WorldWideScience

Sample records for silent vsg es

  1. Research on Improved VSG Control Algorithm Based on Capacity-Limited Energy Storage System

    Directory of Open Access Journals (Sweden)

    Yanfeng Ma

    2018-03-01

    Full Text Available A large scale of renewable energy employing grid connected electronic inverters fail to contribute inertia or damping to power systems, and, therefore, may bring negative effects to the stability of power system. As a solution, an advanced Virtual Synchronous Generator (VSG control technology based on Hamilton approach is introduced in this paper firstly to support the frequency and enhance the suitability and robustness of the system. The charge and discharge process of power storage devices forms the virtual inertia and damping of VSG, and, therefore, limits on storage capacity may change the coefficients of VSG. To provide a method in keeping system output in an acceptable level with the capacity restriction in a transient period, an energy control algorithm is designed for VSG adaptive control. Finally, simulations are conducted in DIgSILENT to demonstrate the correctness of the algorithm. The demonstration shows: (1 the proposed control model aims at better system robustness and stability; and (2 the model performs in the environment closer to practical engineering by fitting the operation state of storage system.

  2. Dicty_cDB: VSG614 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSG614 (Link to dictyBase) - - - - VSG614F (Link to Original s...ite) VSG614F 56 - - - - - - Show VSG614 Library VS (Link to library) Clone ID VSG614 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/V...M029513.1 IpSkn01547 Skin cDNA library Ictalurus punctatus cDNA 5', mRNA sequence

  3. Trypanosoma brucei gambiense adaptation to different mammalian sera is associated with VSG expression site plasticity.

    Science.gov (United States)

    Cordon-Obras, Carlos; Cano, Jorge; González-Pacanowska, Dolores; Benito, Agustin; Navarro, Miguel; Bart, Jean-Mathieu

    2013-01-01

    Trypanosoma brucei gambiense infection is widely considered an anthroponosis, although it has also been found in wild and domestic animals. Thus, fauna could act as reservoir, constraining the elimination of the parasite in hypo-endemic foci. To better understand the possible maintenance of T. b. gambiense in local fauna and investigate the molecular mechanisms underlying adaptation, we generated adapted cells lines (ACLs) by in vitro culture of the parasites in different mammalian sera. Using specific antibodies against the Variant Surface Glycoproteins (VSGs) we found that serum ACLs exhibited different VSG variants when maintained in pig, goat or human sera. Although newly detected VSGs were independent of the sera used, the consistent appearance of different VSGs suggested remodelling of the co-transcribed genes at the telomeric Expression Site (VSG-ES). Thus, Expression Site Associated Genes (ESAGs) sequences were analysed to investigate possible polymorphism selection. ESAGs 6 and 7 genotypes, encoding the transferrin receptor (TfR), expressed in different ACLs were characterised. In addition, we quantified the ESAG6/7 mRNA levels and analysed transferrin (Tf) uptake. Interestingly, the best growth occurred in pig and human serum ACLs, which consistently exhibited a predominant ESAG7 genotype and higher Tf uptake than those obtained in calf and goat sera. We also detected an apparent selection of specific ESAG3 genotypes in the pig and human serum ACLs, suggesting that other ESAGs could be involved in the host adaptation processes. Altogether, these results suggest a model whereby VSG-ES remodelling allows the parasite to express a specific set of ESAGs to provide selective advantages in different hosts. Finally, pig serum ACLs display phenotypic adaptation parameters closely related to human serum ACLs but distinct to parasites grown in calf and goat sera. These results suggest a better suitability of swine to maintain T. b. gambiense infection supporting

  4. Dicty_cDB: VSG286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSG286 (Link to dictyBase) - - - Contig-U16209-1 VSG286E (Link... Clone ID VSG286 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ictalurus furcatus cDNA 5' similar to... Ribosomal protein Sa (laminin receptor 1), mRNA sequence. 46 2e-11 4 CK406973 |CK406973.1 AUF_IfLvr_212_m02 Ict...alurus furcatus liver cDNA library Ictalurus furcatus cDNA 5' similar to lami

  5. Crustal Structure of Khövsgöl, Mongolia

    Science.gov (United States)

    Scott, A. M.; Meltzer, A.; Stachnik, J.; Russo, R.; Munkhuu, U.; Tsagaan, B.

    2017-12-01

    Mongolia is part of the Central Asian Orogenic Belt, an accretionary event that spanned 800 million years from the mid-Proterozoic to mid-Phanerozoic. As a result of the past collisional and rifting events, the modern Khövsgöl rift system of northern Mongolia contains a heterogeneous lithospheric structure. The current rift system has three parallel N-S trending basins that roughly align with terrane boundaries. Structures inherited during the accretionary events may be a factor influencing regional deformation. The forces that drive local deformation are not well understood, but varying processes have been proposed: far-field effects of India-Eurasian plate convergence, westward subduction of the Pacific plate, magmatic underplating at the base of the crust, mantle plume activity, and asthenospheric mantle convection. Determining the nature of crustal features within this poorly understood region may illuminate processes that control rifting within intracontinental settings. A network of 26 broadband seismic stations encompassing 200 square kilometers of the Khövsgöl rift system were deployed from August 2014 to June 2016. More than 2100 events were detected, and most earthquakes were concentrated near rift structures. Events between Busiin-Gol and Darkhad, the westernmost and central basins of the Khövsgöl rift system, are distributed within the crust. An active fault is outlined along the eastern border of the Darkhad basin. Khövsgöl earthquakes bound both sides of the rift. Along the northern border of Lake Khövsgöl, seismic events define a shallow active fault orthogonal to the basin. The largest event recorded within the network was a magnitude ml=5.2 located near the northeastern border of Lake Khövsgöl on 12-05-2014. The focal mechanism of this earthquake is predominantly strike-slip, but also includes an extensional component. This work focuses on earthquake relocation and calculating moment tensors and focal mechanisms of larger regional

  6. 'Silent mentors'

    DEFF Research Database (Denmark)

    Douglas-Jones, Rachel

    2017-01-01

    Unlike cadaver donation in the West, which has to a large degree maintained the anonymity of the body used to teach medical students, the Taiwanese Tzu Chi Buddhist Silent Mentor programme at the centre of this article foregrounds the identity of the training cadaver as an essential element in me...... for medical pedagogy, body donation, and Buddhist practices prompted by this programme, putting the ‘Silent Mentors’ into conversation with the ‘new immortalities’ of this special issue....

  7. How Does the VSG Coat of Bloodstream Form African Trypanosomes Interact with External Proteins?

    Directory of Open Access Journals (Sweden)

    Angela Schwede

    2015-12-01

    Full Text Available Variations on the statement "the variant surface glycoprotein (VSG coat that covers the external face of the mammalian bloodstream form of Trypanosoma brucei acts a physical barrier" appear regularly in research articles and reviews. The concept of the impenetrable VSG coat is an attractive one, as it provides a clear model for understanding how a trypanosome population persists; each successive VSG protects the plasma membrane and is immunologically distinct from previous VSGs. What is the evidence that the VSG coat is an impenetrable barrier, and how do antibodies and other extracellular proteins interact with it? In this review, the nature of the extracellular surface of the bloodstream form trypanosome is described, and past experiments that investigated binding of antibodies and lectins to trypanosomes are analysed using knowledge of VSG sequence and structure that was unavailable when the experiments were performed. Epitopes for some VSG monoclonal antibodies are mapped as far as possible from previous experimental data, onto models of VSG structures. The binding of lectins to some, but not to other, VSGs is revisited with more recent knowledge of the location and nature of N-linked oligosaccharides. The conclusions are: (i Much of the variation observed in earlier experiments can be explained by the identity of the individual VSGs. (ii Much of an individual VSG is accessible to antibodies, and the barrier that prevents access to the cell surface is probably at the base of the VSG N-terminal domain, approximately 5 nm from the plasma membrane. This second conclusion highlights a gap in our understanding of how the VSG coat works, as several plasma membrane proteins with large extracellular domains are very unlikely to be hidden from host antibodies by VSG.

  8. Silent Thyroiditis

    Science.gov (United States)

    Walker, Peter

    1984-01-01

    Silent or painless thyroiditis is a frequent cause of transient hyperthyroidism, which is characterized by recent onset of symptoms in a patient with a normal to modestly enlarged and firm thyroid gland. The hallmarks of the disease are the absence of thyroidal pain or tenderness and a markedly reduced radioiodine uptake. Histologically, the gland is characterized by an important lymphocytic infiltration, occasionally to the point of lymphoid follicle formation. However, other indices of an autoimmune cause are usually absent. The disease appears to have a predilection for the postpartum period. Relapses may occur with subsequent pregnancies. Otherwise, the course is usually benign and transient, requiring moderate doses of β-adrenergic blocking agents for symptomatic relief. No pathogenetic factors are known, but the disease may conceivably have an autoimmune basis, particularly in the postpartum patient. PMID:21278944

  9. FEP catalogue for the VSG. Documentation. Report on the work package 7. Preliminary safety analysis Gorleben (VSG); FEP-Katalog fuer die VSG. Dokumentation. Bericht zum Arbeitspaket 7. Vorlaeufige Sicherheitsanalyse fuer den Standort Gorleben

    Energy Technology Data Exchange (ETDEWEB)

    Wolf, Jens [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH (GRS), Koeln (Germany); Behlau, Joachim [Bundesanstalt fuer Geowissenschaften und Rohstoffe, Hannover (Germany); Beuth, Thomas [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH (GRS), Koeln (Germany)] [and others

    2012-06-15

    The report is a compendium of the FEP (features, events, processes) data base that was developed in the frame of the preliminary safety analysis Gorleben (VSG). For each FEP issue the information includes the following subchapters: definition, general information and examples, status at the site, site-specific impacts, temporal restriction, conditional incidence rate, effects on subsidiary systems, adverse effects on the function of the initial barriers, justification, direct dependencies, open questions, references.

  10. Silent ischaemia and hypertension

    NARCIS (Netherlands)

    Boon, D.; Piek, J. J.; van Montfrans, G. A.

    2000-01-01

    For many years now, silent ischaemia has been recognized as a distinct clinical entity, and its relevance in different patient groups has been established. However, a number of basic questions have not been answered. In explaining the pathophysiology of silent ischaemia, factors affecting both the

  11. The threat of silent earthquakes

    Science.gov (United States)

    Cervelli, Peter

    2004-01-01

    Not all earthquakes shake the ground. The so-called silent types are forcing scientists to rethink their understanding of the way quake-prone faults behave. In rare instances, silent earthquakes that occur along the flakes of seaside volcanoes may cascade into monstrous landslides that crash into the sea and trigger towering tsunamis. Silent earthquakes that take place within fault zones created by one tectonic plate diving under another may increase the chance of ground-shaking shocks. In other locations, however, silent slip may decrease the likelihood of destructive quakes, because they release stress along faults that might otherwise seem ready to snap.

  12. Technical and clinical outcome of transjugular intrahepatic portosystemic stent shunt: Bare metal stents (BMS) versus viatorr stent-grafts (VSG)

    Energy Technology Data Exchange (ETDEWEB)

    Sommer, Christof M., E-mail: cmsommer@gmx.com [Department of Diagnostic and Interventional Radiology, University Hospital Heidelberg, INF 110, 69120 Heidelberg (Germany); Gockner, Theresa L.; Stampfl, Ulrike; Bellemann, Nadine [Department of Diagnostic and Interventional Radiology, University Hospital Heidelberg, INF 110, 69120 Heidelberg (Germany); Sauer, Peter; Ganten, Tom [Department of Gastroenterology, University Hospital Heidelberg, Heidelberg (Germany); Weitz, Juergen [Department of General, Abdominal and Transplantation Surgery, University Hospital Heidelberg, Heidelberg (Germany); Kauczor, Hans U.; Radeleff, Boris A. [Department of Diagnostic and Interventional Radiology, University Hospital Heidelberg, INF 110, 69120 Heidelberg (Germany)

    2012-09-15

    Highlights: ► Twelve month mean number of TIPS revisions per patient was significantly lower in VSG. ► First TIPS revision was performed significantly later in the VSG. ► There was no significant difference of hepatic encephalopathy in both study groups. -- Abstract: Purpose: To compare retrospectively angiographical and clinical results in patients undergoing transjugular intrahepatic portosystemic stent-shunt (TIPS) using BMS or VSG. Materials and methods: From February 2001 to January 2010, 245 patients underwent TIPS. From those, 174 patients matched the inclusion criteria with elective procedures and institutional follow-up. Group (I) consisted of 116 patients (mean age, 57.0 ± 11.1 years) with BMS. Group (II) consisted of 58 patients with VSG (mean age, 53.5 ± 16.1 years). Angiographic and clinical controls were scheduled at 3, 6 and 12 months, followed by clinical controls every 6 months. Primary study goals included hemodynamic success, shunt patency as well as time to and number of revisions. Secondary study goals included clinical success. Results: Hemodynamic success was 92.2% in I and 91.4% in II (n.s.). Primary patency was significantly higher in II compared to I (53.8% after 440.4 ± 474.5 days versus 45.8% after 340.1 ± 413.8 days; p < 0.05). The first TIPS revision was performed significantly later in II compared to I (288.3 ± 334.7 days versus 180.1 ± 307.0 days; p < 0.05). In the first angiographic control, a portosystemic pressure gradient ≥15 mmHg was present in 73.9% in I and in 39.4% in II (p < 0.05). Clinical success was 73.7–86.2% after 466.3 ± 670.1 days in I and 85.7–90.5% after 617.5 ± 642.7 days in II (n.s.). Hepatic encephalopathy was 37.5% in I and 36.5% in II (n.s.). Conclusion: VSG increased primary shunt patency as well as decreased time to and number of TIPS revisions. There was a trend of higher clinical success in VSG without increased hepatic encephalopathy.

