from the SHEBA and Tara expeditions. The product quality is found to be comparable to other previous long-term surface albedo datasets from AVHRR.
Directory of Open Access Journals (Sweden)
Tao Wang
Full Text Available Seasonal snow cover in the Northern Hemisphere is the largest component of the terrestrial cryosphere and plays a major role in the climate system through strong positive feedbacks related to albedo. The snow-albedo feedback is invoked as an important cause for the polar amplification of ongoing and projected climate change, and its parameterization across models is an important source of uncertainty in climate simulations. Here, instead of developing a physical snow albedo scheme, we use a direct insertion approach to assimilate satellite-based surface albedo during the snow season (hereafter as snow albedo assimilation into the land surface model ORCHIDEE (ORganizing Carbon and Hydrology In Dynamic EcosystEms and assess the influences of such assimilation on offline and coupled simulations. Our results have shown that snow albedo assimilation in both ORCHIDEE and ORCHIDEE-LMDZ (a general circulation model of Laboratoire de Météorologie Dynamique improve the simulation accuracy of mean seasonal (October throughout May snow water equivalent over the region north of 40 degrees. The sensitivity of snow water equivalent to snow albedo assimilation is more pronounced in the coupled simulation than the offline simulation since the feedback of albedo on air temperature is allowed in ORCHIDEE-LMDZ. We have also shown that simulations of air temperature at 2 meters in ORCHIDEE-LMDZ due to snow albedo assimilation are significantly improved during the spring in particular over the eastern Siberia region. This is a result of the fact that high amounts of shortwave radiation during the spring can maximize its snow albedo feedback, which is also supported by the finding that the spatial sensitivity of temperature change to albedo change is much larger during the spring than during the autumn and winter. In addition, the radiative forcing at the top of the atmosphere induced by snow albedo assimilation during the spring is estimated to be -2.50 W m-2, the
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Will SSA periodically review the outcome payment system and the outcome-milestone payment system for possible modifications? 411.597 Section 411... Employment Network Payment Systems § 411.597 Will SSA periodically review the outcome payment system and the...
2010-04-01
... information or records in legal proceedings? 403.100 Section 403.100 Employees' Benefits SOCIAL SECURITY ADMINISTRATION TESTIMONY BY EMPLOYEES AND THE PRODUCTION OF RECORDS AND INFORMATION IN LEGAL PROCEEDINGS § 403.100 When can an SSA employee testify or produce information or records in legal proceedings? An SSA...
Cannaday, Ashley E.; Draham, Robert; Berger, Andrew J.
2016-04-01
The goal of this project is to estimate non-nuclear organelle size distributions in single cells by measuring angular scattering patterns and fitting them with Mie theory. Simulations have indicated that the large relative size distribution of organelles (mean:width≈2) leads to unstable Mie fits unless scattering is collected at polar angles less than 20 degrees. Our optical system has therefore been modified to collect angles down to 10 degrees. Initial validations will be performed on polystyrene bead populations whose size distributions resemble those of cell organelles. Unlike with the narrow bead distributions that are often used for calibration, we expect to see an order-of-magnitude improvement in the stability of the size estimates as the minimum angle decreases from 20 to 10 degrees. Scattering patterns will then be acquired and analyzed from single cells (EMT6 mouse cancer cells), both fixed and live, at multiple time points. Fixed cells, with no changes in organelle sizes over time, will be measured to determine the fluctuation level in estimated size distribution due to measurement imperfections alone. Subsequent measurements on live cells will determine whether there is a higher level of fluctuation that could be attributed to dynamic changes in organelle size. Studies on unperturbed cells are precursors to ones in which the effects of exogenous agents are monitored over time.
Human Decision Processes: Implications for SSA Support Tools
Picciano, P.
2013-09-01
Despite significant advances in computing power and artificial intelligence (AI), few critical decisions are made without a human decision maker in the loop. Space Situational Awareness (SSA) missions are both critical and complex, typically adhering to the human-in-the-loop (HITL) model. The collection of human operators injects a needed diversity of expert knowledge, experience, and authority required to successfully fulfill SSA tasking. A wealth of literature on human decision making exists citing myriad empirical studies and offering a varied set of prescriptive and descriptive models of judgment and decision making (Hastie & Dawes, 2001; Baron, 2000). Many findings have been proven sufficiently robust to allow information architects or system/interface designers to take action to improve decision processes. For the purpose of discussion, these concepts are bifurcated in two groups: 1) vulnerabilities to mitigate, and 2) capabilities to augment. These vulnerabilities and capabilities refer specifically to the decision process and should not be confused with a shortcoming or skill of a specific human operator. Thus the framing of questions and orders, the automated tools with which to collaborate, priming and contextual data, and the delivery of information all play a critical role in human judgment and choice. Evaluating the merits of any decision can be elusive; in order to constrain this discussion, ‘rational choice' will tend toward the economic model characteristics such as maximizing utility and selection consistency (e.g., if A preferred to B, and B preferred to C, than A should be preferred to C). Simple decision models often encourage one to list the pros and cons of a decision, perhaps use a weighting schema, but one way or another weigh the future benefit (or harm) of making a selection. The result (sought by the rationalist models) should drive toward higher utility. Despite notable differences in researchers' theses (to be discussed in the full
2012-02-08
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2011-0102] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ the States); Match 6000 and 6003 AGENCY: Social Security Administration..., as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...
Combining NLCD and MODIS to create a land cover-albedo database for the continental United States
Wickham, J.; Barnes, Christopher A.; Nash, M.S.; Wade, T.G.
2015-01-01
Land surface albedo is an essential climate variable that is tightly linked to land cover, such that specific land cover classes (e.g., deciduous broadleaf forest, cropland) have characteristic albedos. Despite the normative of land-cover class specific albedos, there is considerable variability in albedo within a land cover class. The National Land Cover Database (NLCD) and the Moderate Resolution Imaging Spectroradiometer (MODIS) albedo product were combined to produce a long-term (14 years) integrated land cover-albedo database for the continental United States that can be used to examine the temporal behavior of albedo as a function of land cover. The integration identifies areas of homogeneous land cover at the nominal spatial resolution of the MODIS (MCD43A) albedo product (500 m × 500 m) from the NLCD product (30 m × 30 m), and provides an albedo data record per 500 m × 500 m pixel for 14 of the 16 NLCD land cover classes. Individual homogeneous land cover pixels have up to 605 albedo observations, and 75% of the pixels have at least 319 MODIS albedo observations (≥ 50% of the maximum possible number of observations) for the study period (2000–2013). We demonstrated the utility of the database by conducting a multivariate analysis of variance of albedo for each NLCD land cover class, showing that locational (pixel-to-pixel) and inter-annual variability were significant factors in addition to expected seasonal (intra-annual) and geographic (latitudinal) effects.
A. A. Marks; M. D. King
2013-01-01
The response of the albedo of bare sea ice and snow-covered sea ice to the addition of black carbon is calculated. Visible light absorption and light-scattering cross-sections are derived for a typical first-year and multi-year sea ice with both "dry" and "wet" snow types. The cross-sections are derived using data from a 1970s field study that recorded both reflectivity and light penetration in Arctic sea ice and snow overlying sea ice. The variation of absorption cross-section ov...
Scattering of atomic and molecular ions from single crystal surfaces of Cu, Ag and Fe
International Nuclear Information System (INIS)
Zoest, J.M. van.
1986-01-01
This thesis deals with analysis of crystal surfaces of Cu, Ag and Fe with Low Energy Ion scattering Spectroscopy (LEIS). Different atomic and molecular ions with fixed energies below 7 keV are scattered by a metal single crystal (with adsorbates). The energy and direction of the scattered particles are analysed for different selected charge states. In that way information can be obtained concerning the composition and atomic and electronic structure of the single crystal surface. Energy spectra contain information on the composition of the surface, while structural atomic information is obtained by direction measurements (photograms). In Ch.1 a description is given of the experimental equipment, in Ch.2 a characterization of the LEIS method. Ch.3 deals with the neutralization of keV-ions in surface scattering. Two different ways of data interpretation are presented. First a model is treated in which the observed directional dependence of neutralization action of the first atom layer of the surface is presented by a laterally varying thickness of the neutralizing layer. Secondly it is shown that the data can be reproduced by a more realistic, physical model based on atomic transition matrix elements. In Ch.4 the low energy hydrogen scattering is described. The study of the dissociation of H 2 + at an Ag surface r0230ted in a model based on electronic dissociation, initialized by electron capture into a repulsive (molecular) state. In Ch.5 finally the method is applied to the investigation of the surface structure of oxidized Fe. (Auth.)
Arctic sea ice albedo - A comparison of two satellite-derived data sets
Schweiger, Axel J.; Serreze, Mark C.; Key, Jeffrey R.
1993-01-01
Spatial patterns of mean monthly surface albedo for May, June, and July, derived from DMSP Operational Line Scan (OLS) satellite imagery are compared with surface albedos derived from the International Satellite Cloud Climatology Program (ISCCP) monthly data set. Spatial patterns obtained by the two techniques are in general agreement, especially for June and July. Nevertheless, systematic differences in albedo of 0.05 - 0.10 are noted which are most likely related to uncertainties in the simple parameterizations used in the DMSP analyses, problems in the ISCCP cloud-clearing algorithm and other modeling simplifications. However, with respect to the eventual goal of developing a reliable automated retrieval algorithm for compiling a long-term albedo data base, these initial comparisons are very encouraging.
The extreme ultraviolet albedos of the planet Mercury and of the moon
Wu, H. H.; Broadfoot, A. L.
1977-01-01
The albedo of the moon in the far UV was measured by Mariner 10 at a solar phase angle of 74 deg, and the geometric albedo of Mercury was measured in same wavelength range (584-1657 A) at solar phase angles ranging from 50 to 120 deg. For both the moon and Mercury there is a general increase in albedo for wavelengths decreasing from 1657 to 584 A. The ratio of the albedos of Mercury and the moon increases from about 0.6 to 0.8 in the range 600-1600 A. This merely points to a difference in the surfaces of the moon and Mercury, there being insufficient data to make any conclusions regarding the nature of the difference.
Modeling Earth Albedo Currents on Sun Sensors for Improved Vector Observations
DEFF Research Database (Denmark)
Bhanderi, Dan
2006-01-01
Earth albedo influences vector measurements of the solar line of sight vector, due to the induced current on in the photo voltaics of Sun sensors. Although advanced digital Sun sensors exist, these are typically expensive and may not be suited for satellites in the nano or pico-class. Previously...... an Earth albedo model, based on reflectivity data from NASA's Total Ozone Mapping Spectrometer project, has been published. In this paper the proposed model is presented, and the model is sought validated by comparing simulated data with telemetry from the Danish Ørsted satellite. A novel method...... for modeling Sun sensor output by incorporating the Earth albedo model is presented. This model utilizes the directional information of in the Earth albedo model, which is achieved by Earth surface partitioning. This allows accurate simulation of the Sun sensor output and the results are consistent with Ørsted...
Near-ground cooling efficacies of trees and high-albedo surfaces
Energy Technology Data Exchange (ETDEWEB)
Levinson, Ronnen Michael [Univ. of California, Berkeley, CA (United States)
1997-05-01
Daytime summer urban heat islands arise when the prevalence of dark-colored surfaces and lack of vegetation make a city warmer than neighboring countryside. Two frequentlyproposed summer heat island mitigation measures are to plant trees and to increase the albedo (solar reflectivity) of ground surfaces. This dissertation examines the effects of these measures on the surface temperature of an object near the ground, and on solar heating of air near the ground. Near-ground objects include people, vehicles, and buildings. The variation of the surface temperature of a near-ground object with ground albedo indicates that a rise in ground albedo will cool a near-ground object only if the object’s albedo exceeds a critical value. This critical value of object albedo depends on wind speed, object geometry, and the height of the atmospheric thermal boundary layer. It ranges from 0.15 to 0.37 for a person. If an object has typical albedo of 0.3, increasing the ground albedo by 0.25 perturbs the object’s surface temperature by -1 to +2 K. Comparing a tree’s canopy-to-air convection to the reduction in ground-to-air convection induced by tree shading of the ground indicates that the presence of a tree can either increase or decrease solar heating of ground-level air. The tree’s net effect depends on the extent to which solar heating of the canopy is dissipated by evaporation, and on the fraction of air heated by the canopy that flows downward and mixes with the ground-level air. A two-month lysimeter (plant-weighing) experiment was conducted to measure instantaneous rates of water loss from a tree under various conditions of weather and soil-moisture. Calculations of canopy-to-air convection and the reduction of ground-to-air convection based on this data indicate that canopy-induced heating would negate shadowinduced cooling if approximately 45% of the canopy-heated air mixed with ground level air. This critical fraction is comparable to typical downward mixing
Energy Technology Data Exchange (ETDEWEB)
Gallmeier, F.X., E-mail: gallmeierfz@ornl.gov [Spallation Neutron Source, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Iverson, E.B.; Lu, W. [Spallation Neutron Source, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Baxter, D.V. [Center for the Exploration of Energy and Matter, Indiana University, Bloomington, IN 47408 (United States); Muhrer, G.; Ansell, S. [European Spallation Source, ESS AB, Lund (Sweden)
2016-04-01
Neutron transport simulation codes are indispensable tools for the design and construction of modern neutron scattering facilities and instrumentation. Recently, it has become increasingly clear that some neutron instrumentation has started to exploit physics that is not well-modeled by the existing codes. In particular, the transport of neutrons through single crystals and across interfaces in MCNP(X), Geant4, and other codes ignores scattering from oriented crystals and refractive effects, and yet these are essential phenomena for the performance of monochromators and ultra-cold neutron transport respectively (to mention but two examples). In light of these developments, we have extended the MCNPX code to include a single-crystal neutron scattering model and neutron reflection/refraction physics. We have also generated silicon scattering kernels for single crystals of definable orientation. As a first test of these new tools, we have chosen to model the recently developed convoluted moderator concept, in which a moderating material is interleaved with layers of perfect crystals to provide an exit path for neutrons moderated to energies below the crystal's Bragg cut–off from locations deep within the moderator. Studies of simple cylindrical convoluted moderator systems of 100 mm diameter and composed of polyethylene and single crystal silicon were performed with the upgraded MCNPX code and reproduced the magnitude of effects seen in experiments compared to homogeneous moderator systems. Applying different material properties for refraction and reflection, and by replacing the silicon in the models with voids, we show that the emission enhancements seen in recent experiments are primarily caused by the transparency of the silicon and void layers. Finally we simulated the convoluted moderator experiments described by Iverson et al. and found satisfactory agreement between the measurements and the simulations performed with the tools we have developed.
Decoupling single nanowire mobilities limited by surface scattering and bulk impurity scattering
International Nuclear Information System (INIS)
Khanal, D. R.; Levander, A. X.; Wu, J.; Yu, K. M.; Liliental-Weber, Z.; Walukiewicz, W.; Grandal, J.; Sanchez-Garcia, M. A.; Calleja, E.
2011-01-01
We demonstrate the isolation of two free carrier scattering mechanisms as a function of radial band bending in InN nanowires via universal mobility analysis, where effective carrier mobility is measured as a function of effective electric field in a nanowire field-effect transistor. Our results show that Coulomb scattering limits effective mobility at most effective fields, while surface roughness scattering only limits mobility under very high internal electric fields. High-energy α particle irradiation is used to vary the ionized donor concentration, and the observed decrease in mobility and increase in donor concentration are compared to Hall effect results of high-quality InN thin films. Our results show that for nanowires with relatively high doping and large diameters, controlling Coulomb scattering from ionized dopants should be given precedence over surface engineering when seeking to maximize nanowire mobility.
2011-03-07
... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA 2010-0034] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ Bureau of the Public Debt (BPD))--Match Number 1304 AGENCY: Social Security... as shown above. SUPPLEMENTARY INFORMATION: A. General The Computer Matching and Privacy Protection...
The Effect of Bond Albedo on Venus' Atmospheric and Surface Temperatures
Bullock, M. A.; Limaye, S. S.; Grinspoon, D. H.; Way, M.
2017-12-01
In spite of Venus' high planetary albedo, sufficient solar energy reaches the surface to drive a powerful greenhouse effect. The surface temperature is three times higher than it would be without an atmosphere. However, the details of the energy balance within Venus' atmosphere are poorly understood. Half of the solar energy absorbed within the clouds, where most of the solar energy is absorbed, is due to an unknown agent. One of the challenges of modeling Venus' atmosphere has been to account for all the sources of opacity sufficient to generate a globally averaged surface temperature of 735 K, when only 2% of the incoming solar energy is deposited at the surface. The wavelength and spherically integrated albedo, or Bond albedo, has typically been cited as between 0.7 and 0.82 (Colin 1983). Yet, recent photometry of Venus at extended phase angles between 2 and 179° indicate a Bond albedo of 0.90 (Mallama et al., 2006). The authors note an increase in cloud top brightness at phase angles fixed. Figure 1b (right). Venus surface temperature as Bond Albedo changes. Radiative-convective equilibrium models predict the correct globally averaged surface temperature at a=0.81. Calculations here show that a Bond albedo of a=0.9 would yield a surface temperature of 666.4 K, about 70 K too low, unless there is additional thermal absorption within the atmosphere that is not understood. Colin, L.,, Venus, University of Arizona Press, Tucson, 1983, pp 10-26. Mallama, A., et al., 2006. Icarus. 182, 10-22.
Distinguishing the albedo of exoplanets from stellar activity
Serrano, L. M.; Barros, S. C. C.; Oshagh, M.; Santos, N. C.; Faria, J. P.; Demangeon, O.; Sousa, S. G.; Lendl, M.
2018-03-01
Context. Light curves show the flux variation from the target star and its orbiting planets as a function of time. In addition to the transit features created by the planets, the flux also includes the reflected light component of each planet, which depends on the planetary albedo. This signal is typically referred to as phase curve and could be easily identified if there were no additional noise. As well as instrumental noise, stellar activity, such as spots, can create a modulation in the data, which may be very difficult to distinguish from the planetary signal. Aims: We analyze the limitations imposed by the stellar activity on the detection of the planetary albedo, considering the limitations imposed by the predicted level of instrumental noise and the short duration of the obervations planned in the context of the CHEOPS mission. Methods: As initial condition, we have assumed that each star is characterized by just one orbiting planet. We built mock light curves that included a realistic stellar activity pattern, the reflected light component of the planet and an instrumental noise level, which we have chosen to be at the same level as predicted for CHEOPS. We then fit these light curves to try to recover the reflected light component, assuming the activity patterns can be modeled with a Gaussian process. Results: We estimate that at least one full stellar rotation is necessary to obtain a reliable detection of the planetary albedo. This result is independent of the level of noise, but it depends on the limitation of the Gaussian process to describe the stellar activity when the light curve time-span is shorter than the stellar rotation. As an additional result, we found that with a 6.5 magnitude star and the noise level of CHEOPS, it is possible to detect the planetary albedo up to a lower limit of Rp = 0.03 R*. Finally, in presence of typical CHEOPS gaps in the simulations, we confirm that it is still possible to obtain a reliable albedo.
Mapping Global Ocean Surface Albedo from Satellite Observations: Models, Algorithms, and Datasets
Li, X.; Fan, X.; Yan, H.; Li, A.; Wang, M.; Qu, Y.
2018-04-01
Ocean surface albedo (OSA) is one of the important parameters in surface radiation budget (SRB). It is usually considered as a controlling factor of the heat exchange among the atmosphere and ocean. The temporal and spatial dynamics of OSA determine the energy absorption of upper level ocean water, and have influences on the oceanic currents, atmospheric circulations, and transportation of material and energy of hydrosphere. Therefore, various parameterizations and models have been developed for describing the dynamics of OSA. However, it has been demonstrated that the currently available OSA datasets cannot full fill the requirement of global climate change studies. In this study, we present a literature review on mapping global OSA from satellite observations. The models (parameterizations, the coupled ocean-atmosphere radiative transfer (COART), and the three component ocean water albedo (TCOWA)), algorithms (the estimation method based on reanalysis data, and the direct-estimation algorithm), and datasets (the cloud, albedo and radiation (CLARA) surface albedo product, dataset derived by the TCOWA model, and the global land surface satellite (GLASS) phase-2 surface broadband albedo product) of OSA have been discussed, separately.
Size and Albedo of Irregular Saturnian Satellites from Spitzer Observations
Mueller, Michael; Grav, T.; Trilling, D.; Stansberry, J.; Sykes, M.
2008-09-01
Using MIPS onboard the Spitzer Space Telescope, we observed the thermal emission (24 and, for some targets, 70 um) of eight irregular satellites of Saturn: Albiorix, Siarnaq, Paaliaq, Kiviuq, Ijiraq, Tarvos, Erriapus, and Ymir. We determined the size and albedo of all targets. An analysis of archived MIPS observations of Phoebe reproduces Cassini results very accurately, thereby validating our method. For all targets, the geometric albedo is found to be low, probably below 10% and clearly below 15%. Irregular satellites are much darker than the large regular satellites. Their albedo is, however, quite similar to that of small bodies in the outer Solar System (such as cometary nuclei, Jupiter Trojans, or TNOs). This is consistent with color measurements as well as dynamical considerations which suggest a common origin of the said populations. There appear to be significant object-to-object albedo differences. Similar albedos found for some members of dynamical clusters support the idea that they may have originated in the breakup of a parent body. For three satellites, thermal data at two wavelengths are available, enabling us to constrain their thermal properties. Sub-solar temperatures are similar to that found from Cassini's Phoebe fly-by. This suggests a rather low thermal inertia, as expected for regolith-covered objects. This work is based on observations made with the Spitzer Space Telescope, which is operated by JPL under a contract with NASA. Support for this work was provided by NASA.