  13. Technical and clinical outcome of transjugular intrahepatic portosystemic stent shunt: Bare metal stents (BMS) versus viatorr stent-grafts (VSG)

    International Nuclear Information System (INIS)

    Sommer, Christof M.; Gockner, Theresa L.; Stampfl, Ulrike; Bellemann, Nadine; Sauer, Peter; Ganten, Tom; Weitz, Juergen; Kauczor, Hans U.; Radeleff, Boris A.

    2012-01-01

    Highlights: ► Twelve month mean number of TIPS revisions per patient was significantly lower in VSG. ► First TIPS revision was performed significantly later in the VSG. ► There was no significant difference of hepatic encephalopathy in both study groups. -- Abstract: Purpose: To compare retrospectively angiographical and clinical results in patients undergoing transjugular intrahepatic portosystemic stent-shunt (TIPS) using BMS or VSG. Materials and methods: From February 2001 to January 2010, 245 patients underwent TIPS. From those, 174 patients matched the inclusion criteria with elective procedures and institutional follow-up. Group (I) consisted of 116 patients (mean age, 57.0 ± 11.1 years) with BMS. Group (II) consisted of 58 patients with VSG (mean age, 53.5 ± 16.1 years). Angiographic and clinical controls were scheduled at 3, 6 and 12 months, followed by clinical controls every 6 months. Primary study goals included hemodynamic success, shunt patency as well as time to and number of revisions. Secondary study goals included clinical success. Results: Hemodynamic success was 92.2% in I and 91.4% in II (n.s.). Primary patency was significantly higher in II compared to I (53.8% after 440.4 ± 474.5 days versus 45.8% after 340.1 ± 413.8 days; p < 0.05). The first TIPS revision was performed significantly later in II compared to I (288.3 ± 334.7 days versus 180.1 ± 307.0 days; p < 0.05). In the first angiographic control, a portosystemic pressure gradient ≥15 mmHg was present in 73.9% in I and in 39.4% in II (p < 0.05). Clinical success was 73.7–86.2% after 466.3 ± 670.1 days in I and 85.7–90.5% after 617.5 ± 642.7 days in II (n.s.). Hepatic encephalopathy was 37.5% in I and 36.5% in II (n.s.). Conclusion: VSG increased primary shunt patency as well as decreased time to and number of TIPS revisions. There was a trend of higher clinical success in VSG without increased hepatic encephalopathy

  14. Production of bioethanol from fermented sugars of sugarcane bagasse produced by lignocellulolytic enzymes of Exiguobacterium sp. VSG-1.

    Science.gov (United States)

    Vijayalaxmi, S; Anu Appaiah, K A; Jayalakshmi, S K; Mulimani, V H; Sreeramulu, K

    2013-09-01

    Exiguobacterium sp. VSG-1 was isolated from the soil sample and characterized for the production of lignocellulolytic enzymes. Production of these enzymes by the strain VSG-1 was carried out using steam-exploded sugarcane bagasse (SCB) and found to secrete cellulase, pectinase, mannanase, xylanase, and tannase. The growth and enzyme production were found to be optimum at pH 9.0 and 37 °C. Upon steam explosion of SCB, the cellulose increased by 42 %, whereas hemicelluloses and lignin decreased by 40 and 62 %, respectively. Enzymatic hydrolysis of steam-exploded SCB yielded 640 g/l of total sugars. Fermentation of sugars produced from pretreated SCB was carried out by using Saccharomyces cerevisiae at pH 5.0 and 30 °C. The alcohol produced was calculated and found to be 62.24 g/l corresponding to 78 % of the theoretical yield of ethanol. Hence, the strain VSG-1 has an industrial importance for the production of fermentable sugars for biofuels.

  15. Permafrost investigations at the Lake Hövsgöl, northern Mongolia, using DC resistivity tomography and DEM-analyses

    Science.gov (United States)

    Etzelmuller, B.; Heggem, E. S. F.; Frauenfelder, R.; Romanovsky, V.; Sharkhuu, N.; Jambaljav, Y.; Tumensetseg, S.; Kääb, A.; Goulden, C.

    2003-04-01

    The region of Lake Hövsgöl, northern Mongolia, lies at the southern edge of Siberia and forms the southern-most fringe of the Siberian continuous permafrost zone. Analysis of long-term temperature data from the area indicates that annual temperatures have warmed by about 1.5^oC over the last 40 years. Being at the southern fringe of permafrost existence, temperature changes are supposed to have a major impact on permafrost degradation and thus on the environment, in interaction with human activities like nomadic pasture use. The objective of this study is to define the distribution of permafrost and the depth of the active zones in detail, and to begin a monitoring program of soil and permafrost temperatures in the study area. During these studies (a) field measurements of ground temperature, (b) analyses of geophysical parameters (mainly ground resistivities), and (c) the generation and analyses of digital elevation models and satellite imagery were carried out. The field measurements provided the basis for the later development of statistical/empirical and physical models of the permafrost distribution in the Hövsgöl area. This presentation will focus on the DC-resistivity tomography mapping of permafrost and digital elevation model analyses. The study showed that DC resistivity tomography was useful to distinguish the active layer and permafrost thickness under different types of surface cover. The project is funded by a five-year grant from the Global Environment Facility to the Mongolian Academy of Sciences (MAS), implemented by the World Bank and a foundation of the Mongolian Long Term Ecological Research Program at Lake Hövsgöl.

  16. Silent Warning: Understanding the National Terrorism Advisory System

    Science.gov (United States)

    2014-12-01

    NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS Approved for public release; distribution is unlimited SILENT WARNING...PERFORMING OR GANIZATION NA:i\\ti E (S) AND ADDRESS(ES) Naval Postgraduate School Monterey, CA 93943-5000 9. SP ONSORING /MONIT ORING AGENCY NAME(S) AND...Homeland Sectu’ity Advisory System, Boston Marathon bombing, Christmas Day bomber, tmderwear bomber, hum cane , cotmteiteiTO!’ism, CT AB

  17. Monitoring Progress toward Independent Silent Reading.

    Science.gov (United States)

    Franc, Lillian H.; Hildebrandt, Jeannette

    1984-01-01

    Concludes, among other things, that fluent oral reading is an important step toward reading for meaning and independent silent reading and that silent reading should be encouraged from the beginning of reading instruction. (FL)

  18. Plant Phytomass Changes in a Lar ch Forest of the Lake Hövsgöl Area, Northern Mongolia

    Directory of Open Access Journals (Sweden)

    Jamsran Oyumaa

    2007-12-01

    Full Text Available In the present study we related the decrease of the vegetation productivity in a larch forest with an increase of the air temperature over a 20-year period (1987-2007. During the years of the study the data from nearby weather stations showed warming and drying trends in climatic conditions: a 1.6 0 C increase of mean annual temperature, increase in maximum and minimum temperature extremes, and delay of summer rains. Plant community changes include the shift in species dominance from mesophytes to xerophytes, decrease in vegetation cover and plant height, and transformation of a single July blooming peak to the more diffuse blooming season. We also showed the plant phytomass of the larch forest of the Hövsgöl region is decreasing in response to the climate changes.

  19. Unusual ocular manifestations of silent sinus syndrome

    OpenAIRE

    Fonseca, Fabricio Lopes da; Mazoti, Luciana; Polati, Mariza

    2014-01-01

    Silent sinus syndrome is an acquired condition in which there is a gradual collapse of the orbital floor and inward retraction of the maxillary sinus (atelectasis of the maxillary sinus). This in turn may cause associated ocular occurrences of enophthalmos and hypotropia. This is a report of an 8 year-old boy with silent sinus syndrome and associated ocular motility disorders. The association between silent sinus syndrome and ocular motility disturbance has been recently described in the lite...

  20. Underlying skills of oral and silent reading

    NARCIS (Netherlands)

    Van Den Boer, Madelon; van Bergen, Elsje; de Jong, Peter F.

    2014-01-01

    Many studies have examined reading and reading development. The majority of these studies, however, focused on oral reading rather than on the more dominant silent reading mode. Similarly, it is common practice to assess oral reading abilities rather than silent reading abilities in schools and in

  1. The prevalence and quality of silent, socially silent, and disclosed autobiographical memories across adulthood.

    Science.gov (United States)

    Alea, Nicole

    2010-02-01

    Two separate studies examined the prevalence and quality of silent (infrequently recalled), socially silent (i.e., recalled but not shared), and disclosed autobiographical memories. In Study 1 young and older men and women remembered positive events. Positive memories were more likely to be disclosed than to be kept socially silent or completely silent. However, socially silent and disclosed memories did not differ in memory quality: the memories were equally vivid, significant, and emotional. Silent memories were less qualitatively rich. This pattern of results was generally replicated in Study 2 with a lifespan sample for both positive and negative memories, and with additional qualitative variables. The exception was that negative memories were kept silent more often. Age differences were minimal. Women disclosed their autobiographical memories more, but men told a greater variety of people. Results are discussed in terms of the functions that memory telling and silences might serve for individuals.

  2. Silent Patent Ductus Arteriosus Aneurysm

    Directory of Open Access Journals (Sweden)

    Aline Medeiros Botta

    2002-09-01

    Full Text Available Ductus arteriosus aneurysm, a rare and potentially fatal condition, has been reported as a complication after surgical ductus arteriosus closure. Its spontaneous appearance as a septic complication, which was common in the presurgical and preantibiotic era, has been rarely reported in the contemporary literature. Persistence of silent ductus arteriosus in healthy children and adults is a frequent condition that currently has an increasing diagnostic possibility due to the availability of more accurate investigative methods, especially echocardiography. We report the case of a 1-year-old child, in whom no previous heart disease was known, who developed a giant aneurysm of the ductus arteriosus during a staphylococcal infection. This complication appeared after craniotomy for emptying an accidental subdural hematoma. This report associates the persistence of ductus arteriosus with a complication considered rare, which has a rapidly fatal evolution.

  3. Characteristics of silent countingin synchronized swimmers

    Directory of Open Access Journals (Sweden)

    Sergey V. Leonov

    2012-01-01

    Full Text Available This article describes the temporal characteristics of silent counting as used duringa competition by the Russian youth team of synchronized swimmers. Theathletes listened to the music that accompanied their performance at the competition.Diff erent indices of silent counting were defi ned, such as the beginningand cessation of diff erent periods of counting, counting frequency, the stabilityof the temporal structure of silent counting, the degree of synchronization of silentcounting at diff erent moments during the sports program. We studied therelationship of these characteristics of counting with expert estimates of the athletes’sense of tempo, coordination of movements, and choreographic abilities.

  4. Unusual ocular manifestations of silent sinus syndrome

    Directory of Open Access Journals (Sweden)

    Fabricio Lopes da Fonseca

    2014-01-01

    Full Text Available Silent sinus syndrome is an acquired condition in which there is a gradual collapse of the orbital floor and inward retraction of the maxillary sinus (atelectasis of the maxillary sinus. This in turn may cause associated ocular occurrences of enophthalmos and hypotropia. This is a report of an 8 year-old boy with silent sinus syndrome and associated ocular motility disorders. The association between silent sinus syndrome and ocular motility disturbance has been recently described in the literature. However, this is an infrequent association, mainly in childhood.

  5. Myocardial perfusion in silent myocardial ischemia

    International Nuclear Information System (INIS)

    Narita, Michihiro; Kurihara, Tadashi; Murano, Kenichi; Usami, Masahisa

    1989-01-01

    To investigate myocardial perfusion in silent myocardial ischemia, we performed exercise stress myocardial tomography with thallium-201 (Tl) in 85 patients with coronary artery disease (CAD). Exercise stress myocardial tomography was obtained both immediately after exercise and three hours later. Patients were classified into two groups according to the presence (Symptomatic Group, n=36) or absence (Silent Group, n=49) of chest pain during exercise stress. Clinical features (age, gender and history of myocardial infarction) and arteriographically determined severity of CAD were the same in both groups. The extent of myocardial ischemia (% Ischemia) estimated by exercise stress myocardial tomography was the same in each group (30±10 % in Silent Group, 28±12 % in Symptomatic Group, NS). The severity of exercise-induced myocardial ischemia was expressed as a minimal value of myocardial Tl washout rate (minimal WOR) of each patient. Although exercise heart rate was identical in both groups, minimal WOR in Silent Group was significantly higher than that of Symptomatic Group (4±10% vs -16±14%, p<0.001). The study in patients who exhibited both silent and symptomatic ischemia showed the same results. These findings suggest that the severity of ischemia is a fundamental factor in determining the presence or absence of pain during exercise induced ischemia. (author)

  6. Purely Magnetic Silent Universes do not Exist

    Science.gov (United States)

    Vu, K. T.; Carminati, J.