Comparison of different methods to retrieve optical-equivalent snow grain size in central Antarctica
Directory of Open Access Journals (Sweden)
T. Carlsen
2017-11-01
Full Text Available The optical-equivalent snow grain size affects the reflectivity of snow surfaces and, thus, the local surface energy budget in particular in polar regions. Therefore, the specific surface area (SSA, from which the optical snow grain size is derived, was observed for a 2-month period in central Antarctica (Kohnen research station during austral summer 2013/14. The data were retrieved on the basis of ground-based spectral surface albedo measurements collected by the COmpact RAdiation measurement System (CORAS and airborne observations with the Spectral Modular Airborne Radiation measurement sysTem (SMART. The snow grain size and pollution amount (SGSP algorithm, originally developed to analyze spaceborne reflectance measurements by the MODerate Resolution Imaging Spectroradiometer (MODIS, was modified in order to reduce the impact of the solar zenith angle on the retrieval results and to cover measurements in overcast conditions. Spectral ratios of surface albedo at 1280 and 1100 nm wavelength were used to reduce the retrieval uncertainty. The retrieval was applied to the ground-based and airborne observations and validated against optical in situ observations of SSA utilizing an IceCube device. The SSA retrieved from CORAS observations varied between 27 and 89 m2 kg−1. Snowfall events caused distinct relative maxima of the SSA which were followed by a gradual decrease in SSA due to snow metamorphism and wind-induced transport of freshly fallen ice crystals. The ability of the modified algorithm to include measurements in overcast conditions improved the data coverage, in particular at times when precipitation events occurred and the SSA changed quickly. SSA retrieved from measurements with CORAS and MODIS agree with the in situ observations within the ranges given by the measurement uncertainties. However, SSA retrieved from the airborne SMART data slightly underestimated the ground-based results.
Comparison of different methods to retrieve optical-equivalent snow grain size in central Antarctica
Carlsen, Tim; Birnbaum, Gerit; Ehrlich, André; Freitag, Johannes; Heygster, Georg; Istomina, Larysa; Kipfstuhl, Sepp; Orsi, Anaïs; Schäfer, Michael; Wendisch, Manfred
2017-11-01
The optical-equivalent snow grain size affects the reflectivity of snow surfaces and, thus, the local surface energy budget in particular in polar regions. Therefore, the specific surface area (SSA), from which the optical snow grain size is derived, was observed for a 2-month period in central Antarctica (Kohnen research station) during austral summer 2013/14. The data were retrieved on the basis of ground-based spectral surface albedo measurements collected by the COmpact RAdiation measurement System (CORAS) and airborne observations with the Spectral Modular Airborne Radiation measurement sysTem (SMART). The snow grain size and pollution amount (SGSP) algorithm, originally developed to analyze spaceborne reflectance measurements by the MODerate Resolution Imaging Spectroradiometer (MODIS), was modified in order to reduce the impact of the solar zenith angle on the retrieval results and to cover measurements in overcast conditions. Spectral ratios of surface albedo at 1280 and 1100 nm wavelength were used to reduce the retrieval uncertainty. The retrieval was applied to the ground-based and airborne observations and validated against optical in situ observations of SSA utilizing an IceCube device. The SSA retrieved from CORAS observations varied between 27 and 89 m2 kg-1. Snowfall events caused distinct relative maxima of the SSA which were followed by a gradual decrease in SSA due to snow metamorphism and wind-induced transport of freshly fallen ice crystals. The ability of the modified algorithm to include measurements in overcast conditions improved the data coverage, in particular at times when precipitation events occurred and the SSA changed quickly. SSA retrieved from measurements with CORAS and MODIS agree with the in situ observations within the ranges given by the measurement uncertainties. However, SSA retrieved from the airborne SMART data slightly underestimated the ground-based results.
Observational determination of albedo decrease caused by vanishing Arctic sea ice.
Pistone, Kristina; Eisenman, Ian; Ramanathan, V
2014-03-04
The decline of Arctic sea ice has been documented in over 30 y of satellite passive microwave observations. The resulting darkening of the Arctic and its amplification of global warming was hypothesized almost 50 y ago but has yet to be verified with direct observations. This study uses satellite radiation budget measurements along with satellite microwave sea ice data to document the Arctic-wide decrease in planetary albedo and its amplifying effect on the warming. The analysis reveals a striking relationship between planetary albedo and sea ice cover, quantities inferred from two independent satellite instruments. We find that the Arctic planetary albedo has decreased from 0.52 to 0.48 between 1979 and 2011, corresponding to an additional 6.4 ± 0.9 W/m(2) of solar energy input into the Arctic Ocean region since 1979. Averaged over the globe, this albedo decrease corresponds to a forcing that is 25% as large as that due to the change in CO2 during this period, considerably larger than expectations from models and other less direct recent estimates. Changes in cloudiness appear to play a negligible role in observed Arctic darkening, thus reducing the possibility of Arctic cloud albedo feedbacks mitigating future Arctic warming.
Energy Technology Data Exchange (ETDEWEB)
Garvey, G. T. [Los Alamos; Harris, D. A. [Fermilab; Tanaka, H. A. [British Columbia U.; Tayloe, R. [Indiana U.; Zeller, G. P. [Fermilab
2015-06-15
The study of neutrino–nucleus interactions has recently seen rapid development with a new generation of accelerator-based neutrino experiments employing medium and heavy nuclear targets for the study of neutrino oscillations. A few unexpected results in the study of quasi-elastic scattering and single photon production have spurred a revisiting of the underlying nuclear physics and connections to electron–nucleus scattering. A thorough understanding and resolution of these issues is essential for future progress in the study of neutrino oscillations.
Retrieval of snow albedo and grain size using reflectance measurements in Himalayan basin
Directory of Open Access Journals (Sweden)
H. S. Negi
2011-03-01
Full Text Available In the present paper, spectral reflectance measurements of Himalayan seasonal snow were carried out and analysed to retrieve the snow albedo and effective grain size. The asymptotic radiative transfer (ART theory was applied to retrieve the plane and spherical albedo. The retrieved plane albedo was compared with the measured spectral albedo and a good agreement was observed with ±10% differences. Retrieved integrated albedo was found within ±6% difference with ground observed broadband albedo. The retrieved snow grain sizes using different models based on the ART theory were compared for various snow types and it was observed that the grain size model using two channel method (one in visible and another in NIR region can work well for the Himalayan seasonal snow and it was found consistent with temporal changes in grain size. This method can work very well for clean, dry snow as in the upper Himalaya, but sometimes, due to the low reflectances (<20% using wavelength 1.24 μm, the ART theory cannot be applied, which is common in lower and middle Himalayan old snow. This study is important for monitoring the Himalayan cryosphere using air-borne or space-borne sensors.
Li, Can; Tsay, Si-Chee; Fu, Joshua S.; Dickerson, Russell R.; Ji, Qiang; Bell, Shaun W.; Gao, Yang; Zhang, Wu; Huang, Jianping; Li, Zhanqing;
2010-01-01
Trace gases and aerosols were measured in Zhangye (39.082degN, 100.276degE, 1460 m a.s. 1.), a rural site near the Gobi deserts in northwestern China during spring 2008. Primary trace gases (CO:265 ppb; SO2:3.4 ppb; NO(*y): 4.2 ppb; hereafter results given as means of hourly data) in the area were lower than in eastern China, but still indicative of marked anthropogenic emissions. Sizable aerosol mass concentration (153 micro-g/cu m) and light scattering (159/Mm at 500 nm) were largely attributable to dust emissions, and aerosol light absorption (10.3/Mm at 500 nm) was dominated by anthropogenic pollution. Distinct diurnal variations in meteorology and pollution were induced by the local valley terrain. Strong daytime northwest valley wind cleaned out pollution and was replaced by southeast mountain wind that allowed pollutants to build up overnight. In the afternoon, aerosols had single scattering albedo (SSA, 500 mn) of 0.95 and were mainly of supermicron particles, presumably dust, while at night smaller particles and SSA of 0.89-0.91 were related to Pollution. The diverse local emission sources were characterized: the CO/SO2, CO/NO(y), NO(y)/SO2 (by moles), and BC/CO (by mass) ratios for small point sources such as factories were 24.6-54.2, 25.8-35.9, 0.79-1.31, and 4.1-6.1 x 10(exp -3), respectively, compared to the corresponding inventory ratios of 43.7-71.9, 23.7-25.7, 1.84-2.79, and 3.4-4.0 x 10(exp -3) for the industrial sector in the area. The mixing between dust and pollution can be ubiquitous in this region. During a dust storm shown as an example, pollutants were observed to mix with dust, causing discernible changes in both SSA and aerosol size distribution. Further interaction between dust and pollutants during transport may modify the properties of dust particles that are critical for their large-scale impact on radiation, clouds, and global biogeochemical cycles.
Deriving albedo maps for HAPEX-Sahel from ASAS data using kernel-driven BRDF models
Directory of Open Access Journals (Sweden)
P. Lewis
1999-01-01
Full Text Available This paper describes the application and testing of a method for deriving spatial estimates of albedo from multi-angle remote sensing data. Linear kernel-driven models of surface bi-directional reflectance have been inverted against high spatial resolution multi-angular, multi- spectral airborne data of the principal cover types within the HAPEX-Sahel study site in Niger, West Africa. The airborne data are obtained from the NASA Airborne Solid-state Imaging Spectrometer (ASAS instrument, flown in Niger in September and October 1992. The maps of model parameters produced are used to estimate integrated reflectance properties related to spectral albedo. Broadband albedo has been estimated from this by weighting the spectral albedo for each pixel within the map as a function of the appropriate spectral solar irradiance and proportion of direct and diffuse illumination. Partial validation of the results was performed by comparing ASAS reflectance and derived directional-hemispherical reflectance with simulations of a millet canopy made with a complex geometric canopy reflectance model, the Botanical Plant Modelling System (BPMS. Both were found to agree well in magnitude. Broadband albedo values derived from the ASAS data were compared with ground-based (point sample albedo measurements and found to agree extremely well. These results indicate that the linear kernel-driven modelling approach, which is to be used operationally to produce global 16 day, 1 km albedo maps from forthcoming NASA Earth Observing System spaceborne data, is both sound and practical for the estimation of angle-integrated spectral reflectance quantities related to albedo. Results for broadband albedo are dependent on spectral sampling and on obtaining the correct spectral weigthings.
Zuffada, Cinzia; Crisp, David
1997-01-01
Reliable descriptions of the optical properties of clouds and aerosols are essential for studies of radiative transfer in planetary atmospheres. The scattering algorithms provide accurate estimates of these properties for spherical particles with a wide range of sizes and refractive indices, but these methods are not valid for non-spherical particles (e.g., ice crystals, mineral dust, and smoke). Even though a host of methods exist for deriving the optical properties of nonspherical particles that are very small or very large compared with the wavelength, only a few methods are valid in the resonance regime, where the particle dimensions are comparable with the wavelength. Most such methods are not ideal for particles with sharp edges or large axial ratios. We explore the utility of an integral equation approach for deriving the single-scattering optical properties of axisymmetric particles with large axial ratios. The accuracy of this technique is shown for spheres of increasing size parameters and an ensemble of randomly oriented prolate spheroids of size parameter equal to 10.079368. In this last case our results are compared with published results obtained with the T-matrix approach. Next we derive cross sections, single-scattering albedos, and phase functions for cylinders, disks, and spheroids of ice with dimensions extending from the Rayleigh to the geometric optics regime. Compared with those for a standard surface integral equation method, the storage requirement and the computer time needed by this method are reduced, thus making it attractive for generating databases to be used in multiple-scattering calculations. Our results show that water ice disks and cylinders are more strongly absorbing than equivalent volume spheres at most infrared wavelengths. The geometry of these particles also affects the angular dependence of the scattering. Disks and columns with maximum linear dimensions larger than the wavelength scatter much more radiation in the forward
The single-angle neutron scattering facility at Pelindaba
International Nuclear Information System (INIS)
Hofmeyr, C.; Mayer, R.M.; Tillwick, D.L.; Starkey, J.R.
1978-05-01
The small-angle neutron scattering facility at the SAFARI-1 reactor is described in detail, and with reference to theoretical and practical design considerations. Inexpensive copper microwave guides used as a guide-pipe for slow neutrons provided the basis for a useful though comparatively simple facility. The neutron-spectrum characteristics of the final facility in different configurations of the guide-pipe (both S and single-curved) agree wel with expected values based on results obtained with a test facility. The design, construction, installation and alignment of various components of the facility are outlined, as well as intensity optimisation. A general description is given of experimental procedures and data-aquisition electronics for the four-position sample holder and counter array of up to 18 3 He detectors and a beam monitor [af
Empirical models of monthly and annual surface albedo in managed boreal forests of Norway
Bright, Ryan M.; Astrup, Rasmus; Strømman, Anders H.
2013-04-01
As forest management activities play an increasingly important role in climate change mitigation strategies of Nordic regions such as Norway, Sweden, and Finland -- the need for a more comprehensive understanding of the types and magnitude of biogeophysical climate effects and their various tradeoffs with the global carbon cycle becomes essential to avoid implementation of sub-optimal policy. Forest harvest in these regions reduces the albedo "masking effect" and impacts Earth's radiation budget in opposing ways to that of concomitant carbon cycle perturbations; thus, policies based solely on biogeochemical considerations in these regions risk being counterproductive. There is therefore a need to better understand how human disturbances (i.e., forest management activities) affect important biophysical factors like surface albedo. An 11-year remotely sensed surface albedo dataset coupled with stand-level forest management data for a variety of stands in Norway's most productive logging region are used to develop regression models describing temporal changes in monthly and annual forest albedo following clear-cut harvest disturbance events. Datasets are grouped by dominant tree species and site indices (productivity), and two alternate multiple regression models are developed and tested following a potential plus modifier approach. This resulted in an annual albedo model with statistically significant parameters that explains a large proportion of the observed variation, requiring as few as two predictor variables: i) average stand age - a canopy modifier predictor of albedo, and ii) stand elevation - a local climate predictor of a forest's potential albedo. The same model structure is used to derive monthly albedo models, with models for winter months generally found superior to summer models, and conifer models generally outperforming deciduous. We demonstrate how these statistical models can be applied to routine forest inventory data to predict the albedo
Albedo control as an effective strategy to tackle Global Warming: A case study
International Nuclear Information System (INIS)
Cotana, Franco; Rossi, Federico; Filipponi, Mirko; Coccia, Valentina; Pisello, Anna Laura; Bonamente, Emanuele; Petrozzi, Alessandro; Cavalaglio, Gianluca
2014-01-01
Highlights: • We modeled the energy exchanges for the system Earth–Atmosphere–Outer space. • We proposed a method quantifying the CO 2eq offset potential of high-albedo surfaces. • We presented the application of the method to a case study in Tunis. • The CO 2eq offsetting potential depends on the geometry-orientation of the surfaces. • An economic value was attributed to the Albedo control compensation mechanism. - Abstract: Recent research developments focused on Climate Change issue aimed at achieving Kyoto targets. In this context, an innovative methodology (officially recognized by WEC in 2009) is proposed to mitigate Global Warming by artificially enhancing earth’s Albedo. Such a methodology allows to quantify the maximum environmental benefit achievable through the installation of Albedo control technologies, as a function of the geographical features of the installation site, local meteorological conditions, radiative properties, tilt angle, and orientation of the surfaces. This benefit is directly quantified in terms of CO 2eq offset. Albedo control can be an effective mitigation strategy by means of three synergistic effects: a direct contribution towards Global Warming mitigation produced by an enhanced reflection to the space of the shortwave incident radiation; the indirect contribution from energy saving in buildings with high Albedo envelopes; the indirect contribution from the mitigation of Urban Heat Island phenomenon. Since the effectiveness of Albedo control is mostly relevant in Mediterranean area, for both climate conditions and historical-architectural heritage, this work presents procedures and findings of the ABCD project (Albedo, Building green, Control of Global Warming and Desertification) concluded in 2012, funded by the Italian Ministry for the Environment. A description of the analytic model is also presented. The paper focuses on the application of the methodology to a Tunisian factory site, showing that approximately
International Nuclear Information System (INIS)
Hategan, Cornel; Comisel, Horia; Ionescu, Remus A.
2004-01-01
The quasiresonant scattering consists from a single channel resonance coupled by direct interaction transitions to some competing reaction channels. A description of quasiresonant Scattering, in terms of generalized reduced K-, R- and S- Matrix, is developed in this work. The quasiresonance's decay width is, due to channels coupling, smaller than the width of the ancestral single channel resonance (resonance's direct compression). (author)
Valdé s, Felipe; Andriulli, Francesco P.; Bagci, Hakan; Michielssen, Eric
2011-01-01
A new regularized single source equation for analyzing scattering from homogeneous penetrable objects is presented. The proposed equation is a linear combination of a Calderón-preconditioned single source electric field integral equation and a
Raman scattering in the atmospheres of the major planets
International Nuclear Information System (INIS)
Cochran, W.D.; Trafton, L.M.
1978-01-01
A method is developed for calculating the rate at which photons are Raman scattered as a function of frequency and depth in an inhomogeneous anisotropically scattering atmosphere. This method is used to determine the effects of Raman scattering by H 2 in the atmospheres of the major planets. Raman scattering causes an insufficient decrease in the blue and ultraviolet to explain the albedos of all of the planets; an additional source of extinction is necessary in this spectral region. Approximately 0.5-2.0% of the blue continuum photons have undergone Raman scattering in the shallow atmospheres of Jupiter and Saturn, while in the deep atmospheres of Uranus and Neptune Raman scattering accounts for abount 10-15% of the blue continuum intensity. The filling in of the cores of solar lines and the production of Raman-shifted ghosts of the Fraunhofer spectrum will be detectable effects in all of the major planets. Raman scattering has a significant influence on the formation and profiles of the strong red and near-infrared CH 4 bands on Uranus and Neptune. The residual intensity in the cores of these bands may be fully explained as a result of Raman scattering by H 2 . This scattering of photons into the cores of saturated absorption bands will cause an underestimate of the abundance of the absorber unless the effects of Raman scattering by H 2 in an inhomogeneous atmosphere are properly included in the analysis
Glacier albedo decrease in the European Alps: potential causes and links with mass balances
Di Mauro, Biagio; Julitta, Tommaso; Colombo, Roberto
2016-04-01
Both mountain glaciers and polar ice sheets are losing mass all over the Earth. They are highly sensitive to climate variation, and the widespread reduction of glaciers has been ascribed to the atmospheric temperature increase. Beside this driver, also ice albedo plays a fundamental role in defining mass balance of glaciers. In fact, dark ice absorbs more energy causing faster glacier melting, and this can drive to more negative balances. Previous studies showed that the albedo of Himalayan glaciers and the Greenland Ice Sheet is decreasing with important rates. In this contribution, we tested the hypothesis that also glaciers in the European Alps are getting darker. We analyzed 16-year time series of MODIS (MODerate resolution Imaging Spectrometer) snow albedo from Terra (MOD13A1, 2000-2015) and Aqua (MYD13A1, 2002-2015) satellites. These data feature a spatial resolution of 500m and a daily temporal resolution. We evaluated the existence of a negative linear and nonlinear trend of the summer albedo values both at pixel and at glacier level. We also calculated the correlation between MODIS summer albedo and glacier mass balances (from the World Glaciological Monitoring Service, WGMS database), for all the glaciers with available mass balance during the considered period. In order to estimate the percentage of the summer albedo that can be explained by atmospheric temperature, we correlated MODIS albedo and monthly air temperature extracted from the ERA-Interim reanalysis dataset. Results show that decreasing trends exist with a strong spatial variability in the whole Alpine chain. In large glaciers, such as the Aletch (Swiss Alps), the trend varies significantly also within the glacier, showing that the trend is higher in the area across the accumulation and ablation zone. Over the 17 glaciers with mass balance available in the WGMS data set, 11 gave significant relationship with the MODIS summer albedo. Moreover, the comparison between ERA-Interim temperature
Implications of albedo changes following afforestation on the benefits of forests as carbon sinks
Directory of Open Access Journals (Sweden)
M. U. F. Kirschbaum
2011-12-01
Full Text Available Increased carbon storage with afforestation leads to a decrease in atmospheric carbon dioxide concentration and thus decreases radiative forcing and cools the Earth. However, afforestation also changes the reflective properties of the surface vegetation from more reflective pasture to relatively less reflective forest cover. This increase in radiation absorption by the forest constitutes an increase in radiative forcing, with a warming effect. The net effect of decreased albedo and carbon storage on radiative forcing depends on the relative magnitude of these two opposing processes.
We used data from an intensively studied site in New Zealand's Central North Island that has long-term, ground-based measurements of albedo over the full short-wave spectrum from a developing Pinus radiata forest. Data from this site were supplemented with satellite-derived albedo estimates from New Zealand pastures. The albedo of a well-established forest was measured as 13 % and pasture albedo as 20 %. We used these data to calculate the direct radiative forcing effect of changing albedo as the forest grew.