    2008-09-01

    We present a new Maple package called STeM (Symbolic Tetrad Manipulation). Using STeM, we outline, using a formalism which is a hybrid of the NP and Orthonormal ones, the proof of the nonexistence of purely magnetic silent universes.

  7. Relativistic numerical cosmology with silent universes

    Science.gov (United States)

    Bolejko, Krzysztof

    2018-01-01

    Relativistic numerical cosmology is most often based either on the exact solutions of the Einstein equations, or perturbation theory, or weak-field limit, or the BSSN formalism. The silent universe provides an alternative approach to investigate relativistic evolution of cosmological systems. The silent universe is based on the solution of the Einstein equations in 1  +  3 comoving coordinates with additional constraints imposed. These constraints include: the gravitational field is sourced by dust and cosmological constant only, both rotation and magnetic part of the Weyl tensor vanish, and the shear is diagnosable. This paper describes the code simsilun (free software distributed under the terms of the reposi General Public License), which implements the equations of the silent universe. The paper also discusses applications of the silent universe and it uses the Millennium simulation to set up the initial conditions for the code simsilun. The simulation obtained this way consists of 16 777 216 worldlines, which are evolved from z  =  80 to z  =  0. Initially, the mean evolution (averaged over the whole domain) follows the evolution of the background ΛCDM model. However, once the evolution of cosmic structures becomes nonlinear, the spatial curvature evolves from ΩK =0 to ΩK ≈ 0.1 at the present day. The emergence of the spatial curvature is associated with ΩM and Ω_Λ being smaller by approximately 0.05 compared to the ΛCDM.

  8. The Silent Spring of Rachel Carson.

    Science.gov (United States)

    Kerstetter, Ned

    1996-01-01

    Presents a lesson plan examining Rachel Carson's call to arms concerning the harmful consequences of pesticides. Students view a video documentary on Carson's work and read a synopsis of her book, "Silent Spring." Assessment is provided by various activities including writing assignments, creating posters, and editorial cartoons. (MJP)

  9. Malaria - Africa's silent tsunami | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-01-12

    Jan 12, 2011 ... Less well known is the continuous “silent tsunami” of malaria in Africa ... This means almost 3 lives per minute lost from an easily preventable and treatable disease. It was gratifying to see the beginnings of similar passion to deal with ... often in shapes, sizes, and colours unpopular in African households.

  10. Silent Film in the German Classroom.

    Science.gov (United States)

    Caldwell, David

    In addition to using films in the German classroom to introduce students to German culture and history, it is important to show and study the film as film. This procedure emphasizes the importance of the film as a part of creative arts in Germany and demands student participation in observation and discussion. Many German silent films are…

  11. Geochemical analysis of the sealing system. Technical Report to work package 9.1.2. Preliminary safety case of the Gorleben site (VSG)

    Energy Technology Data Exchange (ETDEWEB)

    Xie, Mingliang; Herbert, Horst-Juergen

    2012-02-15

    The geochemical reaction simulation of ground water and brines with sealing materials for a proposed repository at the Gorleben site is a task under the framework of the VSG project. The calculations presented in this report are aimed to provide a preliminary evaluation of the geochemical stability of three potential engineering barrier materials foreseen in the shaft sealing system in case of groundwater and brine intrusion. The long-term stability of these materials is a key issue for the sealing function of the shaft seals. This is governed by many factors such as geotechnical, hydraulic and geochemical processes. In order to better understand the potential effect of geochemical processes on the long-term properties of these sealing materials, geochemical simulations of the potential interactions between groundwater and brine and shaft sealing materials were performed.

  12. Soundless Speech/ Wordless Writing: Language and German Silent Cinema

    Directory of Open Access Journals (Sweden)

    Marc Silberman

    2010-12-01

    Full Text Available Speech / Wordless Writing: Language and German Silent Cinema Marc Silberman If language loses its communicative and interpretative functions in direct proportion to the loss of its referential grounding, then the modernist crisis is simultaneously a crisis of its signifying practices. This means that the evolution of the silent cinema is a particularly rich site to examine the problematic relationship of language and image. This essay presents several expressionist films as a specific response to this crisis in order to describe the diverse cinematic forms of resistance to the word, to articulated speech. While some film makers developed the silence of the silent film into a “gestural language” that dramatized light and movement, others reproduced the film figures’ silent speech by means of graphically stylized intertitles. My thesis is that the expressionist cinema maintained an idealistic notion of the film as a pure work of art that aimed at a unified composition of all elements and missed the opportunity to explore the rich semiotic possibilities of the new technological medium with its hybrid, synergetic forms and provocative force. Hence, the expressionist cinema marks a transition or even the endpoint of a long process of reflection about the communicative possibilities of language that shifted to a fundamentally new level with the invention of sound cinema at the end of the 1920s. Parole muette / écriture sans mot: Le langage et le cinéma allemand muet Marc Silberman Le langage, dit-on, perd de ses functions communicatrices et interpretatives en proportion directe à la perte de sa force référentielle. On dira que la crise moderniste est également une crise des pratiques signifiantes. Ce qui revient à dire aussi que l’évolution du cinéma muet serait une site particulièrement riche pour examiner les problématiques du langage vs. l’image. Cet essai présente quelques films expressionnistes comme réactions à la crise

  13. Silent stroke and advance in neuroimaging

    Energy Technology Data Exchange (ETDEWEB)

    Okada, Yasushi; Sadoshima, Seizo; Hasuo, Kanehiro; Saku, Yoshisuke; Fujishima, Masatoshi (Kyushu Univ., Fukuoka (Japan). Faculty of Medicine)

    1990-10-01

    Recently, silent strokes are more frequently demonstrated by CT and MRI with the advance of neuroimaging. The infarcted lesions unrelated to the neurological symptoms were detected in 8, 30, 28, 34, 60, 63% of the patients with cerebral infarction in 1977-78, 1982, 1985, 1986, 1987, 1988, respectively, by CT and/or MRI, and the asymptomatic patients with incidentally diagnosed cerebral infarction were amounted to 16% (8 of 51 cases) in 1988. Of the recent 50 patients with cerebral infarction examined by CT and MRI, asymptomatic cerebrovascular lesions were detected in 25 (50%) by CT and in 35 (70%) by MRI. MRI also revealed asymptomatic old hemorrhage in 7 (14%). The clinical significance of silent stroke was discussed. (author).

  14. Scoring an Abstract Contemporary Silent Film

    OpenAIRE

    Frost, Crystal

    2014-01-01

    I composed an original digital audio film score with full sound design for a contemporary silent film called Apple Tree. The film is highly conceptual and interpretive and required a very involved, intricate score to successfully tell the story. In the process of scoring this film, I learned new ways to convey an array of contrasting emotions through music and sound. After analyzing the film's emotional journey, I determined that six defining emotions were the foundation on which to build an ...

  15. Teen Depression and Suicide, A SILENT CRISIS.

    Science.gov (United States)

    Kroning, Maureen; Kroning, Kayla

    2016-01-01

    Adolescent depression is a serious problem affecting 10.7% of all teens and 29.9% of high school students; 17% of high school students have contemplated suicide. Yet, depression in teens is often unrecognized. This article relays the tragic death of a 17-year-old, along with symptoms of depression and suicide in adolescents; DSM-5 criteria for depression; treatments including protective factors, psychotherapy, and medications; and imparts interventions for addressing this huge but silent crisis.

  16. Recurrent Silent Thyroiditis as a Sequela of Postpartum Thyroiditis

    Science.gov (United States)

    Kim, Paul

    2014-01-01

    Thyroiditis encompasses a group of disorders characterized by thyroid inflammation. Though clinically indistinguishable from silent thyroiditis, postpartum thyroiditis occurs in women within 12 months after delivery. Recurrent postpartum thyroiditis in subsequent pregnancies is common, but recurrent silent thyroiditis is rare. We reported a case of patient with recurrent episodes of thyroiditis, unrelated to pregnancy, after an episode of postpartum thyroiditis. It is of interest that postpartum thyroiditis and silent thyroiditis could occur closely to each other; however, the link between these disorders is not well established. This report is to remind physicians of the possibility of recurrent silent thyroiditis in women with a history of postpartum thyroiditis. PMID:24987536

  17. Silent ischemia and beta-blockade

    DEFF Research Database (Denmark)

    Egstrup, K

    1991-01-01

    and should also be directed at the other coronary artery risk factors of the patients. The effects of beta-blockers, which reduce the duration and frequency of silent ischemic episodes, is well described. The effect is most pronounced in the morning, when the frequency of ischemia is highest......, and the mechanism of action seems mainly mediated through a reduction in myocardial oxygen demand. beta-Blockers have shown effectiveness in both effort-induced angina and mixed angina, and increased anti-ischemic potency may be achieved by combination therapy with a calcium antagonist. Abrupt withdrawal of beta-blockers...

  18. An introduction to silent speech interfaces

    CERN Document Server

    Freitas, João; Dias, Miguel Sales; Silva, Samuel

    2017-01-01

    This book provides a broad and comprehensive overview of the existing technical approaches in the area of silent speech interfaces (SSI), both in theory and in application. Each technique is described in the context of the human speech production process, allowing the reader to clearly understand the principles behind SSI in general and across different methods. Additionally, the book explores the combined use of different data sources, collected from various sensors, in order to tackle the limitations of simpler SSI approaches, addressing current challenges of this field. The book also provides information about existing SSI applications, resources and a simple tutorial on how to build an SSI.

  19. Eye Movement during Silent and Oral Reading: How Can we Compensate the Loss of Multisensory Process during Silent Reading?

    Directory of Open Access Journals (Sweden)

    Maiko Takahashi

    2011-10-01

    Full Text Available While reading texts orally, we process the multisensory language information. Accordingly, in the context of reading aloud, we process the visually presented text and produce the auditory information of the text through articulatory movement. These multisensory processing activities are assumed to facilitate the memory and comprehension of textual information. Conversely, while reading silently, we process only the visual information of the text. Although we cannot use the multisensory language information while reading silently, several researchers have found that there is little difference between the degree of comprehension based on silent and oral reading for adult readers. The purpose of this study is to explain how we compensate the loss of multisensory process during silent reading by comparing the visual processing process during silent and oral reading. By conducting two experiments, we measured and compared the eye movement during silent and oral reading. The results showed that silent reading took shorter time for comprehension than oral reading, and readers had more visual fixation points and read back frequently during reading silently than orally. These reading strategies during silent reading seemed to compensate the loss of multisensory process and support the text comprehension.

  20. Silent Bodies: Japanese taciturnity and image thinking

    Directory of Open Access Journals (Sweden)

    Ana Došen

    2017-03-01

    Full Text Available A nonverbal transmission and an implicit way of communication are highly encouraged in Japanese society. The reason for this “silence prerogative” is often found in historical facts of lengthy feudal era or in ancient philosophies and religions such as Buddhism and Confucianism and their various concepts which privilege taciturn way of communication. Moreover, the unspoken comprehension is often complemented by the attitude which equates truthfulness with silence. This paper explores the silence as a communicative act in the domain of Japanese art, where the body takes over the place of the language. In traditional Japanese theatrical performance, such as noh, words are often inadequate to convey emotion and therefore the aesthetics of emptiness, understatement and abstraction is transcended by the masks with "nonmoving lips". Drawing on theoretical perspectives from both East and West, I argue that the silent bodies operate as deliberate and integral determinants of Japanese non-silent art forms – especially in cinema and theatre. In the Eastern thought, visual perception is fundamental in cognition of the world, whereas auditory discernment is secondary to "image-thinking" (Yuasa. Accustomed to taciturnity, Japanese audience effectively corresponds to the performance and "completes" it in silence.

  1. Silent Conversations in the Labyrinth of Artistic Research and Practice

    Science.gov (United States)

    Eis, Andrea

    2013-01-01

    This essay explores silent conversations with the past, but also navigates through the labyrinth of artistic process, with its manifold passages of research, chance occurrence and aesthetic experimentation. The double metaphors of silent conversations and labyrinths apply to the essay and the artwork within it, to the research and to the practice.…

  2. Silent Localization of Underwater Sensors Using Magnetometers

    Directory of Open Access Journals (Sweden)

    Jonas Callmer

    2010-01-01

    Full Text Available Sensor localization is a central problem for sensor networks. If the sensor positions are uncertain, the target tracking ability of the sensor network is reduced. Sensor localization in underwater environments is traditionally addressed using acoustic range measurements involving known anchor or surface nodes. We explore the usage of triaxial magnetometers and a friendly vessel with known magnetic dipole to silently localize the sensors. The ferromagnetic field created by the dipole is measured by the magnetometers and is used to localize the sensors. The trajectory of the vessel and the sensor positions are estimated simultaneously using an Extended Kalman Filter (EKF. Simulations show that the sensors can be accurately positioned using magnetometers.

  3. Modification of hormonal secretion in clinically silent pituitary adenomas.

    Science.gov (United States)

    Daems, Tania; Verhelst, Johan; Michotte, Alex; Abrams, Pascale; De Ridder, Dirk; Abs, Roger

    2009-01-01

    Silent pituitary adenomas are a subtype of adenomas characterized by positive immunoreactivity for one or more hormones classically secreted by normal pituitary cells but without clinical expression, although in some occasions enhanced or changed secretory activity can develop over time. Silent corticotroph adenomas are the classical example of this phenomenon. A series of about 500 pituitary adenomas seen over a period of 20 years were screened for modification in hormonal secretion. Biochemical and immunohistochemical data were reviewed. Two cases were retrieved, one silent somatotroph adenoma and one thyrotroph adenoma, both without specific clinical features or biochemical abnormalities, which presented 20 years after initial surgery with evidence of acromegaly and hyperthyroidism, respectively. While the acromegaly was controlled by a combination of somatostatin analogs and growth hormone (GH) receptor antagonist therapy, neurosurgery was necessary to manage the thyrotroph adenoma. Immunohistochemical examination demonstrated an increase in the number of thyroid stimulating hormone (TSH)-immunoreactive cells compared to the first tissue. Apparently, the mechanisms responsible for the secretory modifications are different, being a change in secretory capacity in the silent somatotroph adenoma and a quantitative change in the silent thyrotroph adenoma. These two cases, one somatotroph and one thyrotroph adenoma, are an illustration that clinically silent pituitary adenomas may in rare circumstances evolve over time and become active, as previously demonstrated in silent corticotroph adenomas.

  4. Using Vocal and Silent Reading Approaches for the Enhancement ...

    African Journals Online (AJOL)

    Nekky Umera

    An International Multi-Disciplinary Journal. Vol. 3 (1) ... expresses his thoughts and feelings in such a way that the person can be ... creative, critical and evaluative. .... In the first week, the research assistants taught the oral and silent reading.

  5. Silent store detection and recording in memory storage

    Energy Technology Data Exchange (ETDEWEB)

    Bose, Pradip; Cher, Chen-Yong; Nair, Ravi

    2017-03-14

    An aspect includes receiving a write request that includes a memory address and write data. Stored data is read from a memory location at the memory address. Based on determining that the memory location was not previously modified, the stored data is compared to the write data. Based on the stored data matching the write data, the write request is completed without writing the write data to the memory and a corresponding silent store bit, in a silent store bitmap is set. Based on the stored data not matching the write data, the write data is written to the memory location, the silent store bit is reset and a corresponding modified bit is set. At least one of an application and an operating system is provided access to the silent store bitmap.

  6. Silent store detection and recording in memory storage

    Energy Technology Data Exchange (ETDEWEB)

    Bose, Pradip; Cher, Chen-Yong; Nair, Ravi

    2017-03-07

    An aspect includes receiving a write request that includes a memory address and write data. Stored data is read from a memory location at the memory address. Based on determining that the memory location was not previously modified, the stored data is compared to the write data. Based on the stored data matching the write data, the write request is completed without writing the write data to the memory and a corresponding silent store bit, in a silent store bitmap is set. Based on the stored data not matching the write data, the write data is written to the memory location, the silent store bit is reset and a corresponding modified bit is set. At least one of an application and an operating system is provided access to the silent store bitmap.

  7. Silent Circulation of Ross River Virus in French Polynesia

    Directory of Open Access Journals (Sweden)

    Maite Aubry

    2015-08-01

    Discussion: Our results support the existence of autochthonous RRV transmission and suggest that this pathogen has silently circulated in French Polynesia. These findings raise the question of possible undetected circulation of RRV in other Pacific Island Countries and Territories.

  8. Current practice for diagnosis and management of silent atrial fibrillation

    DEFF Research Database (Denmark)

    Dobreanu, Dan; Svendsen, Jesper Hastrup; Lewalter, Thorsten

    2013-01-01

    for the diagnosis and management of silent AF. This survey is based on an electronic questionnaire sent to the European Heart Rhythm Association Research Network partners. Responses were received from 33 centres in 16 countries. The preferred screening methods for silent AF in patients with rhythm control...... for such patients. Most responders preferred rate control over rhythm control in patients with silent AF, although some favoured pulmonary vein isolation in young patients. However, oral anticoagulant therapy in patients at high thromboembolic risk was considered mandatory by most, provided that at least one......Although it is well known that silent atrial fibrillation (AF) is associated with morbidity and mortality rates similar to those of symptomatic AF, no specific strategy for screening and management of this form of AF has been advocated. The purpose of this survey was to identify current practices...

  9. Multiple Silent Lacunes Are Associated with Recurrent Ischemic Stroke

    DEFF Research Database (Denmark)

    Andersen, Søren Due; Skjøth, Flemming; Yavarian, Yousef

    2016-01-01

    ackground: Silent lacunes are a common finding on brain imaging in ischemic stroke patients, but the prognostic significance of these lesions is uncertain. We aimed at investigating the association of silent lacunes and the risk of ischemic stroke recurrence, death, and cardiovascular events...... in a cohort of patients with incident ischemic stroke and no atrial fibrillation (AF). Methods: We included 786 patients (mean age 59.5 (SD 14.0); 42.9% females) in a registry-based, observational cohort study on patients with first-ever ischemic stroke. On brain MRI we assessed the number of silent lacunes...... as none, single, or multiple and we calculated stratified incidence rates of the outcomes. Cox proportional hazard ratios (HRs) adjusted for age, gender, congestive heart failure, hypertension, diabetes, and vascular disease were calculated with no silent lacunes as reference. In additional analyses, we...

  10. Silent Synapse-Based Circuitry Remodeling in Drug Addiction.

    Science.gov (United States)

    Dong, Yan

    2016-05-01

    Exposure to cocaine, and likely other drugs of abuse, generates α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor-silent glutamatergic synapses in the nucleus accumbens. These immature synaptic contacts evolve after drug withdrawal to redefine the neurocircuital properties. These results raise at least three critical questions: (1) what are the molecular and cellular mechanisms that mediate drug-induced generation of silent synapses; (2) how are neurocircuits remodeled upon generation and evolution of drug-generated silent synapses; and (3) what behavioral consequences are produced by silent synapse-based circuitry remodeling? This short review analyzes related experimental results, and extends them to some speculations. © The Author 2015. Published by Oxford University Press on behalf of CINP.

  11. How Silent is the Right to Silence?

    Directory of Open Access Journals (Sweden)

    Katherine Biber

    2012-11-01

    Full Text Available A long-held and fundamental principle of our criminal justice system is that people accused of crimes have a right to silence, arising from the presumption of innocence. Rules of evidence try to protect this ‘right’ during trial, by ensuring that juries understand that adverse inferences cannot be drawn from the silence of the accused. Silence, in court, can mean nothing, and we are not to speculate about what might motivate an accused person to remain silent, or what they might have said had they spoken. However, an examination of the jurisprudence in this area shows that the law is often not dealing with actual silence; sometimes when the law refers to the ‘right to silence’, it seems to mean a ‘refusal to hear’. In other instances, there is actual silence, and yet the law refuses to subject that silence to any critical interpretation, insisting that we cannot infer anything from it. While we have learned, from theatre, music, linguistics, religion and psychology, to develop sophisticated means for interpreting silence, the law demands that we set aside these interpretive tools, hearing silence that isn’t there, and inferring nothing about something.

  12. Silent communication: toward using brain signals.

    Science.gov (United States)

    Pei, Xiaomei; Hill, Jeremy; Schalk, Gerwin

    2012-01-01

    From the 1980s movie Firefox to the more recent Avatar, popular science fiction has speculated about the possibility of a persons thoughts being read directly from his or her brain. Such braincomputer interfaces (BCIs) might allow people who are paralyzed to communicate with and control their environment, and there might also be applications in military situations wherever silent user-to-user communication is desirable. Previous studies have shown that BCI systems can use brain signals related to movements and movement imagery or attention-based character selection. Although these systems have successfully demonstrated the possibility to control devices using brain function, directly inferring which word a person intends to communicate has been elusive. A BCI using imagined speech might provide such a practical, intuitive device. Toward this goal, our studies to date addressed two scientific questions: (1) Can brain signals accurately characterize different aspects of speech? (2) Is it possible to predict spoken or imagined words or their components using brain signals?

  13. Silent synapses in neuromuscular junction development.

    Science.gov (United States)

    Tomàs, Josep; Santafé, Manel M; Lanuza, Maria A; García, Neus; Besalduch, Nuria; Tomàs, Marta

    2011-01-01

    In the last few years, evidence has been found to suggest that some synaptic contacts become silent but can be functionally recruited before they completely retract during postnatal synapse elimination in muscle. The physiological mechanism of developmental synapse elimination may be better understood by studying this synapse recruitment. This Mini-Review collects previously published data and new results to propose a molecular mechanism for axonal disconnection. The mechanism is based on protein kinase C (PKC)-dependent inhibition of acetylcholine (ACh) release. PKC activity may be stimulated by a methoctramine-sensitive M2-type muscarinic receptor and by calcium inflow though P/Q- and L-type voltage-dependent calcium channels. In addition, tropomyosin-related tyrosine kinase B (trkB) receptor-mediated brain-derived neurotrophic factor (BDNF) activity may oppose the PKC-mediated ACh release depression. Thus, a balance between trkB and muscarinic pathways may contribute to the final functional suppression of some neuromuscular synapses during development. © 2010 Wiley-Liss, Inc.

  14. Usefulness of percutaneous transluminal coronary angioplasty in silent myocardial ischemia

    International Nuclear Information System (INIS)

    Hou, Mami

    1996-01-01

    The usefulness of percutaneous transluminal coronary angioplasty (PTCA) was assessed in patients with exercise-induced asymptomatic myocardial ischemia (silent ischemia) and compared with exercise-induced symptomatic myocardial ischemia (symptomatic ischemia). Patients with single vessel coronary artery disease (51 with angina pectoris, 40 with old myocardial infarction) and evidence of stress-induced ischemia on thallium-201 single photon emission computed tomography (SPECT) underwent successful PTCA. Thirty-seven percent of angina patients and 60% of infarction patients showed asymptomatic exercise-induced ischemia. There was no significant difference in population characteristics between silent and symptomatic patients. Patients with silent angina had significantly higher percentage thallium uptake and washout rate than symptomatic patients. After PTCA, both percentage diameter stenosis and percentage thallium uptake were improved in all patients with angina irrespective of the presence or absence of symptoms. There were no significant differences in percentage thallium uptake and washout rate between patients with silent and symptomatic infarction. After PTCA, percentage diameter stenosis, percentage thallium uptake, and washout rate improved in all infarction patients irrespective of the symptoms. Zero percent of silent angina patients, 12% of symptomatic angina patients, 12% of silent infarction patients, 19% of symptomatic infarction patients had cardiac events during about 4.5 years after PTCA. The incidence of cardiac events did not significantly differ in any patient group. PTCA improved myocardial perfusion in all patients, and the incidence of cardiac events did not differ between the silent and symptomatic groups. Revascularization with PTCA is suitable for patients with silent as well as symptomatic ischemia. (author)

  15. Recurrent Silent Thyroiditis as a Sequela of Postpartum Thyroiditis

    OpenAIRE

    Hanseree, Preaw; Salvador, Vincent Bryan; Sachmechi, Issac; Kim, Paul

    2014-01-01

    Thyroiditis encompasses a group of disorders characterized by thyroid inflammation. Though clinically indistinguishable from silent thyroiditis, postpartum thyroiditis occurs in women within 12 months after delivery. Recurrent postpartum thyroiditis in subsequent pregnancies is common, but recurrent silent thyroiditis is rare. We reported a case of patient with recurrent episodes of thyroiditis, unrelated to pregnancy, after an episode of postpartum thyroiditis. It is of interest that postpar...