We calculated the radiative forcing resulting from the removal of carbon from the atmosphere as a decrease in radiative forcing of −104 GJ tC−1 yr−1. We also showed that the observed change in albedo constituted a direct radiative forcing of 2759 GJ ha−1 yr−1. Thus, following afforestation, 26.5 tC ha−1 needs to be stored in a growing forest to balance the increase in radiative forcing resulting from the observed albedo change. Measurements of tree biomass and albedo were used to estimate the net change in radiative forcing as the newly planted forest grew. Albedo and carbon-storage effects were of similar magnitude for the first four to five years after tree planting, but as the stand grew older, the carbon storage effect increasingly dominated. Averaged over the whole
2010-02-26
... INFORMATION: A. General The Computer Matching and Privacy Protection Act of 1988 (Pub. L. 100-503), amended... SOCIAL SECURITY ADMINISTRATION [Docket No. SSA-2009-0052] Privacy Act of 1974, as Amended; Computer Matching Program (SSA/ U.S. Department of Health and Human Services (HHS), Administration for...
International Nuclear Information System (INIS)
Grigor'ev, A.N.; Dikij, N.P.; Matyash, P.P.; Nikolajchuk, L.I.; Pivovar, L.I.
1974-01-01
The radiation defects in semiconducting CdS single crystals induced during doping with 140 keV Na ions (10 15 -2.10 16 ion/cm 2 ) were studied by the orientation dependence of 700 keV proton backscattering. The absence of discrete peaks in the scattered proton eneryg spectra indicates a small contribution of direct scattering at large angles. The defects formed during doping increase the fractionof dechanneled particles, which are then scattered at large anlges. No amorphization of CdS was observed at high Na ion dose 2x10 16 ion/cm 2
A hybrid intermediate language between SSA and CPS
DEFF Research Database (Denmark)
Torrens, Paulo; Vasconcellos, Cristiano; Gonçalves, Ju
2017-01-01
passing style (CPS) lambda calculus has been used as intermediate language for functional language compilers, they are (almost) equivalent and it is possible to draw syntactic translations between them. This short paper aims to present an untyped intermediate language which may be interpreted as both SSA...... and CPS, in order to provide a common language for both imperative and functional compilers, as well to take advantage of optimizations designed for either one of the approaches. Finally, potential variants and research opportunities are discussed....
Long-Term Variability of Surface Albedo and Its Correlation with Climatic Variables over Antarctica
Directory of Open Access Journals (Sweden)
Minji Seo
2016-11-01
Full Text Available The cryosphere is an essential part of the earth system for understanding climate change. Components of the cryosphere, such as ice sheets and sea ice, are generally decreasing over time. However, previous studies have indicated differing trends between the Antarctic and the Arctic. The South Pole also shows internal differences in trends. These phenomena indicate the importance of continuous observation of the Polar Regions. Albedo is a main indicator for analyzing Antarctic climate change and is an important variable with regard to the radiation budget because it can provide positive feedback on polar warming and is related to net radiation and atmospheric heating in the mainly snow- and ice-covered Antarctic. Therefore, in this study, we analyzed long-term temporal and spatial variability of albedo and investigated the interrelationships between albedo and climatic variables over Antarctica. We used broadband surface albedo data from the Satellite Application Facility on Climate Monitoring and data for several climatic variables such as temperature and Antarctic oscillation index (AAO during the period of 1983 to 2009. Time series analysis and correlation analysis were performed through linear regression using albedo and climatic variables. The results of this research indicated that albedo shows two trends, west trend and an east trend, over Antarctica. Most of the western side of Antarctica showed a negative trend of albedo (about −0.0007 to −0.0015 year−1, but the other side showed a positive trend (about 0.0006 year−1. In addition, albedo and surface temperature had a negative correlation, but this relationship was weaker in west Antarctica than in east Antarctica. The correlation between albedo and AAO revealed different relationships in the two regions; west Antarctica had a negative correlation and east Antarctica showed a positive correlation. In addition, the correlation between albedo and AAO was weaker in the west. This
Validation of response simulation methodology of Albedo dosemeter
International Nuclear Information System (INIS)
Freitas, B.M.; Silva, A.X. da
2016-01-01
The Instituto de Radioprotecao e Dosimetria developed and runs a neutron TLD albedo individual monitoring service. To optimize the dose calculation algorithm and to infer new calibration factors, the response of this dosemeter was simulated. In order to validate this employed methodology, it was applied in the simulation of the problem of the QUADOS (Quality Assurance of Computational Tools for Dosimetry) intercomparison, aimed to evaluate dosimetric problems, one being to calculate the response of a generic albedo dosemeter. The obtained results were compared with those of other modeling and the reference one, with good agreements. (author)
Clear-Sky Narrowband Albedo Datasets Derived from Modis Data
Chen, Y.; Minnis, P.; Sun-Mack, S.; Arduini, R. F.; Hong, G.
2013-12-01
Satellite remote sensing of clouds requires an accurate estimate of the clear-sky radiances for a given scene to detect clouds and aerosols and to retrieve their microphysical properties. Knowing the spatial and angular variability of clear-sky albedo is essential for predicting the clear-sky radiance at solar wavelengths. The Clouds and the Earth's Radiant Energy System (CERES) Project uses the near-infrared (NIR; 1.24, 1.6 or 2.13 μm) and visible (VIS; 0.63 μm) channels available on the Terra and Aqua Moderate Resolution Imaging Spectroradiometers (MODIS) to help identify clouds and retrieve their properties. Generally, clear-sky albedo for a given surface type is determined for conditions when the vegetation is either thriving or dormant and free of snow. The clear-sky albedos are derived using a radiative transfer parameterization of the impact of the atmosphere, including aerosols, on the observed reflectances. This paper presents the method of generating monthly clear-sky overhead albedo maps for both snow-free and snow-covered surfaces of these channels using one year of MODIS (Moderate Resolution Imaging Spectroradiometer) CERES products. Maps of 1.24 and 1.6 μm are being used as the background to help retrieve cloud properties (e.g., effective particle size, optical depth) in CERES cloud retrievals in both snow-free and snow-covered conditions.
International Nuclear Information System (INIS)
Thompson, David C.; Shirey, Robert L.; Roggemann, Michael C; Gudimetla, Rao
2008-01-01
Remote Ultra-Low Light Imaging detectors are photon limited detectors developed at Los Alamos National Laboratories. RULLI detectors provide a very high degree of temporal resolution for the arrival times of detected photoevents, but saturate at a photo-detection rate of about 10 6 photo-events per second. Rather than recording a conventional image, such as output by a charged coupled device (CCD) camera, the RULLI detector outputs a data stream consisting of the two-dimensional location, and time of arrival of each detected photo-electron. Hence, there is no need to select a specific exposure time to accumulate photo-events prior to the data collection with a RULLI detector this quantity can be optimized in post processing. RULLI detectors have lower peak quantum efficiency (from as low as 5% to perhaps as much as 40% with modern photocathode technology) than back-illuminated CCD's (80% or higher). As a result of these factors, and the associated analyses of signal and noise, we have found that RULLI detectors can play two key new roles in SSA: passive imaging of exceedingly dim objects, and three-dimensional imaging of objects illuminated with an appropriate pulsed laser. In this paper we describe the RULLI detection model, compare it to a conventional CCD detection model, and present analytic and simulation results to show the limits of performance of RULLI detectors used for SSA applications at AMOS field site
The influence of inter-annually varying albedo on regional climate and drought
Meng, Xianhong; Evans, Jason P.; McCabe, Matthew
2013-01-01
Albedo plays an important role in land-atmosphere interactions and local climate. This study presents the impact on simulating regional climate, and the evolution of a drought, when using the default climatological albedo as is usually done
Directory of Open Access Journals (Sweden)
Xingwen Lin
2018-01-01
Full Text Available The issue for the validation of land surface remote sensing albedo products over rugged terrain is the scale effects between the reference albedo measurements and coarse scale albedo products, which is caused by the complex topography. This paper illustrates a multi-scale validation strategy specified for coarse scale albedo validation over rugged terrain. A Mountain-Radiation-Transfer-based (MRT-based albedo upscaling model was proposed in the process of multi-scale validation strategy for aggregating fine scale albedo to coarse scale. The simulated data of both the reference coarse scale albedo and fine scale albedo were used to assess the performance and uncertainties of the MRT-based albedo upscaling model. The results showed that the MRT-based model could reflect the albedo scale effects over rugged terrain and provided a robust solution for albedo upscaling from fine scale to coarse scale with different mean slopes and different solar zenith angles. The upscaled coarse scale albedos had the great agreements with the simulated coarse scale albedo with a Root-Mean-Square-Error (RMSE of 0.0029 and 0.0017 for black sky albedo (BSA and white sky albedo (WSA, respectively. Then the MRT-based model was preliminarily applied for the assessment of daily MODerate Resolution Imaging Spectroradiometer (MODIS Albedo Collection V006 products (MCD43A3 C6 over rugged terrain. Results showed that the MRT-based model was effective and suitable for conducting the validation of MODIS albedo products over rugged terrain. In this research area, it was shown that the MCD43A3 C6 products with full inversion algorithm, were generally in agreement with the aggregated coarse scale reference albedos over rugged terrain in the Heihe River Basin, with the BSA RMSE of 0.0305 and WSA RMSE of 0.0321, respectively, which were slightly higher than those over flat terrain.
Thermal diffuse scattering in time-of-flight neutron diffraction studied on SBN single crystals
International Nuclear Information System (INIS)
Prokert, F.; Savenko, B.N.; Balagurov, A.M.
1994-01-01
At time-of-flight (TOF) diffractometer D N-2, installed at the pulsed reactor IBR-2 in Dubna, Sr x Ba 1-x Nb 2 O 6 mixed single crystals (SBN-x) of different compositions (0.50 < x< 0.75) were investigated between 15 and 773 K. The diffraction patterns were found to be strongly influenced by the thermal diffuse scattering (TDS). The appearance of the TDS from the long wavelength acoustic models of vibration in single crystals is characterized by the ratio of the velocity of sound to the velocity of neutron. Due to the nature of the TOF Laue diffraction technique used on D N-2, the TDS around Bragg peaks has rather a complex profile. An understanding of the TDS close to Bragg peaks is essential in allowing the extraction of the diffuse scattering occurring at the diffuse ferroelectric phase transition in SBN crystals. 11 refs.; 9 figs.; 1 tab. (author)
Modeling the bidirectional reflectance distribution function of mixed finite plant canopies and soil
Schluessel, G.; Dickinson, R. E.; Privette, J. L.; Emery, W. J.; Kokaly, R.
1994-01-01
An analytical model of the bidirectional reflectance for optically semi-infinite plant canopies has been extended to describe the reflectance of finite depth canopies contributions from the underlying soil. The model depends on 10 independent parameters describing vegetation and soil optical and structural properties. The model is inverted with a nonlinear minimization routine using directional reflectance data for lawn (leaf area index (LAI) is equal to 9.9), soybeans (LAI, 2.9) and simulated reflectance data (LAI, 1.0) from a numerical bidirectional reflectance distribution function (BRDF) model (Myneni et al., 1988). While the ten-parameter model results in relatively low rms differences for the BRDF, most of the retrieved parameters exhibit poor stability. The most stable parameter was the single-scattering albedo of the vegetation. Canopy albedo could be derived with an accuracy of less than 5% relative error in the visible and less than 1% in the near-infrared. Sensitivity were performed to determine which of the 10 parameters were most important and to assess the effects of Gaussian noise on the parameter retrievals. Out of the 10 parameters, three were identified which described most of the BRDF variability. At low LAI values the most influential parameters were the single-scattering albedos (both soil and vegetation) and LAI, while at higher LAI values (greater than 2.5) these shifted to the two scattering phase function parameters for vegetation and the single-scattering albedo of the vegetation. The three-parameter model, formed by fixing the seven least significant parameters, gave higher rms values but was less sensitive to noise in the BRDF than the full ten-parameter model. A full hemispherical reflectance data set for lawn was then interpolated to yield BRDF values corresponding to advanced very high resolution radiometer (AVHRR) scan geometries collected over a period of nine days. The resulting parameters and BRDFs are similar to those for the
Energy Technology Data Exchange (ETDEWEB)
McFarlane, Sally A.; Gaustad, Krista L.; Mlawer, Eli J.; Long, Charles N.; Delamere, Jennifer
2011-09-01
We present a method for identifying dominant surface type and estimating high spectral resolution surface albedo at the Atmospheric Radiation Measurement (ARM) facility at the Southern Great Plains (SGP) site in Oklahoma for use in radiative transfer calculations. Given a set of 6-channel narrowband visible and near-infrared irradiance measurements from upward and downward looking multi-filter radiometers (MFRs), four different surface types (snow-covered, green vegetation, partial vegetation, non-vegetated) can be identified. A normalized difference vegetation index (NDVI) is used to distinguish between vegetated and non-vegetated surfaces, and a scaled NDVI index is used to estimate the percentage of green vegetation in partially vegetated surfaces. Based on libraries of spectral albedo measurements, a piecewise continuous function is developed to estimate the high spectral resolution surface albedo for each surface type given the MFR albedo values as input. For partially vegetated surfaces, the albedo is estimated as a linear combination of the green vegetation and non-vegetated surface albedo values. The estimated albedo values are evaluated through comparison to high spectral resolution albedo measurements taken during several Intensive Observational Periods (IOPs) and through comparison of the integrated spectral albedo values to observed broadband albedo measurements. The estimated spectral albedo values agree well with observations for the visible wavelengths constrained by the MFR measurements, but have larger biases and variability at longer wavelengths. Additional MFR channels at 1100 nm and/or 1600 nm would help constrain the high resolution spectral albedo in the near infrared region.
McFarlane, S. A.; Gaustad, K. L.; Mlawer, E. J.; Long, C. N.; Delamere, J.
2011-09-01
We present a method for identifying dominant surface type and estimating high spectral resolution surface albedo at the Atmospheric Radiation Measurement (ARM) facility at the Southern Great Plains (SGP) site in Oklahoma for use in radiative transfer calculations. Given a set of 6-channel narrowband visible and near-infrared irradiance measurements from upward and downward looking multi-filter radiometers (MFRs), four different surface types (snow-covered, green vegetation, partial vegetation, non-vegetated) can be identified. A normalized difference vegetation index (NDVI) is used to distinguish between vegetated and non-vegetated surfaces, and a scaled NDVI index is used to estimate the percentage of green vegetation in partially vegetated surfaces. Based on libraries of spectral albedo measurements, a piecewise continuous function is developed to estimate the high spectral resolution surface albedo for each surface type given the MFR albedo values as input. For partially vegetated surfaces, the albedo is estimated as a linear combination of the green vegetation and non-vegetated surface albedo values. The estimated albedo values are evaluated through comparison to high spectral resolution albedo measurements taken during several Intensive Observational Periods (IOPs) and through comparison of the integrated spectral albedo values to observed broadband albedo measurements. The estimated spectral albedo values agree well with observations for the visible wavelengths constrained by the MFR measurements, but have larger biases and variability at longer wavelengths. Additional MFR channels at 1100 nm and/or 1600 nm would help constrain the high resolution spectral albedo in the near infrared region.
Directory of Open Access Journals (Sweden)
J. Delamere
2011-09-01
Full Text Available We present a method for identifying dominant surface type and estimating high spectral resolution surface albedo at the Atmospheric Radiation Measurement (ARM facility at the Southern Great Plains (SGP site in Oklahoma for use in radiative transfer calculations. Given a set of 6-channel narrowband visible and near-infrared irradiance measurements from upward and downward looking multi-filter radiometers (MFRs, four different surface types (snow-covered, green vegetation, partial vegetation, non-vegetated can be identified. A normalized difference vegetation index (NDVI is used to distinguish between vegetated and non-vegetated surfaces, and a scaled NDVI index is used to estimate the percentage of green vegetation in partially vegetated surfaces. Based on libraries of spectral albedo measurements, a piecewise continuous function is developed to estimate the high spectral resolution surface albedo for each surface type given the MFR albedo values as input. For partially vegetated surfaces, the albedo is estimated as a linear combination of the green vegetation and non-vegetated surface albedo values. The estimated albedo values are evaluated through comparison to high spectral resolution albedo measurements taken during several Intensive Observational Periods (IOPs and through comparison of the integrated spectral albedo values to observed broadband albedo measurements. The estimated spectral albedo values agree well with observations for the visible wavelengths constrained by the MFR measurements, but have larger biases and variability at longer wavelengths. Additional MFR channels at 1100 nm and/or 1600 nm would help constrain the high resolution spectral albedo in the near infrared region.
Energy Technology Data Exchange (ETDEWEB)
Bordenave-Montesquieu, D.; Dagnac, R. (Toulouse-3 Univ., 31 (France). Centre de Physique Atomique)
1992-06-14
We studied the single-electron capture as well as the direct processes occurring when a He[sup 2+] ion is scattered by a He target. Doubly differential cross sections were measured for single-electron capture with a collision energy ranging from 2 to 8 keV and a scattering angle varying from 10' to 3[sup o]30' (laboratory frame). Single-electron capture into excited states of He[sup +] was found to be the dominant process, confirming a previous experimental study. Elastic scattering and ionization differential cross sections were measured for E = 6 keV. (Author).
Evaluation of the MODIS Albedo Product over a Heterogeneous Agricultural Area
Sobrino, Jose Antonio; Franch, B.; Oltra-Carrio, R.; Vermote, E. F.; Fedele, E.
2013-01-01
In this article, the Moderate Resolution Imaging Spectroradiometer (MODIS) Bidirectional Reflectance Distribution Function (BRDF)/Albedo product (MCD43) is evaluated over a heterogeneous agricultural area in the framework of the Earth Observation: Optical Data Calibration and Information Extraction (EODIX) project campaign, which was developed in Barrax (Spain) in June 2011. In this method, two models, the RossThick-LiSparse-Reciprocal (RTLSR) (which corresponds to the MODIS BRDF algorithm) and the RossThick-Maignan-LiSparse-Reciprocal (RTLSR-HS), were tested over airborne data by processing high-resolution images acquired with the Airborne Hyperspectral Scanner (AHS) sensor. During the campaign, airborne images were retrieved with different view zenith angles along the principal and orthogonal planes. Comparing the results of applying the models to the airborne data with ground measurements, we obtained a root mean square error (RMSE) of 0.018 with both RTLSR and RTLSR-HS models. The evaluation of the MODIS BRDF/Albedo product (MCD43) was performed by comparing satellite images with AHS estimations. The results reported an RMSE of 0.04 with both models. Additionally, taking advantage of a homogeneous barley pixel, we compared in situ albedo data to satellite albedo data. In this case, the MODIS albedo estimation was (0.210 +/- 0.003), while the in situ measurement was (0.204 +/- 0.003). This result shows good agreement in regard to a homogeneous pixel.
Gyawali, M.; Arnott, W. P.; Zaveri, R. A.; Song, C.; Moosmuller, H.; Liu, L.; Mishchenko, M. I.; Chen, L.-W.A.; Green, M. C.; Watson, J. G.;
2012-01-01
We present the laboratory and ambient photoacoustic (PA) measurement of aerosol light absorption coefficients at ultraviolet wavelength (i.e., 355 nm) and compare with measurements at 405, 532, 870, and 1047 nm. Simultaneous measurements of aerosol light scattering coefficients were achieved by the integrating reciprocal nephelometer within the PA's acoustic resonator. Absorption and scattering measurements were carried out for various laboratory generated aerosols, including salt, incense, and kerosene soot to evaluate the instrument calibration and gain insight on the spectral dependence of aerosol light absorption and scattering. Ambient measurements were obtained in Reno, Nevada, between 18 December 2009 and 18 January 2010. The measurement period included days with and without strong ground level temperature inversions, corresponding to highly polluted (freshly emitted aerosols) and relatively clean (aged aerosols) conditions. Particulate matter (PM) concentrations were measured and analyzed with other tracers of traffic emissions. The temperature inversion episodes caused very high concentration of PM (sub 2.5) and PM( sub 10) (particulate matter with aerodynamic diameters less than 2.5 micrometers and 10 micrometers, respectively) and gaseous pollutants: carbon monoxide (CO), nitric oxide (NO), and nitrogen dioxide (NO2). The diurnal change of absorption and scattering coefficients during the polluted (inversion) days increased approximately by a factor of two for all wavelengths compared to the clean days. The spectral variation in aerosol absorption coefficients indicated a significant amount of absorbing aerosol from traffic emissions and residential wood burning. The analysis of single scattering albedo (SSA), Angstrom exponent of absorption (AEA), and Angstrom exponent of scattering (AES) for clean and polluted days provides evidences that the aerosol aging and coating process is suppressed by strong temperature inversion under cloudy conditions. In
Implementation of stimulated Raman scattering microscopy for single cell analysis
D'Arco, Annalisa; Ferrara, Maria Antonietta; Indolfi, Maurizio; Tufano, Vitaliano; Sirleto, Luigi
2017-05-01
In this work, we present successfully realization of a nonlinear microscope, not purchasable in commerce, based on stimulated Raman scattering. It is obtained by the integration of a femtosecond SRS spectroscopic setup with an inverted research microscope equipped with a scanning unit. Taking account of strength of vibrational contrast of SRS, it provides label-free imaging of single cell analysis. Validation tests on images of polystyrene beads are reported to demonstrate the feasibility of the approach. In order to test the microscope on biological structures, we report and discuss the label-free images of lipid droplets inside fixed adipocyte cells.