  16. SAChES: Scalable Adaptive Chain-Ensemble Sampling.

    Energy Technology Data Exchange (ETDEWEB)

    Swiler, Laura Painton [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Ray, Jaideep [Sandia National Lab. (SNL-CA), Livermore, CA (United States); Ebeida, Mohamed Salah [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Huang, Maoyi [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hou, Zhangshuan [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bao, Jie [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Ren, Huiying [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-08-01

    We present the development of a parallel Markov Chain Monte Carlo (MCMC) method called SAChES, Scalable Adaptive Chain-Ensemble Sampling. This capability is targed to Bayesian calibration of com- putationally expensive simulation models. SAChES involves a hybrid of two methods: Differential Evo- lution Monte Carlo followed by Adaptive Metropolis. Both methods involve parallel chains. Differential evolution allows one to explore high-dimensional parameter spaces using loosely coupled (i.e., largely asynchronous) chains. Loose coupling allows the use of large chain ensembles, with far more chains than the number of parameters to explore. This reduces per-chain sampling burden, enables high-dimensional inversions and the use of computationally expensive forward models. The large number of chains can also ameliorate the impact of silent-errors, which may affect only a few chains. The chain ensemble can also be sampled to provide an initial condition when an aberrant chain is re-spawned. Adaptive Metropolis takes the best points from the differential evolution and efficiently hones in on the poste- rior density. The multitude of chains in SAChES is leveraged to (1) enable efficient exploration of the parameter space; and (2) ensure robustness to silent errors which may be unavoidable in extreme-scale computational platforms of the future. This report outlines SAChES, describes four papers that are the result of the project, and discusses some additional results.

  17. Evidence for presynaptically silent synapses in the immature hippocampus

    International Nuclear Information System (INIS)

    Yoon, Jae Young; Choi, Sukwoo

    2017-01-01

    Silent synapses show NMDA receptor (NMDAR)-mediated synaptic responses, but not AMPAR-mediated synaptic responses. A prevailing hypothesis states that silent synapses contain NMDARs, but not AMPARs. However, alternative presynaptic hypotheses, according to which AMPARs are present at silent synapses, have been proposed; silent synapses show slow glutamate release via a fusion pore, and glutamate spillover from the neighboring synaptic terminals. Consistent with these presynaptic hypotheses, the peak glutamate concentrations at silent synapses have been estimated to be ≪170 μM, much lower than those seen at functional synapses. Glutamate transients predicted based on the two presynaptic mechanisms have been shown to activate only high-affinity NMDARs, but not low-affinity AMPARs. Interestingly, a previous study has developed a new approach to distinguish between the two presynaptic mechanisms using dextran, an inert macromolecule that reduces the diffusivity of released glutamate: postsynaptic responses through the fusion pore mechanism, but not through the spillover mechanism, are potentiated by reduced glutamate diffusivity. Therefore, we reasoned that if the fusion pore mechanism underlies silent synapses, dextran application would reveal AMPAR-mediated synaptic responses at silent synapses. In the present study, we recorded AMPAR-mediated synaptic responses at the CA3-CA1 synapses in neonatal rats in the presence of blockers for NMDARs and GABAARs. Bath application of dextran revealed synaptic responses at silent synapses. GYKI53655, a selective AMPAR-antagonist, completely inhibited the unsilenced synaptic responses, indicating that the unsilenced synaptic responses are mediated by AMPARs. The dextran-mediated reduction in glutamate diffusivity would also lead to the activation of metabotropic glutamate receptors (mGluRs), which might induce unsilencing via the activation of unknown intracellular signaling. Hence, we determined whether mGluR-blockers alter

  18. Replacing dark energy by silent virialisation

    Science.gov (United States)

    Roukema, Boudewijn F.

    2018-02-01

    Context. Standard cosmological N-body simulations have background scale factor evolution that is decoupled from non-linear structure formation. Prior to gravitational collapse, kinematical backreaction (𝒬𝒟) justifies this approach in a Newtonian context. Aims: However, the final stages of a gravitational collapse event are sudden; a globally imposed smooth expansion rate forces at least one expanding region to suddenly and instantaneously decelerate in compensation for the virialisation event. This is relativistically unrealistic. A more conservative hypothesis is to allow non-collapsed domains to continue their volume evolution according to the 𝒬𝒟 Zel'dovich approximation (QZA). We aim to study the inferred average expansion under this "silent" virialisation hypothesis. Methods: We set standard (MPGRAFIC) EdS 3-torus (T3) cosmological N-body initial conditions. Using RAMSES, we partitioned the volume into domains and called the DTFE library to estimate the per-domain initial values of the three invariants of the extrinsic curvature tensor that determine the QZA. We integrated the Raychaudhuri equation in each domain using the INHOMOG library, and adopted the stable clustering hypothesis to represent virialisation (VQZA). We spatially averaged to obtain the effective global scale factor. We adopted an early-epoch-normalised EdS reference-model Hubble constant H1EdS = 37.7 km s-1 /Mpc and an effective Hubble constant Heff,0 = 67.7 km s-1 /Mpc. Results: From 2000 simulations at resolution 2563, we find that reaching a unity effective scale factor at 13.8 Gyr (16% above EdS), occurs for an averaging scale of L13.813 = 2.5-0.1+0.1 Mpc/heff. Relativistically interpreted, this corresponds to strong average negative curvature evolution, with the mean (median) curvature functional Ωℛ𝒟 growing from zero to about 1.5-2 by the present. Over 100 realisations, the virialisation fraction and super-EdS expansion correlate strongly at

  19. Silent Revolution in Research for Sustainability

    Directory of Open Access Journals (Sweden)

    Bruce Alder

    2016-06-01

    Full Text Available Is research ‘fit-for-purpose’ for realizing sustainable development? More than two decades after the Brundtland report and UNCED Earth summit, the world has now adopted Sustainable Development Goals(SDGs. Rather than a cause for celebration, this delay should encourage reflection on the role of research in society. Why is it so difficult to realize sustainability in practice? The answer lies in the fact that universities and research centres persist with 19th century methods of data gathering, scholarly analysis, and journal articles. Today’s world needs science in real-time, whether to detect drought, confront Ebola, or assist refugees. Research needs to work faster and embrace 21st century practices including data science, open access, and infographics.A silent revolution is occurring in the ways of organizing and conducting research, enabled by new technology and encouraging work that tackles the key challenges facing society. A variety of new arrangements have come into existence that promote international collaboration, including Horizon 2020 with its emphasis on societal challenges, the Bill & Melinda Gates Foundation which has inspired a family of grand challenges funds on health and development, and the Future Earth joint program of research for global sustainability. These arrangements not only control billions of dollars in research funding, they also influence the strategies of national research councils and international organizations. The result is no less than a transformation in the incentives that reward how researchers invest their time and effort.Why is a revolution needed? Within research, substantial growth in knowledge production coincided with fragmentation among disciplines. One can easily find expertise and publications in soil science or agronomy, yet integrated efforts on food security and climate adaptation remain scarce. Beyond research, society remains largely uninformed, as academics avoid engaging in public

  20. Silent (painless) thyroiditis. Evidence of a geographic variation in frequency

    International Nuclear Information System (INIS)

    Vitug, A.C.; Goldman, J.M.

    1985-01-01

    Recent reports suggest that 14% to 23% of thyrotoxic patients have silent (painless) thyroiditis, a newly described syndrome characterized by transient thyrotoxicosis with a low radioactive iodine uptake. A three-year review at a Brooklyn (NY) hospital showed only one definite and three possible cases of silent thyroiditis among 86 thyrotoxic patients. At most, 4% to 5% of thyrotoxic patients had silent thyroiditis. The authors suggest a geographic variation in this syndrome. Most cases and the largest series are from Japan and the Great Lakes area of North America. The latter may be related to increased iodine intake over many years in a previously endemic area of hypoiodidism and goiter, although other local factors may also be involved

  1. Silent (painless) thyroiditis. Evidence of a geographic variation in frequency

    Energy Technology Data Exchange (ETDEWEB)

    Vitug, A.C.; Goldman, J.M.

    1985-03-01

    Recent reports suggest that 14% to 23% of thyrotoxic patients have silent (painless) thyroiditis, a newly described syndrome characterized by transient thyrotoxicosis with a low radioactive iodine uptake. A three-year review at a Brooklyn (NY) hospital showed only one definite and three possible cases of silent thyroiditis among 86 thyrotoxic patients. At most, 4% to 5% of thyrotoxic patients had silent thyroiditis. The authors suggest a geographic variation in this syndrome. Most cases and the largest series are from Japan and the Great Lakes area of North America. The latter may be related to increased iodine intake over many years in a previously endemic area of hypoiodidism and goiter, although other local factors may also be involved.

  2. Silent method for mathematics instruction: An overview of teaching subsets

    Science.gov (United States)

    Sugiman, Apino, Ezi

    2017-05-01

    Generally, teachers use oral communication for teaching mathematics. Taking an opposite perspective, this paper describes how instructional practices for mathematics can be carried out namely a silent method. Silent method uses body language, written, and oral communication for classroom interaction. This research uses a design research approach consisting of four phases: preliminary, prototyping and developing the instruction, and assessment. There are four stages of silent method. The first stage is conditioning stage in which the teacher introduces the method and makes agreement about the `rule of the game'. It is followed by the second one, elaborating stage, where students guess and explore alternative answers. The third stage is developing mathematical thinking by structuring and symbolizing. Finally, the method is ended by reinforcing stage which aims at strengthening and reflecting student's understanding. In this paper, every stage is described on the basis of practical experiences in a real mathematics classroom setting.

  3. The funeral and commemoration rite among the Tuvans of Bayan-Ölgii and Khövsgöl aimags, Mongolia

    Directory of Open Access Journals (Sweden)

    Elena V Ayyzhy

    2017-03-01

    Full Text Available The article provides a reconstruction of the funeral and commemoration rite of Tuvans in Mongolia. The rite includes a series of acts, rites, customs and taboos that are enacted immediately after the death of a person and until he or she is buried and the funeral feast is held. There has been a wealth of studies of rites associated with funerals and commemoration among the Tuvans of their titular region, but never among Tuvans living in Mongolia. Our reconstruction is based on the data collected by the author during expeditions to Mongolia, namely to the village of Tsagaan Nuur, the Eastern taiga are of Khövsgöl aimag and to the village of Tsengel, Bayan-Ölgii aimag in 1996-2015. The Tuvans of Tsengel are known for strictly preserving the guarding rituals. To prevent the soul from returning, the dead body is never carried out of the yurt through the door, but through one of its walls, with men wearing their clothes inside out. After the ritual is over, all those present walk around the grave three times, throwing millet on the grave as a farewell gesture – and then return without looking back. The 7th and 49th day commemoration feasts do not feature Shamans, with a marked preference for lamas (a Buddhist influence. In Tsagaan Nuur, the rite has specific local features. A death is reported euphemistically, but the common Tuvan idiom ‘went to fetch some red salt’ is unknown here. Coffins are prepared by a certain body of people. If the death happened in the taiga, then no coffin was needed and no special place sought. The burial area was ‘sanctified’ by burning juniper, and the body was carried by a man on his back (using a special kind of bedding. Prior to the burial, everyone took leave of the dead person, millet was thrown around, and the dirge sung. After the burial, the grave would become taboo, and those who participated in the funeral would have undergo ‘cleansing’ and join the ‘last feast’. Commemoration on the 7th day

  4. Silent, indirect strategic processes in small and medium sized enterprises

    DEFF Research Database (Denmark)

    Larsen, Mette Vinther; Madsen, Charlotte Øland; Rasmussen, Jørgen Gulddahl

    Based on empirical data we in this paper explore day-to-day strategising with an emphasis on phronesis. This way we shed some light on the nearly silent, quiet, indirect strategic change processes as they are practiced and reflected upon by leaders in small companies in their daily practice...

  5. Correlation between increased platelet ADP aggregability and silent brain infarcts

    International Nuclear Information System (INIS)

    Ono, Kenichiro; Arimoto, Hirohiko; Shirotani, Toshiki

    2012-01-01

    The purpose of this study was to investigate the correlation between platelet aggregability and silent brain infarcts. The study subjects were 445 people (264 men, 181 women; mean age, 53±14 years) with no neurologic signs, history of brain tumor, trauma, cerebrovascular disease, or antiplatelet medications. Adenosine diphosphate (ADP)-induced platelet aggregation was measured by the aggregation-size analytic method. Platelet aggregability was classified into 9 classes. The presence of headache/vertigo, hypertension, diabetes mellitus, hyperlipidemia, or smoking was elicited by questioning or blood sampling. A head MRI scan was performed, and if marked atherosclerosis or obvious stenosis in the intracranial vessels was detected, it was defined as a positive MR angiography (MRA) finding. Silent brain infarcts were detected in 26.3% of subjects. Hyperaggregability defined as that above class 6, 7, and 8 was present in 43.8%, 30.8%, and 15.7% of subjects, respectively. The risk factors for silent brain infarcts by multiple logistic regression analysis were aging, hypertension, positive MRA findings, and hyperaggregability. Platelet ADP hyperaggregability might be a risk factor for silent brain infarcts. (author)

  6. Compositionality for Markov reward chains with fast and silent transitions

    NARCIS (Netherlands)

    Markovski, J.; Sokolova, A.; Trcka, N.; Vink, de E.P.