Information Content of Aerosol Retrievals in the Sunglint Region
Ottaviani, M.; Knobelspiesse, K.; Cairns, B.; Mishchenko, M.
2013-01-01
We exploit quantitative metrics to investigate the information content in retrievals of atmospheric aerosol parameters (with a focus on single-scattering albedo), contained in multi-angle and multi-spectral measurements with sufficient dynamical range in the sunglint region. The simulations are performed for two classes of maritime aerosols with optical and microphysical properties compiled from measurements of the Aerosol Robotic Network. The information content is assessed using the inverse formalism and is compared to that deriving from observations not affected by sunglint. We find that there indeed is additional information in measurements containing sunglint, not just for single-scattering albedo, but also for aerosol optical thickness and the complex refractive index of the fine aerosol size mode, although the amount of additional information varies with aerosol type.
Physical characterization of asteroid surfaces from photometric analysis
International Nuclear Information System (INIS)
Helfenstein, P.; Veverka, J.
1989-01-01
Rigorous photometric models, like Hapke's equation, can be applied to the analysis of disk-integrated phase curves in order to estimate a variety of regolith physical properties (average particle single-scattering albedo, particle transparency, soil compaction and large-scale roughness). Unfortunately, unambiguous interpretation is difficult due to uncertainties introduced by the irregular shapes of many asteroids and because Earth-based observations are often restricted to small phase angles (<30 degrees). In this chapter, the authors explore in detail how incomplete phase-angle coverage and nonsphericity of asteroids limits the reliable determination of Hapke's photometric parameters from asteroid phase curves. From obtainable Earth-based observations, it is possible to derive useful relative comparisons of single-scattering albedos, opposition-surge amplitudes, and regolith compaction states for different asteroids
Pectins from the albedo of immature lemon fruitlets have high water binding capacity.
Schröder, Roswitha; Clark, Christopher J; Sharrock, Keith; Hallett, Ian C; MacRae, Elspeth A
2004-04-01
The white part of citrus peel, the albedo, has a special role in water relations of both fruit and leaves from early on in fruit development. In times of drought, this tissue acts as a water reservoir for juice sacs, seeds and leaves. When water was injected into the albedo, free water was undetectable using magnetic resonance imaging. Microscopy showed tightly packed cells with little intercellular space, and thick cell walls. Cell wall material comprised 21% of the fresh albedo weight, and contained 26.1% galacturonic acid, the main constituent of pectin. From this, we postulated that pectin of the cell wall was responsible for the high water-binding capacity of the immature lemon albedo. Cell wall material was extracted using mild procedures that keep polymers intact, and four pectic fractions were recovered. Of these fractions, the SDS and chelator-soluble fractions showed viscosities ten and twenty times higher than laboratory-grade citrus pectin or the other albedo-derived pectins. The yield of these two pectins represented 28% of the cell walls and 62% of the galacturonic acid content of immature lemon albedo. We concluded that, from viscosity and abundance, these types of pectin account for the high water-binding capacity of this tissue. Compositional analyses showed that the two highly viscous pectic fractions differ in galacturonic acid content, degree of branching and length of side chains from the less viscous albedo-derived pectins. The most striking feature of these highly viscous pectins, however, was their high molecular weight distribution compared to the other pectic fractions.
International Nuclear Information System (INIS)
Choi, Han Kyu; Kim, Zee Hwan
2015-01-01
The electromagnetic (EM) enhancement mechanism of surface-enhanced Raman scattering (SERS) has been well established through 30 years of extensive investigation: molecules adsorbed on resonantly driven silver or gold nanoparticles (NPs) experience strongly enhanced field and thus show enhanced Raman scattering. Even stronger SERS enhancement is possible with a gap structure in which two or more NPs form assemblies with gap sizes of 1 nm or less. We have theoretically shown that the measurement of SERS angular distribution can reveal the position of a single molecule near the gap with 1-nm accuracy, even though the spatial extent of the enhanced field is ~10 nm. Real implementation of such experiment requires extremely well-defined (preferably a single crystal) dimeric junctions. Nevertheless, the experiment will provide spatial as well as frequency domain information on single-molecule dynamics at metallic surfaces
The role of iron and black carbon in aerosol light absorption
Directory of Open Access Journals (Sweden)
Y. Derimian
2008-07-01
Full Text Available Iron is a major component of atmospheric aerosols, influencing the light absorption ability of mineral dust, and an important micronutrient that affects oceanic biogeochemistry. The regional distribution of the iron concentration in dust is important for climate studies; however, this is difficult to obtain since it requires in-situ aerosol sampling or simulation of complex natural processes. Simultaneous studies of aerosol chemical composition and radiometric measurements of aerosol optical properties, which were performed in the Negev desert of Israel continuously for about eight years, suggest a potential for deriving a relationship between chemical composition and light absorption properties, in particular the spectral single-scattering albedo.
The two main data sets of the present study were obtained by a sun/sky radiometer and a stacked filter unit sampler that collects particles in coarse and fine size fractions. Analysis of chemical and optical data showed the presence of mixed dust and pollution aerosol in the study area, although their sources appear to be different. Spectral SSA showed an evident response to increased concentrations of iron, black carbon equivalent matter, and their mixing state. A relationship that relates the spectral SSA, the percentage of iron in total particulate mass, and the pollution components was derived. Results calculated, using this relationship, were compared with measurements from dust episodes in several locations around the globe. The comparison showed reasonable agreement between the calculated and the observed iron concentrations, and supported the validity of the suggested approach for the estimation of iron concentrations in mineral dust.
Aerosol optical properties at SORPES in Nanjing, east China
Shen, Yicheng; Virkkula, Aki; Ding, Aijun; Wang, Jiaping; Chi, Xuguang; Nie, Wei; Qi, Ximeng; Huang, Xin; Liu, Qiang; Zheng, Longfei; Xu, Zheng; Petäjä, Tuukka; Aalto, Pasi P.; Fu, Congbin; Kulmala, Markku
2018-04-01
Aerosol optical properties (AOPs) and supporting parameters - particle number size distributions, PM2.5 mass concentrations, and the concentrations of trace gases (NOx and NOy) - were measured at SORPES, a regional background station in Nanjing, China from June 2013 to May 2015. The aerosol was highly scattering: the average scattering coefficient was σsp = 403 ± 314 Mm-1, the absorption coefficient σap = 26 ± 19 Mm-1, and the single-scattering albedo SSA = 0.93 ± 0.03 for green light. The SSA in Nanjing appears to be slightly higher than published values from several other sites in China and elsewhere. The average Ångström exponent of absorption (AAE) for the wavelength range 370-950 nm was 1.04 and the AAE range was 0.7-1.4. These AAE values can be explained with different amounts of non-absorbing coating on pure black carbon (BC) cores and different core sizes rather than contribution by brown carbon. The AOPs had typical seasonal cycles with high σsp and σap in winter and low ones in summer: the averages were σsp = 544 ± 422 and σap = 36 ± 24 Mm-1 in winter and σsp = 342 ± 281 and σap = 20 ± 13 Mm-1 in summer. The intensive AOPs had no clear seasonal cycles, the variations in them were rather related to the evolution of pollution episodes. The diurnal cycles of the intensive AOPs were clear and in agreement with the cycle of the particle number size distribution. The diurnal cycle of SSA was similar to that of the air photochemical age, suggesting that the darkest aerosol originated from fresh traffic emissions. A Lagrangian retroplume analysis showed that the potential source areas of high σsp and σap are mainly in eastern China. Synoptic weather phenomena dominated the cycle of AOPs on a temporal scale of 3-7 days. During pollution episodes, modeled boundary layer height decreased, whereas PM2.5 concentrations and σsp and σap typically increased gradually and remained high during several days but decreased faster, sometimes by even more
Lenoble, J.; Tanre, D.; Deschamps, P. Y.; Herman, M.
1982-01-01
A computer code was developed in terms of a three-layer model for the earth-atmosphere system, using a two-stream approximation for the troposphere and stratosphere. The analysis was limited to variable atmosphere loading by solar radiation over an unperturbed section of the atmosphere. The scattering atmosphere above a Lambertian ground layer was considered in order to derive the planar albedo and the spherical albedo. Attention was given to the influence of the aerosol optical thickness in the stratosphere, the single scattering albedo and asymmetry factor, and the sublayer albedo. Calculations were performed of the zonal albedo and the planetary radiation balance, taking into account a stratospheric aerosol layer containing H2SO4 droplets and volcanic ash. The resulting ground temperature disturbance was computed using a Budyko (1969) climate model. Local decreases in the albedo in the summer were observed in high latitudes, implying a heating effect of the aerosol. An accompanying energy loss of 23-27 W/sq m was projected, which translates to surface temperature decreases of either 1.1 and 0.45 C, respectively, for background and volcanic aerosols.
Vouk, D; Nakic, D; Štirmer, N; Baricevic, A
2017-02-01
Final disposal of sewage sludge is important not only in terms of satisfying the regulations, but the aspect of choosing the optimal wastewater treatment technology, including the sludge treatment. In most EU countries, significant amounts of stabilized and dewatered sludge are incinerated, and sewage sludge ash (SSA) is generated as a by product. At the same time, lime is one of the commonly used additives in the sewage sludge treatment primarily to stabilize the sludge. In doing so, the question arose how desirable is such addition of lime if the sludge is subsequently incinerated, and the generated ash is further used in the production of cementitious materials. A series of mortars were prepared where 10-20% of the cement fraction was replaced by SSA. Since all three types of analyzed SSA (without lime, with lime added during sludge stabilization and with extra lime added during sludge incineration) yielded nearly same results, it can be concluded that if sludge incineration is accepted solution, lime addition during sludge treatment is unnecessary even from the standpoint of preserving the pozzolanic properties of the resulting SSA. Results of the research carried out on cement mortars point to the great possibilities of using SSA in concrete industry.
Ashford C. Chea
2012-01-01
The paper looks at the development experience of East Asia and draws lessons for Sub-Saharan Africa in building global competitiveness. It starts with a historical perspective of both regions’ developmental trajectories. This is followed by an analysis of the causes of East Asia’s superior economic performance and development and SSA underdevelopment. The article also draws policy lessons from East Asia development strategies for SSA global competitiveness. The paper ends with a presentation ...
Davaze, Lucas; Rabatel, Antoine; Arnaud, Yves; Sirguey, Pascal; Six, Delphine; Letreguilly, Anne; Dumont, Marie
2017-04-01
Increasing the number of glaciers monitored for surface mass balance is very challenging, especially using laborious methods based on in situ data. Complementary methods are therefore required to quantify the surface mass balance of unmonitored glaciers. The current study relies on the so-called albedo method, based on the analysis of albedo maps retrieved from optical satellite imagery acquired since 2000 by the MODIS sensor, onboard of TERRA satellite. Recent studies performed on single glaciers in the French Alps, the Himalayas or the Southern Alps of New Zealand revealed substantial relationships between summer minimum glacier-wide surface albedo and annual mass balance, because this minimum surface albedo is directly related to accumulation-area ratio and the equilibrium-line altitude. On the basis of 30 glaciers located in the French Alps where annual surface mass balance are available, our study conducted on the period 2000-2015 confirms the robustness and reliability of the relationship between the summer minimum surface albedo and the annual surface mass balance. At the seasonal scale, the integrated summer surface albedo is significantly correlated with the summer mass balance of the six glaciers seasonally surveyed. For the winter season, four of the six glaciers showed a significant correlation when linking the winter surface mass balance and the integrated winter surface albedo, using glacier-dependent thresholds to filter the albedo signal. Sensitivity study on the computed cloud detection algorithm revealed high confidence in retrieved albedo maps. These results are promising to monitor both annual and seasonal glacier-wide surface mass balances of individual glaciers at a regional scale using optical satellite images.
International Nuclear Information System (INIS)
Saddi, M.B.; Sandhu, B.S.; Singh, B.
2006-01-01
The phenomenon of double-photon Compton scattering has been successfully observed using a single γ detector, a technique avoiding the use of the complicated slow-fast coincidence set-up used till now for observing this higher-order process. Here doubly differential collision cross-sections integrated over the directions of one of the two final photons, the direction of other one being kept fixed, are measured experimentally for 0.662 MeV incident γ photons. The energy spectra of the detected photons are observed as a long tail to the single-photon Compton line on the lower side of the full energy peak in the recorded scattered energy spectrum. The present results are in agreement with theory of this process
Studies of isotopic defined hydrogen beams scattering from Pd single-crystal surfaces
International Nuclear Information System (INIS)
Varlam, Mihai; Steflea, Dumitru
2001-01-01
An experimental investigation of hydrogen isotopes interaction with Pd single-crystal surface has been carried out using molecular beam technique. The energy dependence of the sticking probability and its relation with the trapping probability into the precursor state is studied by integrating the scattered angular distribution of hydrogen Isotopic defined beams from Pd (111) surface in the 40-400 K surface temperature range. The dependence has been evaluated by defining hydrogen molecular beams with different isotopic concentration - from the natural one to the 5% D/(D+H) ratio - and for different incident energies. The beam was directed onto a single-crystal Pd (111) surface. In the paper, we report the experimental results and some considerations related to it. (authors)
Studies of isotopic defined hydrogen beams scattering from Pd single-crystal surfaces
International Nuclear Information System (INIS)
Varlam, Mihai; Steflea, Dumitru
1999-01-01
An experimental investigation of hydrogen isotopes interaction with Pd single-crystal surfaces has been carried out using molecular beam technique. The energy dependence of the sticking probability and its relation with the trapping probability into the precursor state is studied by integrating the scattered angular distribution of hydrogen isotopic defined beams from Pd (111) surfaces in the 40 - 400 K surface temperature range. The dependence has been evaluated by defining hydrogen molecular beams with different isotopic concentration - from the natural one until 5% D/(D + H) and different incident energies and directed onto a single - crystal Pd (111) surface. In the paper, we report the experimental results and some considerations related to them. (authors)
MELiSSA Food Characterization general approach and current status
Weihreter, Martin; Chaerle, Laury; Secco, Benjamin; Molders, Katrien; van der Straeten, Dominique; Duliere, Eric; Pieters, Serge; Maclean, Heather; Dochain, Denis; Quinet, Muriel; Lutts, Stanley; Graham, Thomas; Stasiak, Michael; Rondeau Vuk, Theresa; Zheng, Youbin; Dixon, Mike; Laniau, Martine; Larreture, Alain; Timsit, Michel; Aronne, Giovanna; Barbieri, Giancarlo; Buonomo, Roberta; Veronica; Paradiso, Roberta; de Pascale, Stafania; Galbiati, Massimo; Troia, A. R.; Nobili, Matteo; Bucchieri, Lorenzo; Page, Valérie; Feller, Urs; Lasseur, Christophe
Higher plants play an important role in closed ecological life support systems as oxygen pro-ducers, carbon dioxide and water recyclers, and as a food source. For an integration of higher plant chambers into the MELiSSA (Micro Ecological Life Support System Alternative) loop, a detailed characterization and optimization of the full food production and preparation chain is needed. This implies the prediction and control of the nutritional quality of the final products consumed by the crew, the prediction of the wastes quality and quantity produced along the chain for further waste treatment (MELiSSA waste treatment) and the optimization of overall efficiencies. To reach this goal several issues have to be studied in an integrated manner: the physiological responses of crops to a range of environmental parameters, crop yield efficiencies and respective ratio and composition of edible and inedible biomass, the processability and storability of the produced food and last but not least composition of wastes in view of further degradation (fiber content). Within the Food Characterization (FC) project several compar-ative plant growth bench tests were carried out to obtain preliminary data regarding these aspects. Four pre-selected cultivars of each of the four energy-rich crops with worldwide usage -wheat, durum wheat, potato and soybean -were grown under well-characterized environmental conditions. The different cultivars of each species are screened for their performance in view of a closed loop application by parameter ranking. This comprises the characterization of edi-ble/inedible biomass ratio, nutritional quality, processability and overall performance under the specific conditions of hydroponic cultivation and artificial illumination. A second closely linked goal of the FC project is to develop a mechanistic physiological plant model, which will ease the integration of higher plants compartments in the MELiSSA concept by virtue of its predictive abilities
Study of the relative humidity dependence of aerosol light-scattering in southern Spain
Directory of Open Access Journals (Sweden)
Gloria Titos
2014-09-01
Full Text Available This investigation focuses on the characterisation of the aerosol particle hygroscopicity. Aerosol particle optical properties were measured at Granada, Spain, during winter and spring seasons in 2013. Measured optical properties included particle light-absorption coefficient (σap and particle light-scattering coefficient (σsp at dry conditions and at relative humidity (RH of 85±10%. The scattering enhancement factor, f(RH=85%, had a mean value of 1.5±0.2 and 1.6±0.3 for winter and spring campaigns, respectively. Cases of high scattering enhancement were more frequent during the spring campaign with 27% of the f(RH=85% values above 1.8, while during the winter campaign only 8% of the data were above 1.8. A Saharan dust event (SDE, which occurred during the spring campaign, was characterised by a predominance of large particles with low hygroscopicity. For the day when the SDE was more intense, a mean daily value of f(RH=85%=1.3±0.2 was calculated. f(RH=85% diurnal cycle showed two minima during the morning and afternoon traffic rush hours due to the increase in non-hygroscopic particles such as black carbon and road dust. This was confirmed by small values of the single-scattering albedo and the scattering Ångstrom exponent. A significant correlation between f(RH=85% and the fraction of particulate organic matter and sulphate was obtained. Finally, the impact of ambient RH in the aerosol radiative forcing was found to be very small due to the low ambient RH. For high RH values, the hygroscopic effect should be taken into account since the aerosol forcing efficiency changed from −13 W/m2 at dry conditions to −17 W/m2 at RH=85%.
Cachorro, V. E.; Toledano, C.; Antón, M.; Berjón, A.; de Frutos, A.; Vilaplana, J. M.; Arola, A.; Krotkov, N. A.
2010-12-01
Several validation studies have shown a notable overestimation of the clear sky ultraviolet (UV) irradiance at the Earth's surface derived from satellite sensors such as the Total Ozone Mapping Spectrometer (TOMS) and the Ozone Monitoring Instrument (OMI) with respect to ground-based UV data at many locations. Most of this positive bias is attributed to boundary layer aerosol absorption that is not accounted for in the TOMS/OMI operational UV algorithm. Therefore, the main objective of this study is to analyse the aerosol effect on the bias between OMI erythemal UV irradiance (UVER) and spectral UV (305 nm, 310 nm and 324 nm) surface irradiances and ground-based Brewer spectroradiometer measurements from October 2004 to December 2008 at El Arenosillo station (37.1° N, 6.7° W, 20 m a.s.l.), with meteorological conditions representative of the South-West of Spain. The effects of other factors as clouds, ozone and the solar elevation over this intercomparison were analysed in detail in a companion paper (Antón et al., 2010). In that paper the aerosol effects were studied making only a rough evaluation based on aerosol optical depth (AOD) information at 440 nm wavelength (visible range) without applying any correction. We have used the precise information given by single scattering albedo (SSA) from AERONET for the determination of absorbing aerosols which has allowed the correction of the OMI UV data. An aerosol correction expression was applied to the OMI operational UV data using two approaches to estimate the UV absorption aerosol optical depth, AAOD. The first approach was based on an assumption of constant SSA value of 0.91. This approach reduces the OMI UVER bias against the reference Brewer data from 13.4% to 8.4%. Second approach uses daily AERONET SSA values reducing the bias only to 11.6%. Therefore we have obtained a 37% and 12% of improvement respectively. For the spectral irradiance at 324 nm, the OMI bias is reduced from 10.5% to 6.98% for constant
A Method for Retrieving Daily Land Surface Albedo from Space at 30-m Resolution
Directory of Open Access Journals (Sweden)
Bo Gao
2015-08-01
Full Text Available Land surface albedo data with high spatio-temporal resolution are increasingly important for scientific studies addressing spatially and/or temporally small-scale phenomena, such as urban heat islands and urban land surface energy balance. Our previous study derived albedo data with 2–4-day and 30-m temporal and spatial resolution that have better spatio-temporal resolution than existing albedo data, but do not completely satisfy the requirements for monitoring high-frequency land surface changes at the small scale. Downscaling technology provides a chance to further improve the albedo data spatio-temporal resolution and accuracy. This paper introduces a method that combines downscaling technology for land surface reflectance with an empirical method of deriving land surface albedo. Firstly, downscaling daily MODIS land surface reflectance data (MOD09GA from 500 m to 30 m on the basis of HJ-1A/B BRDF data with 2–4-day and 30-m temporal and spatial resolution is performed: this is the key step in the improved method. Subsequently, the daily 30-m land surface albedo data are derived by an empirical method combining prior knowledge of the MODIS BRDF product and the downscaled daily 30-m reflectance. Validation of albedo data obtained using the proposed method shows that the new method has both improved spatio-temporal resolution and good accuracy (a total absolute accuracy of 0.022 and a total root mean squared error at six sites of 0.028.
Directory of Open Access Journals (Sweden)
Ying Qu
2015-01-01
Full Text Available Surface albedo is one of the key controlling geophysical parameters in the surface energy budget studies, and its temporal and spatial variation is closely related to the global climate change and regional weather system due to the albedo feedback mechanism. As an efficient tool for monitoring the surfaces of the Earth, remote sensing is widely used for deriving long-term surface broadband albedo with various geostationary and polar-orbit satellite platforms in recent decades. Moreover, the algorithms for estimating surface broadband albedo from satellite observations, including narrow-to-broadband conversions, bidirectional reflectance distribution function (BRDF angular modeling, direct-estimation algorithm and the algorithms for estimating albedo from geostationary satellite data, are developed and improved. In this paper, we present a comprehensive literature review on algorithms and products for mapping surface broadband albedo with satellite observations and provide a discussion of different algorithms and products in a historical perspective based on citation analysis of the published literature. This paper shows that the observation technologies and accuracy requirement of applications are important, and long-term, global fully-covered (including land, ocean, and sea-ice surfaces, gap-free, surface broadband albedo products with higher spatial and temporal resolution are required for climate change, surface energy budget, and hydrological studies.
Production of Arctic Sea-ice Albedo by fusion of MISR and MODIS data
Kharbouche, Said; Muller, Jan-Peter
2017-04-01
We have combined data from the NASA MISR and MODIS spectro-radiometers to create a cloud-free albedo dataset specifically for sea-ice. The MISR (Multi-Angular Spectro-Radiometer) instrument on board Terra satellite has a unique ability to create high-quality Bidirectional Reflectance (BRF) over a 7 minute time interval per single overpass, thanks to its 9 cameras of different view angles (±70°,±60°,±45°,±26°). However, as MISR is limited to narrow spectral bands (443nm, 555nm, 670nm, 865nm), which is not sufficient to mask cloud effectively and robustly, we have used the sea-ice mask MOD09 product (Collection 6) from MODIS (Moderate resolution Imaging Spectoradiometer) instrument, which is also on board Terra satellite and acquiring data simultaneously. Only We have created a new and consistent sea-ice (for Arctic) albedo product that is daily, from 1st March to 22nd September for each and every year between 2000 to 2016 at two spatial grids, 1km x 1km and 5km x 5km in polar stereographic projection. Their analysis is described in a separate report [1]. References [1] Muller & Kharbouche, Variation of Arctic's Sea-ice Albedo between 2000 and 2016 by fusion of MISR and MODIS data. This conference. Acknowledgements This work was supported by www.QA4ECV.eu, a project of European Union's Seventh Framework Programme (FP7/2007-2013) under grant agreement no. 607405. We thank our colleagues at JPL and NASA LaRC for processing these data, especially Sebastian Val and Steve Protack.
Hemphill, Ashton S.; Shen, Yuecheng; Liu, Yan; Wang, Lihong V.
2017-11-01
In biological applications, optical focusing is limited by the diffusion of light, which prevents focusing at depths greater than ˜1 mm in soft tissue. Wavefront shaping extends the depth by compensating for phase distortions induced by scattering and thus allows for focusing light through biological tissue beyond the optical diffusion limit by using constructive interference. However, due to physiological motion, light scattering in tissue is deterministic only within a brief speckle correlation time. In in vivo tissue, this speckle correlation time is on the order of milliseconds, and so the wavefront must be optimized within this brief period. The speed of digital wavefront shaping has typically been limited by the relatively long time required to measure and display the optimal phase pattern. This limitation stems from the low speeds of cameras, data transfer and processing, and spatial light modulators. While binary-phase modulation requiring only two images for the phase measurement has recently been reported, most techniques require at least three frames for the full-phase measurement. Here, we present a full-phase digital optical phase conjugation method based on off-axis holography for single-shot optical focusing through scattering media. By using off-axis holography in conjunction with graphics processing unit based processing, we take advantage of the single-shot full-phase measurement while using parallel computation to quickly reconstruct the phase map. With this system, we can focus light through scattering media with a system latency of approximately 9 ms, on the order of the in vivo speckle correlation time.
Abbiendi, G; Akesson, P.F.; Alexander, G.; Allison, John; Amaral, P.; Anagnostou, G.; Anderson, K.J.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Bailey, I.; Barberio, E.; Barlow, R.J.; Batley, R.J.; Bechtle, P.; Behnke, T.; Bell, Kenneth Watson; Bell, P.J.; Bella, G.; Bellerive, A.; Benelli, G.; Bethke, S.; Biebel, O.; Boeriu, O.; Bock, P.; Boutemeur, M.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Buesser, K.; Burckhart, H.J.; Campana, S.; Carnegie, R.K.; Caron, B.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Csilling, A.; Cuffiani, M.; Dado, S.; De Roeck, A.; De Wolf, E.A.; Desch, K.; Dienes, B.; Donkers, M.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Etzion, E.; Fabbri, F.; Feld, L.; Ferrari, P.; Fiedler, F.; Fleck, I.; Ford, M.; Frey, A.; Furtjes, A.; Gagnon, P.; Gary, John William; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Giunta, Marina; Goldberg, J.; Groll, M.; Gross, E.; Grunhaus, J.; Gruwe, M.; Gunther, P.O.; Gupta, A.; Hajdu, C.; Hamann, M.; Hanson, G.G.; Harder, K.; Harel, A.; Harin-Dirac, M.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Hensel, C.; Herten, G.; Heuer, R.D.; Hill, J.C.; Hoffman, Kara Dion; Horvath, D.; Igo-Kemenes, P.; Ishii, K.; Jeremie, H.; Jovanovic, P.; Junk, T.R.; Kanaya, N.; Kanzaki, J.; Karapetian, G.; Karlen, D.; Kawagoe, K.; Kawamoto, T.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kim, D.H.; Klein, K.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Komamiya, S.; Kormos, Laura L.; Kramer, T.; Krieger, P.; von Krogh, J.; Kruger, K.; Kuhl, T.; Kupper, M.; Lafferty, G.D.; Landsman, H.; Lanske, D.; Layter, J.G.; Leins, A.; Lellouch, D.; Lettso, J.; Levinson, L.; Lillich, J.; Lloyd, S.L.; Loebinger, F.K.; Lu, J.; Ludwig, J.; Macpherson, A.; Mader, W.; Marcellini, S.; Martin, A.J.; Masetti, G.; Mashimo, T.; Mattig, Peter; McDonald, W.J.; McKenna, J.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menges, W.; Merritt, F.S.; Mes, H.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Moed, S.; Mohr, W.; Mori, T.; Mutter, A.; Nagai, K.; Nakamura, I.; Nanjo, H.; Neal, H.A.; Nisius, R.; O'Neale, S.W.; Oh, A.; Okpara, A.; Oreglia, M.J.; Orito, S.; Pahl, C.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poli, B.; Polok, J.; Pooth, O.; Przybycien, M.; Quadt, A.; Rabbertz, K.; Rembser, C.; Renkel, P.; Roney, J.M.; Rosati, S.; Rozen, Y.; Runge, K.; Sachs, K.; Saeki, T.; Sarkisyan, E.K.G.; Schaile, A.D.; Schaile, O.; Scharff-Hansen, P.; Schieck, J.; Schoerner-Sadenius, Thomas; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Sherwood, P.; Siroli, G.; Skuja, A.; Smith, A.M.; Sobie, R.; Soldner-Rembold, S.; Spano, F.; Stahl, A.; Stephens, K.; Strom, David M.; Strohmer, R.; Tarem, S.; Tasevsky, M.; Taylor, R.J.; Teuscher, R.; Thomson, M.A.; Torrence, E.; Toya, D.; Tran, P.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turner-Watson, M.F.; Ueda, I.; Ujvari, B.; Vollmer, C.F.; Vannerem, P.; Vertesi, R.; Verzocchi, M.; Voss, H.; Vossebeld, J.; Waller, D.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wengler, T.; Wermes, N.; Wetterling, G.W.; Wilson, D.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Zer-Zion, D.; Zivkovic, Lidija
2003-01-01
A search for single production of doubly-charged Higgs bosons has been performed using 600.7 pb^-1 of e+e- collision data with sqrt(s)=189--209GeV collected by the OPAL detector at LEP. No evidence for the existence of H++/-- is observed. Upper limits on the Yukawa coupling of the H++/-- to like-signed electron pairs are derived. Additionally, indirect constraints on the Yukawa coupling from Bhabha scattering, where the H++/-- would contribute via t-channel exchange, are derived for M(H++/--) < 2TeV. These are the first results for both a single production search and constraints from Bhabha scattering reported from LEP.
Albedo of a hybrid poplar plantation in central Alberta, Canada
Price, D. T.; Bernier, P. Y.; Orchansky, A.; Thomas, B.
2012-04-01
Canada's boreal forest resources are coming under increasing pressure from competing land-uses, including establishment of protected areas, and losses of harvestable forest to mining and oil and gas exploration. In the prairie region, concerns about lack of wood supply for pulpmills and potential opportunities for bioenergy production and carbon sequestration for climate change mitigation, have spurred interest in afforestation of marginal agricultural land, notably with fast-growing hybrid poplars (HP). However, global modelling studies suggest that a shift from grassland or crops to forest cover in temperate and boreal regions could result in reduced surface albedo, particularly in winter, causing an increase in radiative forcing and reducing any climate mitigation benefits due to net GHG removal. We report on seven growing seasons of measurements of short-wave canopy albedo using tower-mounted instruments, along with eddy covariance measurements of carbon, water and energy balance, at a site in central Alberta planted with HP cuttings in spring 2005. The data show little systematic change in average albedo as vegetation has changed from bare ground to a plantation of 6 m trees. Reasons for this include very wide (3 m) spacing between the trees, and snow cover which often persists for 4-5 months and is highly visible below the bare canopies during winter. While measurements should continue as the trees grow larger, we postulate that extensive afforestation with HP is unlikely to have major effects on regional-scale surface albedo compared to the agricultural systems they replace. Normal rotation lengths are 15-20 years, hence even if older plantations have significantly lower winter albedo, their contribution to the regional average would be relatively small because they will cover only a small fraction of the landscape (e.g., compared to forests of boreal conifers or temperate broadleaved species).
Spectral albedo of seasonal snow during intensive melt period at Sodankylä, beyond the Arctic Circle
Directory of Open Access Journals (Sweden)
O. Meinander
2013-04-01
Full Text Available We have measured spectral albedo, as well as ancillary parameters, of seasonal European Arctic snow at Sodankylä, Finland (67°22' N, 26°39' E. The springtime intensive melt period was observed during the Snow Reflectance Transition Experiment (SNORTEX in April 2009. The upwelling and downwelling spectral irradiance, measured at 290–550 nm with a double monochromator spectroradiometer, revealed albedo values of ~0.5–0.7 for the ultraviolet and visible range, both under clear sky and variable cloudiness. During the most intensive snowmelt period of four days, albedo decreased from 0.65 to 0.45 at 330 nm, and from 0.72 to 0.53 at 450 nm. In the literature, the UV and VIS albedo for clean snow are ~0.97–0.99, consistent with the extremely small absorption coefficient of ice in this spectral region. Our low albedo values were supported by two independent simultaneous broadband albedo measurements, and simulated albedo data. We explain the low albedo values to be due to (i large snow grain sizes up to ~3 mm in diameter; (ii meltwater surrounding the grains and increasing the effective grain size; (iii absorption caused by impurities in the snow, with concentration of elemental carbon (black carbon in snow of 87 ppb, and organic carbon 2894 ppb, at the time of albedo measurements. The high concentrations of carbon, detected by the thermal–optical method, were due to air masses originating from the Kola Peninsula, Russia, where mining and refining industries are located.
Measurement of the North-South asymmetry in the solar proton albedo neutron flux
International Nuclear Information System (INIS)
Ifedili, S.O.
1979-01-01
The solar proton albedo neutron flux in the range 10 -2 --10 7 eV measured by a neutron detector on board the Ogo 6 satellite was examined for north-south asymmetry. For the solar proton event of December 19, 1969, the S/N ratio of the solar proton albedo neutron rate at geomagnetic latitude lambda>70 0 was 1.61 +- 0.27 during the event, while for the November 2, 1969, event at 40 0 0 and altitudes ranging from 700 km to 800 km the solar proton albedo neutron rate was 0.40 +- 0.10 count/s in the north and 0.00 +- 0.10 count/s in the south. During the solar proton event of December 18, 1969, the N/S ratio of the solar proton albedo neutron rate at lambda>70 0 was 1.00 +- 0.26. The results are consistent with the expected N-S asymmetry in the solar proton flux. An interplanetary proton anisotropy with the interplanetary magnetic field polarity away from the sun corresponded to larger fluxes of solar proton albedo neutrons at the north polar cap than at the south, while an interplanetary proton anisotropy with the interplanetary magnetic field polarity toward the sun corresponded to larger fluxes of solar proton albedo neutrons at the south polar cap than at the north. This evidence favors the direct access of solar protons to the earth's polar caps via the merged interplanetary and geomagnetic field lines
Directory of Open Access Journals (Sweden)
Daqing Piao
2014-12-01
Full Text Available Recent focused Monte Carlo and experimental studies on steady-state single-fiber reflectance spectroscopy (SfRS from a biologically relevant scattering medium have revealed that, as the dimensionless reduced scattering of the medium increases, the SfRS intensity increases monotonically until reaching a plateau. The SfRS signal is semi-empirically decomposed to the product of three contributing factors, including a ratio-of-remission (RoR term that refers to the ratio of photons remitting from the medium and crossing the fiber-medium interface over the total number of photons launched into the medium. The RoR is expressed with respect to the dimensionless reduced scattering parameter , where is the reduced scattering coefficient of the medium and is the diameter of the probing fiber. We develop in this work, under the assumption of an isotropic-scattering medium, a method of analytical treatment that will indicate the pattern of RoR as a function of the dimensionless reduced scattering of the medium. The RoR is derived in four cases, corresponding to in-medium (applied to interstitial probing of biological tissue or surface-based (applied to contact-probing of biological tissue SfRS measurements using straight-polished or angle-polished fiber. The analytically arrived surface-probing RoR corresponding to single-fiber probing using a 15° angle-polished fiber over the range of agrees with previously reported similarly configured experimental measurement from a scattering medium that has a Henyey–Greenstein scattering phase function with an anisotropy factor of 0.8. In cases of a medium scattering light anisotropically, we propose how the treatment may be furthered to account for the scattering anisotropy using the result of a study of light scattering close to the point-of-entry by Vitkin et al. (Nat. Commun. 2011, doi:10.1038/ncomms1599.
Yu, Xingna; Lü, Rui; Kumar, K Raghavendra; Ma, Jia; Zhang, Qiuju; Jiang, Yilun; Kang, Na; Yang, Suying; Wang, Jing; Li, Mei
2016-08-01
The ground-based characteristics (optical and radiative properties) of dust aerosols measured during the springtime between 2001 and 2014 were investigated over urban Beijing, China. The seasonal averaged aerosol optical depth (AOD) during spring of 2001-2014 was about 0.78 at 440 nm. During dust days, higher AOD occurred associated with lower Ångström exponent (AE). The mean AE440-870 in the springtime was about 1.0, indicating dominance of fine particles over the region. The back-trajectory analysis revealed that the dust was transported from the deserts of Inner Mongolia and Mongolia arid regions to Beijing. The aerosol volume size distribution showed a bimodal distribution pattern, with its highest peak observed in coarse mode for all episodes (especially for dust days with increased volume concentration). The single scattering albedo (SSA) increased with wavelength on dust days, indicating the presence of more scattering particles. Furthermore, the complex parts (real and imaginary) of refractive index showed distinct characteristics with lower imaginary values (also scattering) on dust days. The shortwave (SW; 0.2-4.0 μm) and longwave (LW; 4-100 μm) aerosol radiative forcing (ARF) values were computed from the Santa Barbara DISORT Atmospheric Radiative Transfer (SBDART) model both at the top of atmosphere (TOA) and the bottom of atmosphere (BOA) during dust and non-dust (dust free) days, and the corresponding heating rates and forcing efficiencies were also estimated. The SW (LW) ARF, therefore, produced significant cooling (warming) effects at both the TOA and the BOA over Beijing.
Energy Technology Data Exchange (ETDEWEB)
Miss, J
1998-06-01
The goal of this thesis was to study comprehensively photons energy and angular distributions of backscattered radiations. In general, this relation is described by the concept to the backscattered factor or doubly differential albedo. This concept is useful to study the particle propagation into the air space by simple or multiple reflections on materials There are two principal treatments to solve numerically this problem: the deterministic and probabilistic methods. We showed that deterministic methods furnish unsatisfactory results: that`s why we choice to develop a new gamma ray albedo estimator in the code TRIPOLI14 (three dimensional Monte Carlo code). So, we have been able to compute an important data base of doubly differential albedos. A physical analysis of these data showed that albedos can be simply described by parameter functions. These parameters were obtained by fitting the albedos of the data base over a complete range of incident and reflected energy and direction. So, we produced a very smaller data base of functions coefficients, instead of storing all the values of the doubly differential spectrum. It is so easy to make every albedo by linear interpolations on the coefficient of the new library. (author) 63 refs.
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Paula N.; Pires, Alfredo T.N. [Grupo de Estudo em Materiais Polimericos - POLIMAT - UFSC, Florianopolis, SC (Brazil); Catarino, Margarida; Brandao, Lucia; Tanaka, Alfredo; Mendes, Adelio [Faculdade de Engenharia da Universidade do Porto, Porto (Portugal)
2011-07-01
In the present study, PVA/SSA membranes were prepared with and without the addition of Al{sub 2}O{sub 3} nanoparticles. Sulfosuccinic acid (SSA) was used as the crosslinking agent. Membranes were prepared with different amounts of SSA (26, 43 and 55 wt.%) and with 5 and 10 wt.% of nanoparticles. Crosslinking was performed at 90 degree C during 1.5 h. Membranes were analyzed by infrared spectroscopy, thermal analysis, water absorption, ion exchange capacity (IEC) and proton conductivity. The results showed that control of the crosslinking conditions, IEC value, water absorption and polymer structure are of significant importance to obtain a set of properties suitable for application in proton exchange membrane fuel cells. (author)
Witt, Adolf N.; Petersohn, Jens K.; Bohlin, Ralph C.; O'Connell, Robert W.; Roberts, Morton S.; Smith, Andrew M.; Stecher, Theodore P.
1992-01-01
The Ultraviolet Imaging Telescope as part of the Astro-1 mission, was used to obtain high-resolution surface brightness distribution data in six ultraviolet wavelength bands for the bright reflection nebula NGC 7023. From the quantitative comparison of the measured surface brightness gradients ratios of nebular to stellar flux, and detail radial surface brightness profiles with corresponding data from the visible, two major conclusions results: (1) the scattering in the near- and far-ultraviolet in this nebula is more strongly forward-directed than in the visible; (2) the dust albedo in the ultraviolet for wavelengths not less than 140 nm is identical to that in the visible, with the exception of the 220 nm bump in the extinction curve. In the wavelengths region of the bump, the albedo is reduced by 25 to 30 percent in comparison with wavelengths regions both shorter and longer. This lower albedo is expected, if the bump is a pure absorption feature.
PENGAMBILAN PEKTIN DARI ALBEDO SEMANGKA DENGAN PROSES EKSTRAKSI ASAM
Directory of Open Access Journals (Sweden)
Melisa Triandini Maulani
2014-04-01
Full Text Available Watermelon is a plant that is resistant to dry climate so it can be grown in tropical and semi-desert. Watermelon albedo is a potential source of pectin because it contains pectin compounds. To decompose the pectin in the watermelon albedo can be done by acid extraction process because it will lesser the possibility of damage pectin, whereas alcohol is use to precipitate pectin. In this research watermelon albedo as basic ingredients would be extracted to produce pectin to identified the differences in the influence of temperature variation and the type of solvent extraction of the pectin content of the albedo watermelon and determined variations in maximum temperature and type of solvent extraction to produce pectin. The study was conducted with a 90-minute extraction time and extraction temperature 60, 70, and 80 °C and 500 mL the solvent HCl and CH3COOH with 2.6 pH. The results were obtained taking the maximum conditions of pectin using solvent extraction HCl at a temperature of 80 °C and obtained pectin levels of 11.2635%. Solvent which is a strong acid HCl is easier to untie protopektin pectin so pectin levels has generated a high level. The higher the operating temperature, the bigger pectin levels that are obtained until the temperature limit of 80 °C. This caused by the movement of the H+ ions more reactive, the more contact between the substances dissolved in the sample with solvent and obtained more pectin.
Long-term variability of aerosol optical properties and radiative effects in Northern Finland
Lihavainen, Heikki; Hyvärinen, Antti; Asmi, Eija; Hatakka, Juha; Viisanen, Yrjö
2017-04-01
We introduce long term dataset of aerosol scattering and absorption properties and combined aerosol optical properties measured in Pallas Atmosphere-Ecosystem Supersite in Norhern Finland. The station is located 170 km north of the Arctic Circle. The station is affected by both pristine Arctic air masses as well as long transported air pollution from northern Europe. We studied the optical properties of aerosols and their radiative effects in continental and marine air masses, including seasonal cycles and long-term trends. The average (median) scattering coefficient, backscattering fraction, absorption coefficient and single scattering albedo at the wavelength of 550 nm were 7.9 (4.4) 1/Mm, 0.13 (0.12), 0.74 (0.35) 1/Mm and 0.92 (0.93), respectively. We observed clear seasonal cycles in these variables, the scattering coefficient having high values during summer and low in fall, and absorption coefficient having high values during winter and low in fall. We found that the high values of the absorption coefficient and low values of the single scattering albedo were related to continental air masses from lower latitudes. These aerosols can induce an additional effect on the surface albedo and melting of snow. We observed the signal of the Arctic haze in marine (northern) air masses during March and April. The haze increased the value of the absorption coefficient by almost 80% and that of the scattering coefficient by about 50% compared with the annual-average values. We did not observe any long-term trend in the scattering coefficient, while our analysis showed a clear decreasing trend in the backscattering fraction and scattering Ångström exponent during winter. We also observed clear relationship with temperature and aerosol scattering coefficient. We will present also how these different features affects to aerosol direct radiative forcing.