    2009-01-01

    A parallel composition is defined for Markov reward chains with stochastic discontinuity, and with fast and silent transitions. In this setting, compositionality with respect to the relevant aggregation preorders is established. For Markov reward chains with fast transitions the preorders are

  7. Stopping the Silent Killer: Hepatitis B Among Asian Americans

    Centers for Disease Control (CDC) Podcasts

    This podcast discusses an underappreciated health threat to many Asians and Pacific Islanders in the United States: chronic infection with the hepatitis B virus. Dr. John Ward, director of CDC's Division of Viral Hepatitis, and Dr. Sam So, founder of the Asian Liver Center at Stanford University, address the importance of testing, vaccination, and care to prevent serious health consequences from this "silent" disease.

  8. Hydrocoele: A Silent Disability Affecting Quality of Life in Katakwi ...

    African Journals Online (AJOL)

    Background: Katakwi district is one of the rural districts in eastern Uganda in Teso Sub Region. The district is heavily infested with filarial worms a major cause for hydrocoele and elephantiasis if the infection is left untreated. Hydrocoele in Katakwi district are still a big cause of silent morbidity though it's an operable ...

  9. Health Education Films of the Silent Era: A Historical Analysis

    Science.gov (United States)

    Sofalvi, Alan

    2011-01-01

    Films have been used to present health messages throughout the history of the medium. The purpose of this article is to describe pictures from the silent film era that were designed to educate people about health issues. Films still available in at least one format were reviewed. Published reviews were also used to obtain information about these…

  10. silent no more: sexual violence in conflict as a challenge

    African Journals Online (AJOL)

    Rights (FIDH), Violence Against Women in Syria: Breaking the Silence, Briefing. Paper Based on an .... not perceived as the church's concern”, Silent No More, p. 8. .... travel all night to retrieve the bodies and bury them with dignity.23 In the.

  11. Perspectives on the "Silent Period" for Emergent Bilinguals in England

    Science.gov (United States)

    Bligh, Caroline; Drury, Rose

    2015-01-01

    This article draws together the research findings from two ethnographic studies as a means to problematize the "silent period" as experienced by young bilingual learners in two English speaking early-years settings in England. Most teachers and senior early-years practitioners in England are monolingual English speakers. The children…

  12. Human Schedule Performance, Protocol Analysis, and the "Silent Dog" Methodology

    Science.gov (United States)

    Cabello, Francisco; Luciano, Carmen; Gomez, Inmaculada; Barnes-Holmes, Dermot

    2004-01-01

    The purpose of the current experiment was to investigate the role of private verbal behavior on the operant performances of human adults, using a protocol analysis procedure with additional methodological controls (the "silent dog" method). Twelve subjects were exposed to fixed ratio 8 and differential reinforcement of low rate 3-s schedules. For…

  13. Using Early Silent Film to Teach French: The Language of "Cinema Muet."

    Science.gov (United States)

    Bloom, Michelle E.

    1995-01-01

    Discusses the use of early silent films in second-language classrooms, focusing on the experiences of one instructor in using early French silents in elementary and intermediate French courses. Sample lesson plans and information on the availability of French silents are also provided. (Contains 17 references.) (MDM)

  14. Oral Reading Fluency as a Predictor of Silent Reading Fluency at Secondary and Postsecondary Levels

    Science.gov (United States)

    Seok, Soonhwa; DaCosta, Boaventura

    2014-01-01

    This research investigated oral reading fluency as a predictor of silent reading fluency at the secondary and postsecondary levels. Several measures were used, including the Gray Oral Reading Test, the Test of Silent Word Reading Fluency, the Test of Silent Contextual Reading Fluency, and the Reading Observation Scale. A total of 223 students…

  15. Isquemia miocárdica silente en diabéticos tipo 2 Silent myocardial ischemia in type 2 diabetes patients

    Directory of Open Access Journals (Sweden)

    Yordanka Piña Rivera

    2012-08-01

    Full Text Available Objetivos: determinar la frecuencia de isquemia miocárdica silente en diabéticos tipo 2 y su relación con el control metabólico. Métodos: se realizó un estudio descriptivo transversal en 79 pacientes asintomáticos con diabetes mellitus tipo 2 sin antecedentes de cardiopatía isquémica, hipertensión arterial o de ser fumador, que acudieron a la Consulta de Endocrinología del Hospital Militar Central "Dr. Carlos J. Finlay", entre febrero de 2009 y febrero de 2011. Se les realizó ecocardiografía con doppler tisular y se determinaron los niveles de glucemia en ayunas, posprandial, hemoglobina glucosilada, colesterol y triglicéridos. Las variables clínicas analizadas en relación con la isquemia miocárdica silente fueron: edad, sexo, tiempo de evolución de la diabetes e índice de masa corporal. Para las variables cualitativas se utilizaron distribuciones de frecuencia con el cálculo del porcentaje y para establecer relación entre variables la prueba de chi cuadrado. Resultados: la edad media del total de pacientes fue de 54 años, de ellos el 69,1 % correspondió al sexo masculino y el 31,9 % al femenino. En el 20,2 % de los pacientes se observaron signos de isquemia miocárdica por doppler tisular, y de ellos, un 75 % tuvo niveles patológicos de colesterol total, con relación estadísticamente significativa (p= 0,01, sujetos que tuvieron 4,4 veces más riesgo relativo de presentar isquemia miocárdica, que los pacientes con colesterol normal. Las cifras de glucemia en ayunas, posprandial y hemoglobina glucosilada fueron significativamente mayor en el grupo con isquemia. Los pacientes con niveles elevados de glucemia en ayunas tuvieron 10,5 veces más riesgo de isquemia miocárdica que los que tenían cifras adecuadas. Igualmente, los casos con cifras elevadas de glucemia posprandial presentaron 12 veces más riesgo de enfermar. Conclusiones: la isquemia miocárdica silente es frecuente en los diabéticos tipo 2 y se relaciona

  16. Anamnesis and the Silent Narrator in Plato and John

    Directory of Open Access Journals (Sweden)

    George L. Parsenios

    2017-03-01

    Full Text Available The Gospel of John is often compared to the dialogues of Plato by those who connect Johannine theology and Platonic philosophy. The comparison operates on the level of ideas. The present paper does not ignore issues of theology and philosophy but grounds a comparison of John and Plato first and foremost on the literary level. In several key places in John 1, 3, and 14, the Johannine narrator recedes from view and is unexpectedly silent where one would expect a narrator’s comment to organize the conversations and interactions between characters in John. Plato also renders the voice of the narrator silent in a dialogue like the Theaetetus. This paper argues that John and Plato both suppress the narrator’s voice in order to further their anamnetic efforts and to make later generations not only readers but participants in their original conversations.

  17. Incidence and implications of silent hydronephrosis following percutaneous nephrolithotomy
.

    Science.gov (United States)

    Dagrosa, Lawrence; Moses, Rachel; Pais, Vernon M

    2017-01-01

    While routine renal imaging following ureteroscopy for urinary calculi has been recommended to screen for asymptomatic "silent" obstruction, the rate of silent obstruction following percutaneous nephrolithotomy (PCNL) remains poorly defined, and no consensus recommendations exist on routine postoperative imaging. At our institution, we sought to assess the incidence of silent hydronephrosis (SH), as a screen for obstruction, following PCNL. The records of all 162 patients who met study inclusion criteria were reviewed. Of this group, 112 patients presented for their scheduled renal ultrasonography 4 - 6 weeks following stent removal to screen for SH. Asymptomatic patients found to have ultrasonographic evidence of hydronephrosis were further analyzed. SH was noted in 16% (18/112) of patients. Two required subsequent ureteroscopic stone extraction (1.8%), one of which also underwent endoureterotomy for a ureteral stricture. Four patients (22%) had stable hydronephrosis and declined functional imaging, 2 patients (11%) had a known partial ureteropelvic junction obstruction and declined intervention. SH resolved spontaneously in 50% (9/18) with a mean time to resolution of 6.3 months. There was no difference in stone complexity based on Guy's stone score between groups, 2.8 (± 0.92) vs. 2.4 (± 1.03), p = 0.34. Although not statistically significant, patients with SH were more likely to have had residual stone fragments postoperatively, 39% (7/18) vs. 19% (18/94), p = 0.067. SH following, PCNL was identified in 16% of this screened population, with the majority requiring no intervention. However, SH may be attributed to residual stone or stricture, which may have been otherwise unrecognized in up to 2% of patients undergoing PCNL. Consideration should be given for routine postoperative ultrasound to screen for silent obstruction following PCNL.
.

  18. Transluminal coronary angioplasty in the treatment of silent ischemia

    International Nuclear Information System (INIS)

    Bergin, P.; Myler, R.K.; Shaw, R.E.; Stertzer, S.H.; Clark, D.A.; Ryan, C.; Murphy, M.C.

    1988-01-01

    Fifty-four asymptomatic patients with positive thallium exercise tests underwent coronary angiography followed by coronary angioplasty (PTCA), as the primary therapy for silent ischemia. The procedure was technically successful in 89% of these patients. Emergency bypass graft surgery was necessary in 2 (3.6%) and q-wave myocardial infarction occurred in 1 (1.8%) of these. All fifty-four patients have been followed for a mean of 35 months since angioplasty. Of the 48 patients with initially successful PTCA, 12 had either clinical restenosis (9/14 or 19%) or a new lesion (3/48 or 6%) during follow-up, which required a repeat PTCA. At the longest follow-up, 46 (85%) had been successfully treated with on or more PTCA procedures. Two patients (3.6%) had sustained late q-wave myocardial infarction and two additional patients reported angina pectoris. There were no deaths. Angioplasty as a primary therapy for silent ischemia appears efficacious, with success and restenosis rates comparable to those in the symptomatic population. Event-free survival is improved, compared with natural history data for patients with silent ischemia from other studies. Prudent risk/benefit analysis may help to define subgroups most likely to benefit from this intervention

  19. Prevalence of silent gastrointestinal complications in maintenance renal transplant population

    Directory of Open Access Journals (Sweden)

    Teplitsky Susan

    2010-01-01

    Full Text Available This study aims to determine the prevalence of silent GI complications within a stable renal transplant population and to investigate whether the conversion to enteric-coated myco-phenolate sodium (EC-MPS, Myfortic; would improve symptom scores. This was a single-center, open-label, non-randomized, prospective study. Patients without any history of GI com-plaints were evaluated by means of the gastrointestinal symptom rating scale (GSRS, with subse-quent switch to EC-MPS in a group of patients. Silent complications were defined as patients who voiced no GI complaints at clinic visits despite a score of ≥ 2 on GSRS scale. A total of 236 stable patients participated in the trial. The prevalence of baseline scores ≥ 2 was relatively high with abdominal pain 29.66%, reflux 37.28%, indigestion 50%, constipation 58.47% and diarrhea 33.4%. Of 236 patients, 80 were converted to EC-MPS. There was statistically significant improvement on all scales in the subgroup of patients with GSRS score ≥ 2 (P< 0.05. In conclusion, the GSRS scale identified a high percentage of silent gastrointestinal complications in this renal transplant population. The converted patients with higher GSRS scores reported a sustained improvement.

  20. Assessing reading fluency in Kenya: Oral or silent assessment?

    Science.gov (United States)

    Piper, Benjamin; Zuilkowski, Stephanie Simmons

    2015-04-01

    In recent years, the Education for All movement has focused more intensely on the quality of education, rather than simply provision. Many recent and current education quality interventions focus on literacy, which is the core skill required for further academic success. Despite this focus on the quality of literacy instruction in developing countries, little rigorous research has been conducted on critical issues of assessment. This analysis, which uses data from the Primary Math and Reading Initiative (PRIMR) in Kenya, aims to begin filling this gap by addressing a key assessment issue - should literacy assessments in Kenya be administered orally or silently? The authors compared second-grade students' scores on oral and silent reading tasks of the Early Grade Reading Assessment (EGRA) in Kiswahili and English, and found no statistically significant differences in either language. They did, however, find oral reading rates to be more strongly related to reading comprehension scores. Oral assessment has another benefit for programme evaluators - it allows for the collection of data on student errors, and therefore the calculation of words read correctly per minute, as opposed to simply words read per minute. The authors therefore recommend that, in Kenya and in similar contexts, student reading fluency be assessed via oral rather than silent assessment.

  1. Differences in autonomic nerve function in patients with silent and symptomatic myocardial ischaemia.

    Science.gov (United States)

    Shakespeare, C. F.; Katritsis, D.; Crowther, A.; Cooper, I. C.; Coltart, J. D.; Webb-Peploe, M. W.