Kamgaing, Theophile; Doungmo, Giscard; Melataguia Tchieno, Francis Merlin; Gouoko Kouonang, Jimmy Julio; Mbadcam, Ketcha Joseph
2017-07-03
Orange albedo and its adsorption capacity towards bisphenol A (BPA) were studied. Adsorption experiments were conducted in batch mode at 25-55°C. Scanning electron microscopy (SEM), Energy dispersive X-ray spectroscopy (EDX), X-ray diffraction (XRD), Brunauer-Emmett-Teller (BET) and Fourier transform infrared (FTIR) spectroscopy were used to characterise the biosorbent. The effects of various parameters including adsorption time, equilibrium pH, adsorbent dosage and initial adsorbate concentration were investigated. The optimum contact time and pH for the removal of BPA were 60 min and 2, respectively. It was found that the adsorption isotherms best matched the Freundlich model, the adsorption of BPA being multilayer and that of the albedo surface heterogeneous. From the kinetic studies, it was found that the removal of BPA best matched the pseudo-second order kinetic model. An adsorption mechanism based on the albedo surface molecules is proposed and gives a good account of π-π interactions and hydrogen bonding. Orange albedo, with a maximum BPA loading capacity of 82.36 mg g -1 (significantly higher than that of most agricultural residues), is a good candidate for BPA adsorption in aqueous media.
Ceres Photometry and Albedo from Dawn Framing Camera Images
Schröder, S. E.; Mottola, S.; Keller, H. U.; Li, J.-Y.; Matz, K.-D.; Otto, K.; Roatsch, T.; Stephan, K.; Raymond, C. A.; Russell, C. T.
2015-10-01
The Dawn spacecraft is in orbit around dwarf planet Ceres. The onboard Framing Camera (FC) [1] is mapping the surface through a clear filter and 7 narrow-band filters at various observational geometries. Generally, Ceres' appearance in these images is affected by shadows and shading, effects which become stronger for larger solar phase angles, obscuring the intrinsic reflective properties of the surface. By means of photometric modeling we attempt to remove these effects and reconstruct the surface albedo over the full visible wavelength range. Knowledge of the albedo distribution will contribute to our understanding of the physical nature and composition of the surface.
Energy Technology Data Exchange (ETDEWEB)
Petersen, Claudio Zen
2008-07-01
In this dissertation we use the Laplace transform to derive expressions for nonstandard albedo boundary conditions for one and two non-multiplying regions at the ends of one dimensional domains. In practice, the fuel regions of reactor cores are surrounded by reflector regions that reduce neutron leakage. In order to exclude the reflector regions from the calculations, we introduce a reflection coefficient or albedo. We use the present albedo boundary conditions to solve numerically slab-geometry monoenergetic and multigroup diffusion equations using the conventional finite difference method. Numerical results are generated for fixed source and eigenvalue diffusion problems in slab geometry(author)
The scattering of low energy helium ions and atoms from a copper single crystal, ch. 2
International Nuclear Information System (INIS)
Verheij, L.K.; Poelsema, B.; Boers, A.L.
1976-01-01
The scattering of 4-10 keV helium ions from a copper surface cannot be completely described with elastic, single collisions. The general behaviour of the measured energy and width of the surface peak can be explained by differences in inelastic energy losses for scattering from an ideal surface and from surface structures (damage). Multiple scattering effects have a minor influence. Additional information about the inelastic processes is obtained from scattering experiments with a primary atom beam. For large angles of incidence, the energy of the reflected ions is reduced about 20 eV if the primary beam consists of atoms instead of ions. An explanation of this effect and an explanation of the different behaviour of small angles is given. In the investigated energy range, the electronic stopping power might depend on the charge state of the primary particles. The experimental results are rather well explained by the Lindhard, Scharff, Schioett theory
Analyses of the energy-dependent single separable potential models for the NN scattering
International Nuclear Information System (INIS)
Ahmad, S.S.; Beghi, L.
1981-08-01
Starting from a systematic study of the salient features regarding the quantum-mechanical two-particle scattering off an energy-dependent (ED) single separable potential and its connection with the rank-2 energy-independent (EI) separable potential in the T-(K-) amplitude formulation, the present status of the ED single separable potential models due to Tabakin (M1), Garcilazo (M2) and Ahmad (M3) has been discussed. It turned out that the incorporation of a self-consistent optimization procedure improves considerably the results of the 1 S 0 and 3 S 1 scattering phase shifts for the models (M2) and (M3) up to the CM wave number q=2.5 fm -1 , although the extrapolation of the results up to q=10 fm -1 reveals that the two models follow the typical behaviour of the well-known super-soft core potentials. It has been found that a variant of (M3) - i.e. (M4) involving one more parameter - gives the phase shifts results which are generally in excellent agreement with the data up to q=2.5 fm -1 and the extrapolation of the results for the 1 S 0 case in the higher wave number range not only follows the corresponding data qualitatively but also reflects a behaviour similar to the Reid soft core and Hamada-Johnston potentials together with a good agreement with the recent [4/3] Pade fits. A brief discussion regarding the features resulting from the variations in the ED parts of all the four models under consideration and their correlations with the inverse scattering theory methodology concludes the paper. (author)
Directory of Open Access Journals (Sweden)
Annepu Venkata Naga Vamsi
2016-01-01
Full Text Available We have reported the measurement of temperature by using coherent anti-Stroke and coherent Stroke Raman scattering using superconducting nano wire single-photon detector. The measured temperatures by both methods (Coherent Anti-Raman scattering & Coherent Stroke Raman scattering and TC 340 are in good accuracy of ± 5 K temperature range. The length of the pipe line under test can be increased by increasing the power of the pump laser. This methodology can be widely used to measure temperatures at instantaneous positions in test pipe line or the entire temperature of the pipe line under test.
Meng, X.; Lyu, S.; Zhang, T.; Zhao, L.; Li, Z.; Han, B.; Li, S.; Ma, D.; Chen, H.; Ao, Y.; Luo, S.; Shen, Y.; Guo, J.; Wen, L.
2018-04-01
Systematic cold biases exist in the simulation for 2 m air temperature in the Tibetan Plateau (TP) when using regional climate models and global atmospheric general circulation models. We updated the albedo in the Weather Research and Forecasting (WRF) Model lower boundary condition using the Global LAnd Surface Satellite Moderate-Resolution Imaging Spectroradiometer albedo products and demonstrated evident improvement for cold temperature biases in the TP. It is the large overestimation of albedo in winter and spring in the WRF model that resulted in the large cold temperature biases. The overestimated albedo was caused by the simulated precipitation biases and over-parameterization of snow albedo. Furthermore, light-absorbing aerosols can result in a large reduction of albedo in snow and ice cover. The results suggest the necessity of developing snow albedo parameterization using observations in the TP, where snow cover and melting are very different from other low-elevation regions, and the influence of aerosols should be considered as well. In addition to defining snow albedo, our results show an urgent call for improving precipitation simulation in the TP.
Directory of Open Access Journals (Sweden)
B. V. Scarnato
2013-05-01
Full Text Available According to recent studies, internal mixing of black carbon (BC with other aerosol materials in the atmosphere alters its aggregate shape, absorption of solar radiation, and radiative forcing. These mixing state effects are not yet fully understood. In this study, we characterize the morphology and mixing state of bare BC and BC internally mixed with sodium chloride (NaCl using electron microscopy and examine the sensitivity of optical properties to BC mixing state and aggregate morphology using a discrete dipole approximation model (DDSCAT. DDSCAT is flexible in simulating the geometry and refractive index of particle aggregates. DDSCAT predicts a higher mass absorption coefficient (MAC, lower single scattering albedo (SSA, and higher absorption Angstrom exponent (AAE for bare BC aggregates that are lacy rather than compact. Predicted values of SSA at 550 nm range between 0.16 and 0.27 for lacy and compact aggregates, respectively, in agreement with reported experimental values of 0.25 ± 0.05. The variation in absorption with wavelength does not adhere precisely to a power law relationship over the 200 to 1000 nm range. Consequently, AAE values depend on the wavelength region over which they are computed. The MAC of BC (averaged over the 200–1000 nm range is amplified when internally mixed with NaCl (100–300 nm in radius by factors ranging from 1.0 for lacy BC aggregates partially immersed in NaCl to 2.2 for compact BC aggregates fully immersed in NaCl. The SSA of BC internally mixed with NaCl is higher than for bare BC and increases with the embedding in the NaCl. Internally mixed BC SSA values decrease in the 200–400 nm wavelength range, a feature also common to the optical properties of dust and organics. Linear polarization features are also predicted in DDSCAT and are dependent on particle size and morphology. This study shows that DDSCAT predicts complex morphology and mixing state dependent aerosol optical properties that have
Directory of Open Access Journals (Sweden)
T. Sun
2018-03-01
Full Text Available The climatological variation of aerosol properties and the planetary boundary layer (PBL during 2013–2015 over the Yangtze River Delta (YRD region were investigated by employing ground-based Micro Pulse Lidar (MPL and CE-318 sun-photometer observations. Combining Moderate Resolution Imaging Spectroradiometer (MODIS and Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observation (CALIPSO satellite products, enhanced haze pollution events affected by different types of aerosol over the YRD region were analyzed through vertical structures, spatial distributions, backward trajectories, and the potential source contribution function (PSCF model. The results show that aerosols in the YRD are dominated by fine-mode particles, except in March. The aerosol optical depth (AOD in June and September is higher due to high single scattering albedo (SSA from hygroscopic growth, but it is lower in July and August due to wet deposition from precipitation. The PBL height (PBLH is greater (means ranging from 1.23 to 1.84 km and more variable in the warmer months of March to August, due to the stronger diurnal cycle and exchange of heat. Northern fine-mode pollutants are brought to the YRD at a height of 1.5 km. The SSA increases, blocking the radiation to the surface, and cooling the surface, thereby weakening turbulence, lowering the PBL, and in turn accelerating the accumulation of pollutants, creating a feedback to the cooling effect. Originated from the deserts in Xinjiang and Inner Mongolia, long-range transported dust masses are seen at heights of about 2 km over the YRD region with an SSA440 nm below 0.84, which heat air and raise the PBL, accelerating the diffusion of dust particles. Regional transport from biomass-burning spots to the south of the YRD region bring mixed aerosol particles at a height below 1.5 km, resulting in an SSA440 nm below 0.89. During the winter, the accumulation of the local emission layer is facilitated by
Attitude estimation from magnetometer and earth-albedo-corrected coarse sun sensor measurements
Appel, Pontus
2005-01-01
For full 3-axes attitude determination the magnetic field vector and the Sun vector can be used. A Coarse Sun Sensor consisting of six solar cells placed on each of the six outer surfaces of the satellite is used for Sun vector determination. This robust and low cost setup is sensitive to surrounding light sources as it sees the whole sky. To compensate for the largest error source, the Earth, an albedo model is developed. The total albedo light vector has contributions from the Earth surface which is illuminated by the Sun and visible from the satellite. Depending on the reflectivity of the Earth surface, the satellite's position and the Sun's position the albedo light changes. This cannot be calculated analytically and hence a numerical model is developed. For on-board computer use the Earth albedo model consisting of data tables is transferred into polynomial functions in order to save memory space. For an absolute worst case the attitude determination error can be held below 2∘. In a nominal case it is better than 1∘.
Halim, M. A.; Thomas, S. C.
2017-12-01
Surface albedo is the most important biophysical radiative forcing in the boreal forest. General Circulation Model studies have suggested that harvesting of boreal forest has a net cooling effect, in contrast to other terrestrial biomes, by increasing surface albedo. However, albedo estimation in these models has been achieved by simplifying processes governing albedo at a coarse scale (both spatial and temporal). Biophysical processes that determine albedo likely operate on small spatial and temporal scales, requiring more direct estimates of effects of landcover change on net radiation. We established a chronosequence study in post-fire and post-clearcut sites (2013, 2006, 1998), logging data from July 2013 to July 2017 in boreal forest sites in northwestern Ontario, Canada. Each age-class X disturbance had 3 three replicates, matched to 18 permanent circular plots (10-m radius) each with an instrumented tower measuring surface albedo, air and soil temperature, and soil moisture. We also measured leaf area index, species composition and soil organic matter content at each site. BRDF-corrected surface albedo was calculated from daily 30m x 30m reflectance data fused from the MODIS MOD09GA product and Landsat 7 reflectance data. Calculated albedo was verified using ground-based measurements. Results show that fire sites generally had lower (15-25%) albedo than clearcut sites in all seasons. Because of rapid forest regrowth, large perturbations of clearcut harvests on forest albedo started to fade out within a year. Albedo differences between fire and clearcut sites also declined sharply with stand age. Younger stands generally had higher albedo than older stands mainly due to the presence of broadleaf species (for example, Populus tremuloides). In spring, snow melted 10-12 days earlier in recent (2013) clearcut sites compared to closed-canopy sites, causing a sharp reduction in surface albedo in comparison to old clearcut/fire sites (2006 and 1998). Snow melted
International Nuclear Information System (INIS)
Shafiq, A.; Meyer, H.E. de; Grosjean, C.C.
1985-01-01
An approximate model based on an improved diffusion-type theory is established for treating multiple synthetic scattering in a homogeneous slab of finite thickness. As in the case of the exact treatment given in the preceding paper (Part I), it appears possible to transform the considered transport problem into an equivalent fictitious one involving multiple isotropic scattering, therefore permitting the application of an established corrected diffusion theory for treating isotropic scattering taking place in a convex homogeneous medium bounded by a vacuum in the presence of various types of sources. The approximate values of the reflection and transmission coefficients are compared with the rigorous values listed in Part I. In this way, the high accuracy of the approximation is clearly demonstrated. (author)
Shock Hazard Prevention through Self-Healing Insulative Coating on SSA Metallic Bearings, Phase II
National Aeronautics and Space Administration — The space suit assembly (SSA) contains metallic bearings at the wrist, neck, and waist, which are exposed to space environment, and pose a potential shock hazard....
International Nuclear Information System (INIS)
Iwinski, Z.R.; Rosenberg, L.; Spruch, L.
1986-01-01
For potential scattering, with delta/sub L/(k) the phase shift modulo π for an incident wave number k, Levinson's theorem gives delta/sub L/(0)-delta/sub L/(infinity) in terms of N/sub L/, the number of bound states of angular momentum L, for delta/sub L/(k) assumed to be a continuous function of k. N/sub L/ also determines the number of nodes of the zero-energy wave function u/sub L/(r). A knowledge of the nodal structure and of the absolute value of delta/sub L/(0) is very useful in theoretical studies of low-energy potential scattering. Two preliminary attempts, one formal and one ''physical,'' are made to extend the above results to single-channel scattering by a compound system initially in its ground state. The nodal structure will be of greater interest to us here than an extension of Levinson's theorem
Impact of Atmospheric Albedo on Amazon Evapotranspiration
Lopes, A. V.; Thompson, S. E.; Dracup, J. A.
2013-12-01
The vulnerability of the Amazon region to climate and anthropogenic driven disturbances has been the subject of extensive research efforts, given its importance in the global and regional climate and ecologic systems. The evaluation of such vulnerabilities requires the proper understanding of physical mechanisms controlling water and energy balances and how the disturbances change them. Among those mechanisms, the effects of atmospheric albedo on evapotranspiration have not been fully explored yet and are explored in this study. Evapotranspiration in the Amazon is sustained at high levels across all seasons and represents a large fraction of water and energy surface budgets. In this study, statistical analysis of data from four flux towers installed at Amazon primary forest sites was employed to quantify the impact of atmospheric albedo, mostly resulted from cloudiness, on evapotranspiration and to compare it to the effect of water limitation. Firstly, the difference in eddy-flux derived evapotranspiration at the flux towers under rainy and non-rainy antecedent conditions was tested for significance. Secondly, the same statistical comparison was performed under cloudy and clear sky conditions at hourly and daily time scales, using the reduction in incoming solar radiation as an indicator of cloudiness. Finally, the sensitivity of seasonal evapotranspiration totals to atmospheric albedo resulted from rainfall patterns is evaluated. That was done by sampling daily evapotranspiration estimates from empirical probability distribution functions conditioned to rainfall occurrence and then varying the number of dry days in each season. It was found that light limitation is much more important than water limitation in the Amazon, resulting in up to 43% reduction in daily evapotranspiration. Also, this effect varies by location and by season, the largest impact being in wet season, from December do January. Moreover, seasonal evapotranspiration totals were found to be
Huang, Shengli; Dahal, Devendra; Liu, Heping; Jin, Suming; Young, Claudia J.; Liu, Shuang; Liu, Shu-Guang
2015-01-01
The albedo change caused by both fires and subsequent succession is spatially heterogeneous, leading to the need to assess the spatiotemporal variation of surface shortwave forcing (SSF) as a component to quantify the climate impacts of high-latitude fires. We used an image reconstruction approach to compare postfire albedo with the albedo assuming fires had not occurred. Combining the fire-caused albedo change from the 2001-2010 fires in interior Alaska and the monthly surface incoming solar radiation, we examined the spatiotemporal variation of SSF in the early successional stage of around 10 years. Our results showed that while postfire albedo generally increased in fall, winter, and spring, some burned areas could show an albedo decrease during these seasons. In summer, the albedo increased for several years and then declined again. The spring SSF distribution did not show a latitudinal decrease from south to north as previously reported. The results also indicated that although the SSF is usually largely negative in the early successional years, it may not be significant during the first postfire year. The annual 2005-2010 SSF for the 2004 fire scars was -1.30, -4.40, -3.31, -4.00, -3.42, and -2.47 Wm-2. The integrated annual SSF map showed significant spatial variation with a mean of -3.15 Wm-2 and a standard deviation of 3.26 Wm-2, 16% of burned areas having positive SSF. Our results suggest that boreal deciduous fires would be less positive for climate change than boreal evergreen fires. Future research is needed to comprehensively investigate the spatiotemporal radiative and non-radiative forcings to determine the effect of boreal fires on climate.
NEOWISE REACTIVATION MISSION YEAR ONE: PRELIMINARY ASTEROID DIAMETERS AND ALBEDOS
Energy Technology Data Exchange (ETDEWEB)
Nugent, C. R.; Cutri, R. M. [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Mainzer, A.; Masiero, J.; Bauer, J.; Kramer, E.; Sonnett, S.; Stevenson, R. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Grav, T. [Planetary Science Institute, Tucson, AZ (United States); Wright, E. L., E-mail: cnugent@ipac.caltech.edu [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States)
2015-12-01
We present preliminary diameters and albedos for 7956 asteroids detected in the first year of the NEOWISE Reactivation mission. Of those, 201 are near-Earth asteroids and 7755 are Main Belt or Mars-crossing asteroids. 17% of these objects have not been previously characterized using the Near-Earth Object Wide-field Infrared Survey Explorer, or “NEOWISE” thermal measurements. Diameters are determined to an accuracy of ∼20% or better. If good-quality H magnitudes are available, albedos can be determined to within ∼40% or better.
McMeeking, G. R.; Morgan, W. T.; Flynn, M.; Highwood, E. J.; Turnbull, K.; Haywood, J.; Coe, H.
2011-09-01
Black carbon (BC) aerosols absorb sunlight thereby leading to a positive radiative forcing and a warming of climate and can also impact human health through their impact on the respiratory system. The state of mixing of BC with other aerosol species, particularly the degree of internal/external mixing, has been highlighted as a major uncertainty in assessing its radiative forcing and hence its climate impact, but few in situ observations of mixing state exist. We present airborne single particle soot photometer (SP2) measurements of refractory BC (rBC) mass concentrations and mixing state coupled with aerosol composition and optical properties measured in urban plumes and regional pollution over the United Kingdom. All data were obtained using instrumentation flown on the UK's BAe-146-301 large Atmospheric Research Aircraft (ARA) operated by the Facility for Airborne Atmospheric Measurements (FAAM). We measured sub-micron aerosol composition using an aerosol mass spectrometer (AMS) and used positive matrix factorization to separate hydrocarbon-like (HOA) and oxygenated organic aerosols (OOA). We found a higher number fraction of thickly coated rBC particles in air masses with large OOA relative to HOA, higher ozone-to-nitrogen oxides (NOx) ratios and large concentrations of total sub-micron aerosol mass relative to rBC mass concentrations. The more ozone- and OOA-rich air masses were associated with transport from continental Europe, while plumes from UK cities had higher HOA and NOx and fewer thickly coated rBC particles. We did not observe any significant change in the rBC mass absorption efficiency calculated from rBC mass and light absorption coefficients measured by a particle soot absorption photometer despite observing significant changes in aerosol composition and rBC mixing state. The contributions of light scattering and absorption to total extinction (quantified by the single scattering albedo; SSA) did change for different air masses, with lower SSA
Black carbon aerosol mixing state, organic aerosols and aerosol optical properties over the UK
McMeeking, G. R.; Morgan, W. T.; Flynn, M.; Highwood, E. J.; Turnbull, K.; Haywood, J.; Coe, H.
2011-05-01
Black carbon (BC) aerosols absorb sunlight thereby leading to a positive radiative forcing and a warming of climate and can also impact human health through their impact on the respiratory system. The state of mixing of BC with other aerosol species, particularly the degree of internal/external mixing, has been highlighted as a major uncertainty in assessing its radiative forcing and hence its climate impact, but few in situ observations of mixing state exist. We present airborne single particle soot photometer (SP2) measurements of refractory BC (rBC) mass concentrations and mixing state coupled with aerosol composition and optical properties measured in urban plumes and regional pollution over the UK. All data were obtained using instrumentation flown on the UK's BAe-146-301 large Atmospheric Research Aircraft (ARA) operated by the Facility for Airborne Atmospheric Measurements (FAAM). We measured sub-micron aerosol composition using an aerosol mass spectrometer (AMS) and used positive matrix factorization to separate hydrocarbon-like (HOA) and oxygenated organic aerosols (OOA). We found a higher number fraction of thickly coated rBC particles in air masses with large OOA relative to HOA, higher ozone-to-nitrogen oxides (NOx) ratios and large concentrations of total sub-micron aerosol mass relative to rBC mass concentrations. The more ozone- and OOA-rich air masses were associated with transport from continental Europe, while plumes from UK cities had higher HOA and NOx and fewer thickly coated rBC particles. We did not observe any significant change in the rBC mass absorption efficiency calculated from rBC mass and light absorption coefficients measured by a particle soot absorption photometer despite observing significant changes in aerosol composition and rBC mixing state. The contributions of light scattering and absorption to total extinction (quantified by the single scattering albedo; SSA) did change for different air masses, with lower SSA observed in
Directory of Open Access Journals (Sweden)
G. R. McMeeking
2011-09-01
Full Text Available Black carbon (BC aerosols absorb sunlight thereby leading to a positive radiative forcing and a warming of climate and can also impact human health through their impact on the respiratory system. The state of mixing of BC with other aerosol species, particularly the degree of internal/external mixing, has been highlighted as a major uncertainty in assessing its radiative forcing and hence its climate impact, but few in situ observations of mixing state exist. We present airborne single particle soot photometer (SP2 measurements of refractory BC (rBC mass concentrations and mixing state coupled with aerosol composition and optical properties measured in urban plumes and regional pollution over the United Kingdom. All data were obtained using instrumentation flown on the UK's BAe-146-301 large Atmospheric Research Aircraft (ARA operated by the Facility for Airborne Atmospheric Measurements (FAAM. We measured sub-micron aerosol composition using an aerosol mass spectrometer (AMS and used positive matrix factorization to separate hydrocarbon-like (HOA and oxygenated organic aerosols (OOA. We found a higher number fraction of thickly coated rBC particles in air masses with large OOA relative to HOA, higher ozone-to-nitrogen oxides (NOx ratios and large concentrations of total sub-micron aerosol mass relative to rBC mass concentrations. The more ozone- and OOA-rich air masses were associated with transport from continental Europe, while plumes from UK cities had higher HOA and NOx and fewer thickly coated rBC particles. We did not observe any significant change in the rBC mass absorption efficiency calculated from rBC mass and light absorption coefficients measured by a particle soot absorption photometer despite observing significant changes in aerosol composition and rBC mixing state. The contributions of light scattering and absorption to total extinction (quantified by the single scattering albedo; SSA did change for
DUST, Albedo Monte-Carlo Simulation of Neutron Streaming in Multi-legged Square Concrete Ducts
International Nuclear Information System (INIS)
1993-01-01
1 - Description of program or function: DUST simulates the thermal neutron streaming through multi-legged square concrete ducts. 2 - Method of solution: DUST uses the albedo Monte Carlo method. The albedo data used are in the form of empirical formulae based on the measured doubly differential albedo data. Sampling of the reflected polar and azimuthal angles is done by the rejection method. Variance reduction devices such as Russian Roulette are used. 3 - Restrictions on the complexity of the problem: - The albedo data and the subroutines for sampling the reflected polar and azimuthal angles are specific for concrete ducts. The maximum number of legs (as specified by dimension statements) is 5 and the maximum number of dose points is 50. The dose points considered are only in the last leg of the multi-legged duct
Non-Markovian dynamics of a qubit due to single-photon scattering in a waveguide
Fang, Yao-Lung L.; Ciccarello, Francesco; Baranger, Harold U.
2018-04-01
We investigate the open dynamics of a qubit due to scattering of a single photon in an infinite or semi-infinite waveguide. Through an exact solution of the time-dependent multi-photon scattering problem, we find the qubit's dynamical map. Tools of open quantum systems theory allow us then to show the general features of this map, find the corresponding non-Linbladian master equation, and assess in a rigorous way its non-Markovian nature. The qubit dynamics has distinctive features that, in particular, do not occur in emission processes. Two fundamental sources of non-Markovianity are present: the finite width of the photon wavepacket and the time delay for propagation between the qubit and the end of the semi-infinite waveguide.
International Nuclear Information System (INIS)
Aptowicz, Kevin B; Chang, Richard K
2005-01-01
Elastic light scattering from a single non-spherical particle of various morphologies has been measured simultaneously with a large angular range (90 deg. < θ < 165 deg. and 0 deg. < φ < 360 deg.) and with high angular resolution (1024 pixels in θ and 512 pixels in φ). Because the single-shot laser pulse is short (pulse duration of 70 ns), the tumbling and flowing particle can be treated as frozen in space. The large angle two-dimensional angular optical scattering (hereafter referred to as LA TAOS) intensity pattern, I(θ,φ), has been measured for a variety of particle morphology, such as the following: (1) single polystyrene latex (PSL) sphere; (2) cluster of PSL spheres; (3) single Bacillus subtilis (BG) spore; (4) cluster of BG spores; (5) dried aggregates of bio-aerosols as well as background clutter aerosols. All these measurements were made using the second harmonic of a Nd:YAG laser (0.532 μm). Islands structures in the LA TAOS patterns seem to be the prominent feature. Efforts are being made to extract metrics from these islands and compare them to theoretical results based on the T-matrix method
Stochastic dynamics of melt ponds and sea ice-albedo climate feedback
Sudakov, Ivan
Evolution of melt ponds on the Arctic sea surface is a complicated stochastic process. We suggest a low-order model with ice-albedo feedback which describes stochastic dynamics of melt ponds geometrical characteristics. The model is a stochastic dynamical system model of energy balance in the climate system. We describe the equilibria in this model. We conclude the transition in fractal dimension of melt ponds affects the shape of the sea ice albedo curve.
International Nuclear Information System (INIS)
Krieger, U.K.; Meier, P.
2011-01-01
We use single bi-sphere particles levitated in an electrodynamic balance to record two-dimensional angular scattering patterns at different angles of the coordinate system of the aggregate relative to the incident laser beam. Due to Brownian motion the particle covers the whole set of possible angles with time and allows to select patterns with high symmetry for analysis. These are qualitatively compared to numerical calculations. A small cluster of four spheres shows complex scattering patterns, comparison with computations suggest a low compactness for these clusters. An experimental procedure is proposed for studying restructuring effects occurring in mixed particles upon evaporation. - Research highlights: → Single levitated bi-sphere particle. → Two-dimensional angular scattering pattern. → Comparison experiment with computations.
Wells, Kelley C.; Martins, J. Vanderlei; Remer, Lorraine A.; Kreidenweis, Sonia M.; Stephens, Graeme L.
2012-01-01
Aerosols are tiny suspended particles in the atmosphere that scatter and absorb sunlight. Smoke particles are aerosols, as are sea salt, particulate pollution and airborne dust. When you look down at the earth from space sometimes you can see vast palls of whitish smoke or brownish dust being transported by winds. The reason that you can see these aerosols is because they are reflecting incoming sunlight back to the view in space. The reason for the difference in color between the different types of aerosol is that the particles arc also absorbing sunlight at different wavelengths. Dust appears brownish or reddish because it absorbs light in the blue wavelengths and scatters more reddish light to space, Knowing how much light is scattered versus how much is absorbed, and knowin that as a function of wavelength is essential to being able to quantify the role aerosols play in the energy balance of the earth and in climate change. It is not easy measuring the absorption properties of aerosols when they are suspended in the atmosphere. People have been doing this one substance at a time in the laboratory, but substances mix when they are in the atmosphere and the net absorption effect of all the particles in a column of air is a goal of remote sensing that has not yet been completely successful. In this paper we use a technique based on observing the point at which aerosols change from brightening the surface beneath to darkening it. If aerosols brighten a surface. they must scatter more light to space. If they darken the surface. they must be absorbing more. That cross over point is called the critical reflectance and in this paper we show that critical reflectance is a monotonic function of the intrinsic absorption properties of the particles. This parameter we call the single scattering albedo. We apply the technique to MODIS imagery over the Sahara and Sahel regions to retrieve the single scattering albedo in seven wavelengths, compare these retrievals to ground
Invariance for Single Curved Manifold
Castro, Pedro Machado Manhaes de
2012-01-01
Recently, it has been shown that, for Lambert illumination model, solely scenes composed by developable objects with a very particular albedo distribution produce an (2D) image with isolines that are (almost) invariant to light direction change. In this work, we provide and investigate a more general framework, and we show that, in general, the requirement for such in variances is quite strong, and is related to the differential geometry of the objects. More precisely, it is proved that single curved manifolds, i.e., manifolds such that at each point there is at most one principal curvature direction, produce invariant is surfaces for a certain relevant family of energy functions. In the three-dimensional case, the associated energy function corresponds to the classical Lambert illumination model with albedo. This result is also extended for finite-dimensional scenes composed by single curved objects. © 2012 IEEE.
Invariance for Single Curved Manifold
Castro, Pedro Machado Manhaes de
2012-08-01
Recently, it has been shown that, for Lambert illumination model, solely scenes composed by developable objects with a very particular albedo distribution produce an (2D) image with isolines that are (almost) invariant to light direction change. In this work, we provide and investigate a more general framework, and we show that, in general, the requirement for such in variances is quite strong, and is related to the differential geometry of the objects. More precisely, it is proved that single curved manifolds, i.e., manifolds such that at each point there is at most one principal curvature direction, produce invariant is surfaces for a certain relevant family of energy functions. In the three-dimensional case, the associated energy function corresponds to the classical Lambert illumination model with albedo. This result is also extended for finite-dimensional scenes composed by single curved objects. © 2012 IEEE.
Smol, Marzena; Kulczycka, Joanna; Kowalski, Zygmunt
2016-12-15
The aim of this research is to present the possibility of using the sewage sludge ash (SSA) generated in incineration plants as a secondary source of phosphorus (P). The importance of issues related to P recovery from waste materials results from European Union (UE) legislation, which indicated phosphorus as a critical raw material (CRM). Due to the risks of a shortage of supply and its impact on the economy, which is greater than other raw materials, the proper management of phosphorus resources is required in order to achieve global P security. Based on available databases and literature, an analysis of the potential use of SSA for P-recovery in Poland was conducted. Currently, approx. 43,000 Mg/year of SSA is produced in large and small incineration plants and according to in the Polish National Waste Management Plan 2014 (NWMP) further steady growth is predicted. This indicates a great potential to recycle phosphorus from SSA and to reintroduce it again into the value chain as a component of fertilisers which can be applied directly on fields. The amount of SSA generated in installations, both large and small, varies and this contributes to the fact that new and different P recovery technology solutions must be developed and put into use in the years to come (e.g. mobile/stationary P recovery installations). The creation of a database focused on the collection and sharing of data about the amount of P recovered in EU and Polish installations is identified as a helpful tool in the development of an efficient P management model for Poland. Copyright © 2016 Elsevier Ltd. All rights reserved.
Quality assurance of in-situ measurements of land surface albedo: A model-based approach
Adams, Jennifer; Gobron, Nadine; Widlowski, Jean-Luc; Mio, Corrado
2016-04-01
This paper presents the development of a model-based framework for assessing the quality of in-situ measurements of albedo used to validate land surface albedo products. Using a 3D Monte Carlo Ray Tracing (MCRT) radiative transfer model, a quality assurance framework is built based on simulated field measurements of albedo within complex 3D canopies and under various illumination scenarios. This method provides an unbiased approach in assessing the quality of field measurements, and is also able to trace the contributions of two main sources of uncertainty in field-measurements of albedo; those resulting from 1) the field measurement protocol, such as height or placement of field measurement within the canopy, and 2) intrinsic factors of the 3D canopy under specific illumination characteristics considered, such as the canopy structure and landscape heterogeneity, tree heights, ecosystem type and season.
Menon, Harilal B; Shirodkar, Shilpa; Kedia, Sumita; S, Ramachandran; Babu, Suresh; Moorthy, K Krishna
2014-01-15
Optical characterization of aerosol was performed by assessing the columnar aerosol optical depth (AOD) and angstrom wavelength exponent (α) using data from the Microtops II Sunphotometer. The data were collected on cloud free days over Goa, a coastal site along the west coast of India, from January to December 2008. Along with the composite aerosol, the black carbon (BC) mass concentration from the Aethalometer was also analyzed. The AOD0.500 μm and angstrom wavelength exponent (α) were in the range of 0.26 to 0.7 and 0.52 to 1.33, respectively, indicative of a significant seasonal shift in aerosol characteristics during the study period. The monthly mean AOD0.500 μm exhibited a bi-modal distribution, with a primary peak in April (0.7) and a secondary peak in October (0.54), whereas the minimum of 0.26 was observed in May. The monthly mean BC mass concentration varied between 0.31 μg/m(3) and 4.5 μg/m(3), and the single scattering albedo (SSA), estimated using the OPAC model, ranged from 0.87 to 0.97. Modeled aerosol optical properties were used to estimate the direct aerosol shortwave radiative forcing (DASRF) in the wavelength range 0.25 μm4.0 μm. The monthly mean forcing at the surface, at the top of the atmosphere (TOA) and in the atmosphere varied between -14.1 Wm(-2) and -35.6 Wm(-2), -6.7 Wm(-2) and -13.4 Wm(-2) and 5.5 Wm(-2) to 22.5 Wm(-2), respectively. These results indicate that the annual SSA cycle in the atmosphere is regulated by BC (absorbing aerosol), resulting in a positive forcing; however, the surface forcing was governed by the natural aerosol scattering, which yielded a negative forcing. These two conditions neutralized, resulting in a negative forcing at the TOA that remains nearly constant throughout the year. © 2013.
Lattice and Molecular Vibrations in Single Crystal I2 at 77 K by Inelastic Neutron Scattering
DEFF Research Database (Denmark)
Smith, H. G.; Nielsen, Mourits; Clark, C. B.
1975-01-01
Phonon dispersion curves of single crystal iodine at 77 K have been measured by one-phonon coherent inelastic neutron scattering techniques. The data are analysed in terms of two Buckingham-six intermolecular potentials; one to represent the shortest intermolecular interaction (3.5 Å) and the other...
Multidecadal Variability in Surface Albedo Feedback Across CMIP5 Models
Schneider, Adam; Flanner, Mark; Perket, Justin
2018-02-01
Previous studies quantify surface albedo feedback (SAF) in climate change, but few assess its variability on decadal time scales. Using the Coupled Model Intercomparison Project Version 5 (CMIP5) multimodel ensemble data set, we calculate time evolving SAF in multiple decades from surface albedo and temperature linear regressions. Results are meaningful when temperature change exceeds 0.5 K. Decadal-scale SAF is strongly correlated with century-scale SAF during the 21st century. Throughout the 21st century, multimodel ensemble mean SAF increases from 0.37 to 0.42 W m-2 K-1. These results suggest that models' mean decadal-scale SAFs are good estimates of their century-scale SAFs if there is at least 0.5 K temperature change. Persistent SAF into the late 21st century indicates ongoing capacity for Arctic albedo decline despite there being less sea ice. If the CMIP5 multimodel ensemble results are representative of the Earth, we cannot expect decreasing Arctic sea ice extent to suppress SAF in the 21st century.
Impacto do desmatamento de uma área de mangue no albedo superficial
Directory of Open Access Journals (Sweden)
Carlos Alexandre Santos Querino
2013-12-01
Full Text Available Manguezais são ecossistemas peculiares encontrados nas regiões tropicais. A degradação dos manguezais altera o balanço superficial de radiação, e por consequência o albedo. Para avaliar e comparar o albedo, nesse ambiente foram instaladas duas plataformas de coletas de dados micrometeorológicos no município de Marechal Deodoro, Alagoas, Brasil, no período de outubro de 2004 a outubro de 2005. No mangue nativo (9º42' 18"S; 35º 48' 32" W foram instalados dois piranômetros acima da copa das árvores, e em outubro de 2005, um terceiro dentro do mangue. Na área degradada (9º 36' 38" S; 35º 46' 03" W, os sensores foram posicionados a uma altura de dois metros em relação ao solo. Observou-se que o albedo sobre a floresta de mangue, em geral, é maior em média, 5 pontos percentuais superior em relação à outras florestas tropicais, como por exemplo, a Amazônia. Internamente notou-se que o mesmo não ultrapassou os 13% e seu valor máximo ocorre no horário de menor albedo da copa ≈ 20%, evidenciando a influência da maré. Já na área degradada, o albedo médio foi de 35%, o que implica em uma elevação aproximada de 49% quando substituída a cobertura de floresta natural.
He, Cenlin; Liou, Kuo-Nan; Takano, Yoshi; Yang, Ping; Qi, Ling; Chen, Fei
2018-01-01
We quantify the effects of grain shape and multiple black carbon (BC)-snow internal mixing on snow albedo by explicitly resolving shape and mixing structures. Nonspherical snow grains tend to have higher albedos than spheres with the same effective sizes, while the albedo difference due to shape effects increases with grain size, with up to 0.013 and 0.055 for effective radii of 1,000 μm at visible and near-infrared bands, respectively. BC-snow internal mixing reduces snow albedo at wavelengths external mixing, internal mixing enhances snow albedo reduction by a factor of 1.2-2.0 at visible wavelengths depending on BC concentration and snow shape. The opposite effects on albedo reductions due to snow grain nonsphericity and BC-snow internal mixing point toward a careful investigation of these two factors simultaneously in climate modeling. We further develop parameterizations for snow albedo and its reduction by accounting for grain shape and BC-snow internal/external mixing. Combining the parameterizations with BC-in-snow measurements in China, North America, and the Arctic, we estimate that nonspherical snow grains reduce BC-induced albedo radiative effects by up to 50% compared with spherical grains. Moreover, BC-snow internal mixing enhances the albedo effects by up to 30% (130%) for spherical (nonspherical) grains relative to external mixing. The overall uncertainty induced by snow shape and BC-snow mixing state is about 21-32%.
Ocko, Ilissa B.; Ginoux, Paul A.
2017-04-01
Anthropogenic aerosols are a key factor governing Earth's climate and play a central role in human-caused climate change. However, because of aerosols' complex physical, optical, and dynamical properties, aerosols are one of the most uncertain aspects of climate modeling. Fortunately, aerosol measurement networks over the past few decades have led to the establishment of long-term observations for numerous locations worldwide. Further, the availability of datasets from several different measurement techniques (such as ground-based and satellite instruments) can help scientists increasingly improve modeling efforts. This study explores the value of evaluating several model-simulated aerosol properties with data from spatially collocated instruments. We compare aerosol optical depth (AOD; total, scattering, and absorption), single-scattering albedo (SSA), Ångström exponent (α), and extinction vertical profiles in two prominent global climate models (Geophysical Fluid Dynamics Laboratory, GFDL, CM2.1 and CM3) to seasonal observations from collocated instruments (AErosol RObotic NETwork, AERONET, and Cloud-Aerosol Lidar with Orthogonal Polarization, CALIOP) at seven polluted and biomass burning regions worldwide. We find that a multi-parameter evaluation provides key insights on model biases, data from collocated instruments can reveal underlying aerosol-governing physics, column properties wash out important vertical distinctions, and improved models does not mean all aspects are improved. We conclude that it is important to make use of all available data (parameters and instruments) when evaluating aerosol properties derived by models.
Thermo-optical properties of residential coals and combustion aerosols
Pintér, Máté; Ajtai, Tibor; Kiss-Albert, Gergely; Kiss, Diána; Utry, Noémi; Janovszky, Patrik; Palásti, Dávid; Smausz, Tomi; Kohut, Attila; Hopp, Béla; Galbács, Gábor; Kukovecz, Ákos; Kónya, Zoltán; Szabó, Gábor; Bozóki, Zoltán
2018-04-01
In this study, we present the inherent optical properties of carbonaceous aerosols generated from various coals (hard through bituminous to lignite) and their correlation with the thermochemical and energetic properties of the bulk coal samples. The nanoablation method provided a unique opportunity for the comprehensive investigation of the generated particles under well controlled laboratory circumstances. First, the wavelength dependent radiative features (optical absorption and scattering) and the size distribution (SD) of the generated particulate matter were measured in-situ in aerosol phase using in-house developed and customised state-of-the-art instrumentation. We also investigated the morphology and microstructure of the generated particles using Transmission Electron Microscopy (TEM) and Electron Diffraction (ED). The absorption spectra of the measured samples (quantified by Absorption Angström Exponent (AAE)) were observed to be distinctive. The correlation between the thermochemical features of bulk coal samples (fixed carbon (FC) to volatile matter (VM) ratio and calorific value (CV)) and the AAE of aerosol assembly were found to be (r2 = 0.97 and r2 = 0.97) respectively. Lignite was off the fitted curves in both cases most probably due to its high optically inactive volatile material content. Although more samples are necessary to be investigated to draw statistically relevant conclusion, the revealed correlation between CV and Single Scattering Albedo (SSA) implies that climatic impact of coal combusted aerosol could depend on the thermal and energetic properties of the bulk material.