    1994-01-01

    BACKGROUND--Autonomic neuropathy provides a mechanism for the absence of symptoms in silent myocardial ischaemia, but characterisation of the type of neuropathy is lacking. AIM--To characterise and compare autonomic nerve function in patients with silent and symptomatic myocardial ischaemia. METHODS AND RESULTS--The Valsalva manoeuvre, heart rate variation (HRV) in response to deep breathing and standing, lower body negative pressure, isometric handgrip, and the cold pressor test were performed by patients with silent (n = 25) and symptomatic (n = 25) ambulatory ischaemia and by controls (n = 21). No difference in parasympathetic efferent function between patients with silent and symptomatic ischaemia was recorded, but both had significantly less HRV in response to standing than the controls (p < 0.005 for silent and p < 0.01 for symptomatic). Patients with silent ischaemia showed an increased propensity for peripheral vasodilatation compared with symptomatic patients (p < 0.02) and controls (p < 0.04). Impaired sympathetic function was found in patients with pure silent ischaemia (n = 4) compared with the remaining patients with silent ischaemia whose pain pathways were presumed to be intact. CONCLUSIONS--Patients with silent ischaemia and pain pathways presumed to be intact have an enhanced peripheral vasodilator response, and if this applied to the coronary vasculature it could provide a mechanism for limiting ischaemia to below the pain threshold. Patients with pure silent ischaemia have evidence of sympathetic autonomic dysfunction. Images PMID:8297687

  2. Cucurbitacées

    African Journals Online (AJOL)

    SARAH

    31 août 2015 ... Environ 58,17% des consommateurs des produits à base des graines de Cucurbitacées consomment régulièrement la sauce liquide simple de courge. Elle est obtenue par deux différentes méthodes selon les consommateurs. La première(A1) pratiquée par les 64,12% des consommateurs de cette sauce.

  3. COSIMA-ES-PORT

    DEFF Research Database (Denmark)

    Barfod, Michael Bruhn; Leleur, Steen

    2007-01-01

    This article describes the results of the research project – WP3 East-west, Interreg IIIB – concerning the de¬velop¬ment of a new composite decision model, COSIMA-ES-PORT, for the assessment of three pre-feasibility studies situated at the Port of Esbjerg: a road project, a railway project...... and a multimodal terminal. The three studies indicates that a new road connection to the Port of Esbjerg is a very profitable project due to large travel time savings, whereas a new railway connection is not economically viable. However, a new multimodal terminal is also a very profitable project. The COSIMA...

  4. Silent pituitary macroadenoma co-secreting growth hormone and thyroid stimulating hormone.

    Science.gov (United States)

    Sen, Orhan; Ertorer, M Eda; Aydin, M Volkan; Erdogan, Bulent; Altinors, Nur; Zorludemir, Suzan; Guvener, Nilgun

    2005-04-01

    Silent pituitary adenomas are a group of tumors showing heterogenous morphological features with no hormonal function observed clinically. To date no explanation has been provided as to why these tumors remain "silent". We report a case of a silent macroadenoma with both growth hormone (GH) and thyroid stimulating hormone (TSH) staining and secretion but with no clinical manifestations, in particular, the absence of features of acromegaly or hyperthyroidism. The relevant literature is reviewed.

  5. The Rachel Carson Letters and the Making of Silent Spring

    Directory of Open Access Journals (Sweden)

    John Paull

    2013-06-01

    Full Text Available Environment, conservation, green, and kindred movements look back to Rachel Carson’s 1962 book Silent Spring as a milestone. The impact of the book, including on government, industry, and civil society, was immediate and substantial, and has been extensively described; however, the provenance of the book has been less thoroughly examined. Using Carson’s personal correspondence, this paper reveals that the primary source for Carson’s book was the extensive evidence and contacts compiled by two biodynamic farmers, Marjorie Spock and Mary T. Richards, of Long Island, New York. Their evidence was compiled for a suite of legal actions (1957-1960 against the U.S. Government and that contested the aerial spraying of dichlorodiphenyltrichloroethane (DDT. During Rudolf Steiner’s lifetime, Spock and Richards both studied at Steiner’s Goetheanum, the headquarters of Anthroposophy, located in Dornach, Switzerland. Spock and Richards were prominent U.S. anthroposophists, and established a biodynamic farm under the tutelage of the leading biodynamics exponent of the time, Dr. Ehrenfried Pfeiffer. When their property was under threat from a government program of DDT spraying, they brought their case, eventually lost it, in the process spent US$100,000, and compiled the evidence that they then shared with Carson, who used it, and their extensive contacts and the trial transcripts, as the primary input for Silent Spring. Carson attributed to Spock, Richards, and Pfeiffer, no credit whatsoever in her book. As a consequence, the organics movement has not received the recognition, that is its due, as the primary impulse for Silent Spring, and it is, itself, unaware of this provenance.

  6. Assessment of Silent T1-weighted head imaging at 7 T

    Energy Technology Data Exchange (ETDEWEB)

    Costagli, Mauro; Tiberi, Gianluigi; Tosetti, Michela [Imago7 Foundation, Pisa (Italy); IRCCS Stella Maris, Laboratory of Medical Physics and Biotechnologies for Magnetic Resonance, Pisa (Italy); Symms, Mark R. [GE Applied Science Laboratory, Pisa (Italy); Angeli, Lorenzo [University of Pisa, Department of Translational Research and New Technologies in Medicine and Surgery, Pisa (Italy); Kelley, Douglas A.C. [GE Healthcare Technologies, San Francisco, CA (United States); Biagi, Laura [IRCCS Stella Maris, Laboratory of Medical Physics and Biotechnologies for Magnetic Resonance, Pisa (Italy); Farnetani, Andrea [University of Ferrara, Engineering Department, Ferrara (Italy); Materiacustica s.r.l., Ferrara (Italy); Rua, Catarina [University of Pisa, Department of Physics, Pisa (Italy); Donatelli, Graziella [Azienda Ospedaliero-Universitaria Pisana (AOUP), Neuroradiology Unit, Department of Diagnostic and Interventional Radiology, Pisa (Italy); Cosottini, Mirco [Imago7 Foundation, Pisa (Italy); University of Pisa, Department of Translational Research and New Technologies in Medicine and Surgery, Pisa (Italy)

    2016-06-15

    This study aimed to assess the performance of a ''Silent'' zero time of echo (ZTE) sequence for T1-weighted brain imaging using a 7 T MRI system. The Silent sequence was evaluated qualitatively by two neuroradiologists, as well as quantitatively in terms of tissue contrast, homogeneity, signal-to-noise ratio (SNR) and acoustic noise. It was compared to conventional T1-weighted imaging (FSPGR). Adequacy for automated segmentation was evaluated in comparison with FSPGR acquired at 7 T and 1.5 T. Specific absorption rate (SAR) was also measured. Tissue contrast and homogeneity in Silent were remarkable in deep brain structures and in the occipital and temporal lobes. Mean tissue contrast was significantly (p < 0.002) higher in Silent (0.25) than in FSPGR (0.11), which favoured automated tissue segmentation. On the other hand, Silent images had lower SNR with respect to conventional imaging: average SNR of FSPGR was 2.66 times that of Silent. Silent images were affected by artefacts related to projection reconstruction, which nevertheless did not compromise the depiction of brain tissues. Silent acquisition was 35 dB(A) quieter than FSPGR and less than 2.5 dB(A) louder than ambient noise. Six-minute average SAR was <2 W/kg. The ZTE Silent sequence provides high-contrast T1-weighted imaging with low acoustic noise at 7 T. (orig.)

  7. EL ORO ES TRISTE

    Directory of Open Access Journals (Sweden)

    Jose María Corella Hurtado

    2012-01-01

    Full Text Available Esas narraciones eran las mismas cantaletas de mis abuelos, de mis tíos, de los negros y los mineros, contadas bajo las torrenciales noches de lluvia o bajo los indignos soles. Mi madre también relataba de memoria, como una cotorra y con la misma exactitud mientras realizaba los oficios domésticos, bien sean los de la barraca del puerto de Barbacoas o los de la casa de Pasto. Los barbacoanos de esa lejana generación, debieron soportar los recuerdos nefastos de la historia enquistada con dolor porque crecieron coreando episodios con la misma y sorprendente precisión. Era, es y será por siempre, una carcoma dolorosa y perseverante, aquello de la draga. Es que lo sucedido en Barbacoas no debe olvidarse y menos repetirse. Esos sucesos me comprometían de alguna manera; vividos unos en carne propia y a oídas otros que mezclaban el dolor que causó a los paisanos la pobreza en que quedaron.

  8. El Futuro es Hoy

    Directory of Open Access Journals (Sweden)

    Alfonso Latiff Conde

    2002-08-01

    Full Text Available

    En ninguna otra época de la historia como en la nuestra se ha producido una transición tan rápida hacia el futuro, en el campo de la medicina.

    Lo que había sido una centuria de evolución desde la era Industrial a la era de la Informática, en la pasada década se ha convertido en una revolución.

    La cirugía laparoscopica que ha constituído el despertar a la edad de la informática como la tecnología lider es considerada ahora un standard en la práctica médica. En la actualidad tecnologias más avanzadas prometen mayores progresos en la medicina.

    La mayor revolución médica ocurrió en la cirugía en las postrimerias del siglo diecinueve cuando algunos gigantes de la medicina todavía caminaban sobre la tierra. Estos visionarios comprendieron la magnitud del cambio y dieron nacimiento a la nueva disciplina de la cirugía. Entre ellos estaban Bilroth, Lister, Virchow y Morton.

    Nunca trabajaron juntos, pero la integración espontánea de sus investigaciones y sus habilidades clínicas hicieron posible la nueva cirugía. Fue la convergencia de sus visiones y sus tecnologias las que dieron un vuelco a la cirugía. Bilroth aportó nuevas técnicas y nuevos instrumentos Lister aportó la asepsia, Virchow la patología y Morton la anestesia.

    Los antiguos mitos y muchos hechos empiricos hicieron creer por miles de años en la inviolabilidad del cuerpo humano. Las herramientas científicas de la Era Industrial convirtieron en realidad lo imposible y la ciencia dio nacimiento a la moderna cirugía. En un corto periodo de tiempo se establecieron los fundamentos de una cirugía que permitiría a las siguientes generaciones liderar nuevos avances y tecnologias.

    Nada estremeció más los fundamentos de la medicina como esta explosión de la cirugía. Comprender el shock, la cirugía cardiaca y coronaria, los trasplantes, tuvieron un enorme impacto que conmocionó la medicina. Es obvio que los cambios producidos

  9. Electrocardiographically and symptomatically silent myocardial ischemia during exercise testing

    International Nuclear Information System (INIS)

    Kurata, Chinori; Tawarahara, Kei; Sakata, Kazuyuki; Taguchi, Takahisa; Fukumoto, Yoshihiro; Kobayashi, Akira; Yamazaki, Noboru; Tanaka, Hiroshi

    1991-01-01

    Certain patients with coronary artery disease (CAD) may have neither ST depression nor chest pain during exercise despite the presence of myocardial ischemia. The frequency and characteristics of such electrocardiographically and symptomatically silent ischemia were studied in 171 patients with both angiographically documented CAD and scintigraphically documented ischemia. Fifty-six (33%) of 171 patients had neither ST depression nor chest pain (Group N), and 115 (67%) had ST depression and/or chest pain (Group P). The two groups were similar with respect to age, gender, the prevalence of prior infarction, and peak systolic blood pressure. Group N patients, however, had a higher mean peak heart rate and rate-pressure product, less severe scintigraphic ischemia, a lower lung thallium-201 uptake, and a smaller number of diseased vessels. Stepwise discriminant analysis showed a history of effort angina, lung thallium-201 uptake, and scintigraphic severity of ischemia to be significant discriminators between Groups N and P. In conclusion, electrocardiographically and symptomatically silent ischemia may be common during exercise in patients with CAD, and less severe ischemia may be one of important determinants. (author)

  10. Silent ischemic brain lesions after transcatheter aortic valve replacement : lesion distribution and predictors

    NARCIS (Netherlands)

    Samim, Mariam; Hendrikse, Jeroen; van der Worp, H. Bart; Agostoni, Pierfrancesco; Nijhoff, Freek; Doevendans, Pieter A.; Stella, Pieter R.

    Silent ischemic brain lesions and ischemic stroke are known complications of transcatheter aortic valve replacement (TAVR). We aimed to investigate the occurrence and distribution of TAVR-related silent ischemic brain lesions using diffusion-weighted magnetic resonance imaging (DWI). Consecutive

  11. Morphology and Spelling in French Students with Dyslexia: The Case of Silent Final Letters

    Science.gov (United States)

    Quémart, Pauline; Casalis, Séverine

    2017-01-01

    Spelling is a challenge for individuals with dyslexia. Phoneme-to-grapheme correspondence rules are highly inconsistent in French, which make them very difficult to master, in particular for dyslexics. One recurrent manifestation of this inconsistency is the presence of silent letters at the end of words. Many of these silent letters perform a…

  12. The Keefe Inventory of Silent Reading: A Window into the Reading Process.

    Science.gov (United States)

    Keefe, Donald

    1993-01-01

    Contains part of the Keefe Inventory of Silent Reading, a silent informal reading inventory. Presents a case study of a student to whom it was administered, including analysis of this individual's reading ability and description of the specific strategies used with this individual on the basis of the results of the inventory. (RS)

  13. EFFICACY OF METOPROLOL AND DILTIAZEM IN TREATING SILENT-MYOCARDIAL-ISCHEMIA

    NARCIS (Netherlands)

    PORTEGIES, MCM; SIJBRING, P; GOBEL, JAM; VIERSMA, JW; LIE, KI

    1994-01-01

    Recent studies strongly support the prognostic importance of transient silent ischemia. Because patients with silent ischemia are at higher risk of a cardiac event, they are likely to benefit not only from control of symptoms, but also from treatment directed at prevention of ischemia. The efficacy

  14. Does phonological recoding occur during silent reading and is it necessary for orthographic learning?

    NARCIS (Netherlands)

    de Jong, P.F.; Bitter, D.J.L.; van Setten, M.; Marinus, E.