International Nuclear Information System (INIS)
Sun, Wenbo; Videen, Gorden; Fu, Qiang; Hu, Yongxiang
2013-01-01
As fundamental parameters for polarized-radiative-transfer calculations, the single-scattering phase matrix of irregularly shaped aerosol particles must be accurately modeled. In this study, a scattered-field finite-difference time-domain (FDTD) model and a scattered-field pseudo-spectral time-domain (PSTD) model are developed for light scattering by arbitrarily shaped dielectric aerosols. The convolutional perfectly matched layer (CPML) absorbing boundary condition (ABC) is used to truncate the computational domain. It is found that the PSTD method is generally more accurate than the FDTD in calculation of the single-scattering properties given similar spatial cell sizes. Since the PSTD can use a coarser grid for large particles, it can lower the memory requirement in the calculation. However, the Fourier transformations in the PSTD need significantly more CPU time than simple subtractions in the FDTD, and the fast Fourier transform requires a power of 2 elements in calculations, thus using the PSTD could not significantly reduce the CPU time required in the numerical modeling. Furthermore, because the scattered-field FDTD/PSTD equations include incident-wave source terms, the FDTD/PSTD model allows for the inclusion of an arbitrarily incident wave source, including a plane parallel wave or a Gaussian beam like those emitted by lasers usually used in laboratory particle characterizations, etc. The scattered-field FDTD and PSTD light-scattering models can be used to calculate single-scattering properties of arbitrarily shaped aerosol particles over broad size and wavelength ranges. -- Highlights: • Scattered-field FDTD and PSTD models are developed for light scattering by aerosols. • Convolutional perfectly matched layer absorbing boundary condition is used. • PSTD is generally more accurate than FDTD in calculating single-scattering properties. • Using same spatial resolution, PSTD requires much larger CPU time than FDTD
Johns, Maureen; Liu, Hanli
2003-07-01
When light interacts with tissue, it can be absorbed, scattered or reflected. Such quantitative information can be used to characterize the optical properties of tissue, differentiate tissue types in vivo, and identify normal versus diseased tissue. The purpose of this research is to develop an algorithm that determines the reduced scattering coefficient (μs") of tissues from a single optical reflectance spectrum with a small source-detector separation. The basic relationship between μs" and optical reflectance was developed using Monte Carlo simulations. This produced an analytical equation containing μs" as a function of reflectance. To experimentally validate this relationship, a 1.3-mm diameter fiber optic probe containing two 400-micron diameter fibers was used to deliver light to and collect light from Intralipid solutions of various concentrations. Simultaneous measurements from optical reflectance and an ISS oximeter were performed to validate the calculated μs" values determined by the reflectance measurement against the 'gold standard" ISS readings. The calculated μs" values deviate from the expected values by approximately -/+ 5% with Intralipid concentrations between 0.5 - 2.5%. The scattering properties within this concentration range are similar to those of in vivo tissues. Additional calculations are performed to determine the scattering properties of rat brain tissues and to discuss accuracy of the algorithm for measured samples with a broad range of the absorption coefficient (μa).
Directory of Open Access Journals (Sweden)
Y. H. Zhang
2008-09-01
Full Text Available The scattering and absorption of solar radiation by atmospheric aerosols is a key element of the Earth's radiative energy balance and climate. The optical properties of aerosol particles are, however, highly variable and not well characterized, especially near newly emerging mega-cities. In this study, aerosol optical properties were measured at a rural site approximately 60 km northwest of the mega-city Guangzhou in southeast China. The measurements were part of the PRIDE-PRD2006 intensive campaign, covering the period of 1–30 July 2006. Scattering and absorption coefficients of dry aerosol particles with diameters up to 10 μm (PM10 were determined with a three-wavelength integrating nephelometer and with a photoacoustic spectrometer, respectively.
Averaged over the measurement campaign (arithmetic mean ± standard deviation, the total scattering coefficients were 200±133 Mm−1 (450 nm, 151±103 Mm−1 (550 nm and 104±72 Mm−1 (700 nm and the absorption coefficient was 34.3±26.5 Mm−1 (532 nm. The average Ångström exponent was 1.46±0.21 (450 nm/700 nm and the average single scattering albedo was 0.82±0.07 (532 nm with minimum values as low as 0.5. The low single scattering albedo values indicate a high abundance, as well as strong sources, of light absorbing carbon (LAC. The ratio of LAC to CO concentration was highly variable throughout the campaign, indicating a complex mix of different combustion sources. The scattering and absorption coefficients, as well as the Ångström exponent and single scattering albedo, exhibited pronounced diurnal cycles, which can be attributed to boundary layer mixing effects and enhanced nighttime emissions of LAC (diesel soot from regulated truck traffic. The daytime average mid-visible single scattering albedo of 0.87 appears to be more suitable for climate modeling purposes than the 24-h average of 0.82, as the latter value is
de Grenier, Muriel; Pinet, Patrick C.
1995-06-01
A nearly global coverage of the martian eastern hemisphere, acquired under small phase angles and varying observational geometries conditions, has been produced from 1988 opposition by spectral (0.5-1 μm) imaging data obtained at the Pic du Midi Observatory in France. From this data set, the methodology presented here permits a systematic analysis of martian photometric behavior at a regional scale of 100-300 km in the visible and near-infrared. The quantification of limb-darkening as a function of wavelength and surface albedo gives access in martian regional properties as a function of wavelength and surface albedo and results in the production of visible and near-infrared geometric albedo maps. A linear relation between the limb darkening parameter k and geometric albedo exists in the near infrared. Based on laboratory studies, it suggests a spectral response of particulate type for the martian soil. Conversely, in the visible, the value of k parameter is 0.6 independent of albedo and is consistent with a single scattering photometric behavior in the surface layer. However, the observed change in the martian photometry from single to multiple scattering may be partially due to a large contribution of atmospheric scattering above 0.7 μm. In the absence of a multitemporal dataset analysis, it must be emphasized that the present results are a priori only pertinent to the atmospheric and surface conditions existing on Mars at the time of observation. However, this analysis may contribute to characterize some physical properties, such as surface roughness. In the near-infrared, for bright terrains, k tends to 0.8 and agrees with the presence of very fine particulate materials. Photometry of dark areas is more irregular (0.48 duricrust. Finally, we evaluate the influence of reflectance geometrical effects on the multispectral and spectroscopic data of the martian surface.
Albedo neutron dosimetry in Germany: regulations and performance
International Nuclear Information System (INIS)
Luszik-Bhadra, M.; Zimbal, A.; Busch, F.; Jordan, M.; Eichelberger, A.; Engelhardt, J.; Martini, E.; Figel, M.; Haninger, T.; Frasch, G.; Guenther, K.; Seifert, R.; Rimpler, A.
2014-01-01
Personal neutron dosimetry has been performed in Germany using albedo dosemeters for >20 y. This paper describes the main principles, the national standards, regulations and recommendations, the quality management and the overall performance, giving some examples. (authors)
Potter, S.; Solvik, K.; Erb, A.; Goetz, S. J.; Johnstone, J. F.; Mack, M. C.; Randerson, J. T.; Roman, M. O.; Schaaf, C. L.; Turetsky, M. R.; Veraverbeke, S.; Wang, Z.; Rogers, B. M.
2017-12-01
Boreal forest dynamics including succession, composition, carbon cycling, and surface-atmosphere energy exchanges are largely driven by fire. In Alaska and Canada, burned area and fire frequency have increased since the 1970s, and are projected to continue increasing into the 21st century. In contrast to other biomes, alterations to surface albedo from fires in North American boreal forests are one of the primary feedbacks to climate. Understanding how altered fire regimes impact vegetation composition and energy budgets is therefore critical to forecasting regional and global climate change. High-severity fires cause winter and spring albedo to increase due to increased snow exposure and replacement of evergreen conifers by deciduous broadleaf trees. Although summer albedo decreases initially due to the deposition of black carbon and charred surfaces, it typically increases for several decades thereafter when younger and brighter deciduous trees dominate. The net effect of these albedo changes is expected to result in substantive radiative cooling, but there has been little research to examine how albedo trajectories differ spatially and temporally as a result of differences in burn severity, species composition, topography, climate and soil properties, and what the associated implications for future energy balances are. Here we investigate drivers of post-fire monthly albedo trajectories across Canada and Alaska using a new Collection V006 500 m MODIS daily blue-sky albedo product and historical fires from the Canadian and Alaskan National Fire Databases. The impacts of varying fuel type, landscape position, soils, climate, and burn severity on monthly albedo trajectories are explored using a Random Forest model. This information is then used to predict long-term monthly albedo and radiative forcing for fires that occurred during the MODIS era (2001-2012). We find that higher severity burns in denser forests and environmental conditions that promote either
The high albedo of the hot Jupiter Kepler-7b
DEFF Research Database (Denmark)
Demory, B.-O.; Seager, S.; Madhusudhan, N.
2011-01-01
Hot Jupiters are expected to be dark from both observations (albedo upper limits) and theory (alkali metals and/or TiO and VO absorption). However, only a handful of hot Jupiters have been observed with high enough photometric precision at visible wavelengths to investigate these expectations....... The NASA Kepler mission provides a means to widen the sample and to assess the extent to which hot Jupiter albedos are low. We present a global analysis of Kepler-7 b based on Q0-Q4 data, published radial velocities, and asteroseismology constraints. We measure an occultation depth in the Kepler bandpass...
Scattering by two spheres: Theory and experiment
DEFF Research Database (Denmark)
Bjørnø, Irina; Jensen, Leif Bjørnø
1998-01-01
of suspended sediments. The scattering properties of single regular-shaped particles have been studied in depth by several authors in the past. However, single particle scattering cannot explain all features of scattering by suspended sediment. When the concentration of particles exceeds a certain limit...... on three issues: (1) to develop a simplified theory for scattering by two elastical spheres; (2) to measure the scattering by two spheres in a water tank, and (3) to compare the theoretical/numerical results with the measured data. A number of factors influencing multiple scattering, including...
Energy Technology Data Exchange (ETDEWEB)
Roman, Miguel O. [NASA Goddard Space Flight Center; Schaaf, Crystal [Boston University; Woodcock, Curtis E. [Boston University; Strahler, Alan [Boston University; Yang, Xiaoyuan [Boston University; Braswell, Rob H. [Complex Systems Research Center, Durham, NH; Curtis, Peter [Ohio State University, The, Columbus; Davis, Kenneth J. [Pennsylvania State University; Dragoni, Danilo [Indiana University; Goulden, Michael L. [University of California, Irvine; Gu, Lianhong [ORNL; Hollinger, David Y [ORNL; Meyers, Tilden P. [NOAA, Oak Ridge, TN; Wilson, Tim B. [NOAA; Munger, J. William [Harvard University; Wofsy, Steve [Harvard University; Privette, Jeffrey L. [NOAA; Richardson, Andrew D. [Harvard University
2009-11-01
A new methodology for establishing the spatial representativeness of tower albedo measurements that are routinely used in validation of satellite retrievals from global land surface albedo and reflectance anisotropy products is presented. This method brings together knowledge of the intrinsic biophysical properties of a measurement site, and the surrounding landscape to produce a number of geostatistical attributes that describe the overall variability, spatial extent, strength of the spatial correlation, and spatial structure of surface albedo patterns at separate seasonal periods throughout the year. Variogram functions extracted from Enhanced Thematic Mapper Plus (ETM+) retrievals of surface albedo using multiple spatial and temporal thresholds were used to assess the degree to which a given point (tower) measurement is able to capture the intrinsic variability of the immediate landscape extending to a satellite pixel. A validation scheme was implemented over a wide range of forested landscapes, looking at both deciduous and coniferous sites, from tropical to boreal ecosystems. The experiment focused on comparisons between tower measurements of surface albedo acquired at local solar noon and matching retrievals from the MODerate Resolution Imaging Spectroradiometer (MODIS) (Collection V005) Bidirectional Reflectance Distribution Function (BRDF)/albedo algorithm. Assessments over a select group of field stations with comparable landscape features and daily retrieval scenarios further demonstrate the ability of this technique to identify measurement sites that contain the intrinsic spatial and seasonal features of surface albedo over sufficiently large enough footprints for use in modeling and remote sensing studies. This approach, therefore, improves our understanding of product uncertainty both in terms of the representativeness of the field data and its relationship to the larger satellite pixel.
Energy Technology Data Exchange (ETDEWEB)
Borel, C.C.; Gerstl, S.A.W. [Los Alamos National Lab., NM (United States); Tornow, C. [German Aerospace Research Establishment, Berlin (Germany)
1996-05-01
Changes in the Earth`s surface albedo impact the atmospheric and global energy budget and contribute to the global climate change. It is now recognized that multispectral and multiangular views of the Earth`s top of the atmosphere (TOA) albedo are necessary to provide information on albedo changes. In this paper we describe four semi- empirical bidirectional reflectance factor (BRF) models which are inverted for two and three unknowns. The retrieved BRF parameters are then used to compute the TOA spectral albedo for clear sky conditions. Using this approach we find that the albedo can be computed with better than one percent error in the visible and one and a half percent in the near infrared (NIR) for most surface types. Global monitoring of the earth radiation budget is one of the main goals in global change research programs. Thus global measurements of the TOA albedo are important. Our goals is to compute the TOA spectral albedo for clear sky conditions.
Coherent anti-Stokes Raman scattering microscopy of single nanodiamonds
Pope, Iestyn; Payne, Lukas; Zoriniants, George; Thomas, Evan; Williams, Oliver; Watson, Peter; Langbein, Wolfgang; Borri, Paola
2014-11-01
Nanoparticles have attracted enormous attention for biomedical applications as optical labels, drug-delivery vehicles and contrast agents in vivo. In the quest for superior photostability and biocompatibility, nanodiamonds are considered one of the best choices due to their unique structural, chemical, mechanical and optical properties. So far, mainly fluorescent nanodiamonds have been utilized for cell imaging. However, their use is limited by the efficiency and costs in reliably producing fluorescent defect centres with stable optical properties. Here, we show that single non-fluorescing nanodiamonds exhibit strong coherent anti-Stokes Raman scattering (CARS) at the sp3 vibrational resonance of diamond. Using correlative light and electron microscopy, the relationship between CARS signal strength and nanodiamond size is quantified. The calibrated CARS signal in turn enables the analysis of the number and size of nanodiamonds internalized in living cells in situ, which opens the exciting prospect of following complex cellular trafficking pathways quantitatively.
Coherent anti-Stokes Raman scattering microscopy of single nanodiamonds.
Pope, Iestyn; Payne, Lukas; Zoriniants, George; Thomas, Evan; Williams, Oliver; Watson, Peter; Langbein, Wolfgang; Borri, Paola
2014-11-01
Nanoparticles have attracted enormous attention for biomedical applications as optical labels, drug-delivery vehicles and contrast agents in vivo. In the quest for superior photostability and biocompatibility, nanodiamonds are considered one of the best choices due to their unique structural, chemical, mechanical and optical properties. So far, mainly fluorescent nanodiamonds have been utilized for cell imaging. However, their use is limited by the efficiency and costs in reliably producing fluorescent defect centres with stable optical properties. Here, we show that single non-fluorescing nanodiamonds exhibit strong coherent anti-Stokes Raman scattering (CARS) at the sp(3) vibrational resonance of diamond. Using correlative light and electron microscopy, the relationship between CARS signal strength and nanodiamond size is quantified. The calibrated CARS signal in turn enables the analysis of the number and size of nanodiamonds internalized in living cells in situ, which opens the exciting prospect of following complex cellular trafficking pathways quantitatively.
Pollack, J. B.; Cuzzi, J. N.
1980-01-01
A semiempirical theory is developed which is based on simple physical principles and comparisons with laboratory measurements. The ultimate utility of this approach rests on its ability to successfully reproduce the observed single-scattering phase function for a wide variety of particle shapes, sizes and refractive indices. This approximate theory is developed for evaluating the interaction of randomly oriented, nonspherical particles with the total intensity component of electromagnetic radiation. Mie theory is used when the particle size parameter x (ratio of particle circumference to wavelength) is less than some upper bound x sub zero (about 5). For x greater than x sub zero, the interaction is divided into three components: diffraction, external reflection and transmission. The application of the theory is illustrated by considering the influence of the shape of tropospheric aerosols on their contribution to the earth's global albedo.
Triton: Scattering models and surface/atmosphere constraints
International Nuclear Information System (INIS)
Thompson, W.R.
1989-01-01
Modeling of Triton's spectrum indicates a bright scattering layer of optical depth τ≅3 overlying an optically deep layer of CH 4 with high absorption and little scattering. UV absorption in the spectrum indicates τ≅0.3 of red-yellow haze, although some color may also arise from complex organics partially visible on the surface. An analysis of this and other (spectro)photometric evidence indicates that Triton most likely has a bright surface, which was partially visible in 1977-1980. Geometric albedo p=0.62 +0.18 -0.12 , radius r = 1480 ± 180 km, and temperature T = 48 ± 6 K. With scattering optical depths of 0.3-3 and ∼1-10 mb of N 2 , a Mars-like atmospheric density and surface visibility pertain. Imaging with the 0.62μm CH 4 filter of the Voyager 2 wide angle camera could show ∼20% contrast between the average surface and clean exposures of CH 4 ice (which is not limited to the polar caps). Low far-infrared atmospheric opacity will in principle allow the detection of thermal gradients in the surface caused by optically transmitting but infrared opaque CH 4 and N 2 ice
A new albedo parameterization for use in climate models over the Antarctic ice sheet
Kuipers Munneke, P.|info:eu-repo/dai/nl/304831891; van den Broeke, M.R.|info:eu-repo/dai/nl/073765643; Lenaerts, J.T.M.|info:eu-repo/dai/nl/314850163; Flanner, M.G.; Gardner, A.S.; van de Berg, W.J.|info:eu-repo/dai/nl/304831611
2011-01-01
A parameterization for broadband snow surface albedo, based on snow grain size evolution, cloud optical thickness, and solar zenith angle, is implemented into a regional climate model for Antarctica and validated against field observations of albedo for the period 1995–2004. Over the Antarctic
Albedo Neutron Dosimetry in a Deep Geological Disposal Repository for High-Level Nuclear Waste.
Pang, Bo; Becker, Frank
2017-04-28
Albedo neutron dosemeter is the German official personal neutron dosemeter in mixed radiation fields where neutrons contribute to personal dose. In deep geological repositories for high-level nuclear waste, where neutrons can dominate the radiation field, it is of interest to investigate the performance of albedo neutron dosemeter in such facilities. In this study, the deep geological repository is represented by a shielding cask loaded with spent nuclear fuel placed inside a rock salt emplacement drift. Due to the backscattering of neutrons in the drift, issues concerning calibration of the dosemeter arise. Field-specific calibration of the albedo neutron dosemeter was hence performed with Monte Carlo simulations. In order to assess the applicability of the albedo neutron dosemeter in a deep geological repository over a long time scale, spent nuclear fuel with different ages of 50, 100 and 500 years were investigated. It was found out, that the neutron radiation field in a deep geological repository can be assigned to the application area 'N1' of the albedo neutron dosemeter, which is typical in reactors and accelerators with heavy shielding. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Cescatti, Alessandro; Marcolla, Barbara; Vannan, Suresh K. Santhana; Pan, Jerry Yun; Roman, Miguel O.; Yang, Xiaoyuan; Ciais, Philippe; Cook, Robert B.; Law, Beverly E.; Matteucci, Girogio;
2012-01-01
Surface albedo is a key parameter in the Earth's energy balance since it affects the amount of solar radiation directly absorbed at the planet surface. Its variability in time and space can be globally retrieved through the use of remote sensing products. To evaluate and improve the quality of satellite retrievals, careful intercomparisons with in situ measurements of surface albedo are crucial. For this purpose we compared MODIS albedo retrievals with surface measurements taken at 53 FLUXNET sites that met strict conditions of land cover homogeneity. A good agreement between mean yearly values of satellite retrievals and in situ measurements was found (R(exp 2)= 0.82). The mismatch is correlated to the spatial heterogeneity of surface albedo, stressing the relevance of land cover homogeneity when comparing point to pixel data. When the seasonal patterns of MODIS albedo is considered for different plant functional types, the match with surface observation is extremely good at all forest sites. On the contrary, in non-forest sites satellite retrievals underestimate in situ measurements across the seasonal cycle. The mismatch observed at grasslands and croplands sites is likely due to the extreme fragmentation of these landscapes, as confirmed by geostatistical attributes derived from high resolution scenes.