    2009-01-01

    Two studies were conducted to test the central claim of the self-teaching hypothesis (i.e., phonological recoding is necessary for orthographic learning) in silent reading. The first study aimed to demonstrate the use of phonological recoding during silent reading. Texts containing pseudowords were

  15. (In-)Secure messaging with the Silent Circle instant messaging protocol

    NARCIS (Netherlands)

    Verschoor, S.R.; Lange, T.

    2016-01-01

    Silent Text, the instant messaging application by the company Silent Circle, provides its users with end-to-end encrypted communication on the Blackphone and other smartphones. The underlying protocol, SCimp, has received many extensions during the update to version 2, but has not been subjected to

  16. Distinct transmitter release properties determine differences in short-term plasticity at functional and silent synapses.

    Science.gov (United States)

    Cabezas, Carolina; Buño, Washington

    2006-05-01

    Recent evidence suggests that functional and silent synapses are not only postsynaptically different but also presynaptically distinct. The presynaptic differences may be of functional importance in memory formation because a proposed mechanism for long-term potentiation is the conversion of silent synapses into functional ones. However, there is little direct experimentally evidence of these differences. We have investigated the transmitter release properties of functional and silent Schaffer collateral synapses and show that on the average functional synapses displayed a lower percentage of failures and higher excitatory postsynaptic current (EPSC) amplitudes than silent synapses at +60 mV. Moreover, functional but not silent synapses show paired-pulse facilitation (PPF) at +60 mV and thus presynaptic short-term plasticity will be distinct in the two types of synapse. We examined whether intraterminal endoplasmic reticulum Ca2+ stores influenced the release properties of these synapses. Ryanodine (100 microM) and thapsigargin (1 microM) increased the percentage of failures and decreased both the EPSC amplitude and PPF in functional synapses. Caffeine (10 mM) had the opposite effects. In contrast, silent synapses were insensitive to both ryanodine and caffeine. Hence we have identified differences in the release properties of functional and silent synapses, suggesting that synaptic terminals of functional synapses express regulatory molecular mechanisms that are absent in silent synapses.

  17. Silent Flange Coupling Design Used for the Schenck Eddy Current Dynamometer

    Science.gov (United States)

    Schinteie, D.; Croitorescu, V.

    2016-11-01

    The silent flange used for coupling different machines/systems to an eddy current dynamometer represents one of the modular components each test-bench should use. By introducing a silent flange into a dynamometer, the coupling steps are easier and faster. For an appropriate design, the silent flange was analyzed using dedicated software during different operation procedures and scenarios, for materials that allow easy manufacturing. This study shows that the design for this silent flange model has no danger of failure due to the small deformation and the values for the equivalent stresses. The silent flange coupling is suitable for the dynamometer for his high positioning accuracy, the zero backlash and the fact that there is no motion between the shafts.

  18. Low fetal hemoglobin percentage is associated with silent brain lesions in adults with homozygous sickle cell disease

    OpenAIRE

    Calvet, David; Tuilier, Titien; Mélé, Nicolas; Turc, Guillaume; Habibi, Anoosha; Abdallah, Nassim Ait; Majhadi, Loubna; Hemery, François; Edjlali, Myriam; Galacteros, Frédéric; Bartolucci, Pablo

    2017-01-01

    Low %HbF is independently associated with silent WMCs on brain imaging in adults with SCD.Our results highlight the potential use of therapeutic strategies inducing HbF expression in SCD patients with silent white matter changes.

  19. Plasma remediation of trichloroethylene in silent discharge plasmas

    International Nuclear Information System (INIS)

    Evans, D.; Rosocha, L.A.; Anderson, G.K.; Coogan, J.J.; Kushner, M.J.

    1993-01-01

    Plasma destruction of toxins, and volatile organic compounds in particular, from gas streams is receiving increased attention as an energy efficient means to remediate those compounds. In this regard, remediation of trichloroethylene (TCE) in silent discharge plasmas has been experimentally and theoretically investigated. We found that TCE can be removed from Ar/O 2 gas streams at atmospheric pressure with an energy efficiency of 15--20 ppm/(mJ/cm 3 ), or 2--3 kW h kg -1 . The majority of the Cl from TCE is converted to HCl, Cl 2 , and COCl 2 , which can be removed from the gas stream by a water bubbler. The destruction efficiency of TCE is smaller in humid mixtures compared to dry mixtures due to interception of reactive intermediates by OH radicals

  20. Scaling of silent electrical discharge reactors for hazardous organics destruction

    International Nuclear Information System (INIS)

    Coogan, J.J.; Rosocha, L.A.; Brower, M.J.; Kang, M.; Schmidt, C.A.

    1993-01-01

    Silent electrical discharges are used to produce highly reactive free radicals that destroy hazardous compounds entrained in gaseous effluents at ambient gas temperatures and pressures. We have carried out destruction experiments at Los Alamos on a range of volatile organic compounds (VOCs), including trichloroethylene (TCE), carbon tetrachloride, perchloroethylene (PCE), and chlorofluorocarbons (CFCs). We have measured a ''nine-factor'', the amount of energy required to reduce the VOC concentration by a factor of ten. For practical reactor power densities, the ''nine-factor'' can be used to predict the destruction an removal efficiency (DRE) in terms of gas flow rate and the number of reactor modules. This report proposes a modular, stackable architecture for scaling up the reactor throughput

  1. [Silent myocardial ischemia in patients with transient ischemic attacks].

    Science.gov (United States)

    Sánchez Valiente, S; Mostacero, E; del Río, A; Morales, F

    1994-10-01

    Given evidence that ischemic heart disease is the most frequent cause of death in patients with cerebrovascular disease, we used ergometrics to screen 80 patients with TIA for silent myocardial ischemia (SMI) at the neurological unit of Hospital Clínico Universitario in Zaragoza, Spain. The patients were compared with a control group of 80 with no signs of heart disease. Neither the patients nor the controls had ever shown clinical signs of coronary ischemia and their baseline electrocardiograms were normal. Stress test results were positive in 25 (31%) of the TIA patients, and in 4 (5%) (p Hiperlipidemia (75% testing positive versus 43% negative, p < 0.01) and diabetes (31% testing positive versus 13% negative, p < 0.01) were the risk factors statistically related with a positive stress test.

  2. Myocardial perfusion imaging for detection of silent myocardial ischemia

    International Nuclear Information System (INIS)

    Beller, G.A.

    1988-01-01

    Despite the widespread use of the exercise stress test in diagnosing asymptomatic myocardial ischemia, exercise radionuclide imaging remains useful for detecting silent ischemia in numerous patient populations, including those who are totally asymptomatic, those who have chronic stable angina, those who have recovered from an episode of unstable angina or an uncomplicated myocardial infarction, and those who have undergone angioplasty or received thrombolytic therapy. Studies show that thallium scintigraphy is more sensitive than exercise electrocardiography in detecting ischemia, i.e., in part, because perfusion defects occur more frequently than ST depression and before angina in the ischemic cascade. Thallium-201 scintigraphy can be performed to differentiate a true- from a false-positive exercise electrocardiographic test in patients with exercise-induced ST depression and no angina. The development of technetium-labeled isonitriles may improve the accuracy of myocardial perfusion imaging. 11 references

  3. Reducing the silent burden of impaired mental health.

    Science.gov (United States)

    Jané-Llopis, Eva; Anderson, Peter; Stewart-Brown, Sarah; Weare, Katherine; Wahlbeck, Kristian; McDaid, David; Cooper, Cary; Litchfield, Paul

    2011-08-01

    Mental and behavioral disorders account for about one third of the world's disability caused by all ill health among adults, with unipolar depressive disorders set to be the world's number one cause of illhealth and premature death in 2030, affecting high- and low-income countries. There is a range of evidence-based cost-effective interventions that can be implemented in parenting, at schools, at the workplace, and in older age that can promote health and well-being, reduce mental disorders, lead to improved productivity, and increase resilience to cope with many of the stressors in the world. These facts need to be better communicated to policymakers to ensure that the silent burden of impaired mental health is adequately heard and reduced.

  4. Stopping the Silent Killer: Hepatitis B Among Asian Americans

    Centers for Disease Control (CDC) Podcasts

    2008-04-18

    This podcast discusses an underappreciated health threat to many Asians and Pacific Islanders in the United States: chronic infection with the hepatitis B virus. Dr. John Ward, director of CDC's Division of Viral Hepatitis, and Dr. Sam So, founder of the Asian Liver Center at Stanford University, address the importance of testing, vaccination, and care to prevent serious health consequences from this "silent" disease.  Created: 4/18/2008 by National Center for HIV/AIDS, Viral Hepatitis, STD, and TB Prevention (NCHHSTP), Division of Viral Hepatitis (DVH) and Office of Dispute Resolution and Equal Employment Opportunity, Office of the Director (OD).   Date Released: 5/1/2008.

  5. Treatment of hazardous organic wastes using silent discharge plasmas

    International Nuclear Information System (INIS)

    Rosocha, L.A.; Anderson, G.K.; Bechtold, L.A.; Coogan, J.J.; Heck, H.G.; Kang, M.; McCulla, W.H.; Tennant, R.A.; Wantuck, P.J.

    1992-01-01

    During the past two decades, interest in applying non-equilibrium plasmas to the removal of hazardous chemicals from gaseous media has been growing, in particular from heightened concerns over the pollution of our environment and a growing body of environmental regulations. At the Los Alamos National Laboratory, we are currently engaged in a project to develop non-equilibrium plasma technology for hazardous waste treatment. Our present focus is on dielectric-barrier discharges, which are historically called silent electrical discharges. This type of plasma is also named a silent discharge plasma (SDP). We have chosen this method due to its potential for high energy efficiency, its scientific and technological maturity, and its scalability. The SDP process has been demonstrated to be reliable and economical for the industrial-scale synthesis of ozone, where municipal water treatment plants frequently require the on-site generation of thousands of kilograins per day (Eliasson ampersand Kogelschatz). The related methods of corona processing are presently the focus of work at other institutions, particularly for flue gas processing. Both SDP and corona processes are characterized by the production of large quantities of highly reactive free radicals, especially atomic oxygen O(3P) and the hydroxyl OH, in the gaseous medium and their subsequent reaction with contaminants. Our primary objective is to convert hazardous or toxic chemicals into non-hazardous compounds or into materials which are more amenable to treatment. In the ideal case, the hazardous wastes are destructively oxidized to simpler, non-hazardous compounds plus CO2 and H2O. Sometimes the reaction products are still potentially hazardous, but are easily treated by conventional methods to yield non-hazardous products

  6. Migraine with aura and silent brain infarcts lack of mediation of patent foramen ovale.

    Science.gov (United States)

    Calviere, L; Tall, P; Massabuau, P; Bonneville, F; Larrue, V

    2013-12-01

    Population-based studies have shown a heightened prevalence of clinically silent brain infarcts in subjects who have migraine with aura (MA). We sought to determine whether this association could be confirmed in young patients with cryptogenic ischemic stroke, and explored the role of patent foramen ovale (PFO) as a potential underlying mechanism. Patients were selected from a registry of young patients consecutively treated for ischemic stroke in a tertiary university hospital among those without definite cause of stroke. Patients with PFO were matched for age and gender with patients with normal atrial septum. Migraine and MA were evaluated after patient selection and matching. Silent brain infarcts were independently evaluated on MRI. We included 100 patients [60 men; mean age (SD), 44.8 years (8.3)], 50 patients with PFO. We found silent brain infarcts in 36 patients and MA in 13 patients. MA was more frequent in patients with silent brain infarcts than in patients without silent brain infarcts (25.0% vs. 6.3%; OR, 5; 95% CI, 1.4-17.6; P = 0.01). Traditional cardiovascular risk factors were not associated with silent brain infarcts. PFO was neither associated with MA (OR, 1.7; 95% CI, 0.5-5.3) nor silent brain infarcts (OR, 0.7; 95% CI, 0.3-1.5). The association of MA with silent brain infarcts was not altered after adjustment for PFO. Findings suggest that silent brain infarcts in young patients with cryptogenic stroke is associated with MA. We found no evidence for a mediating effect of PFO on this association. © 2013 The Author(s) European Journal of Neurology © 2013 EFNS.

  7. Screening for silent myocardial ischemia caseof diabetics : interest of myocardial perfusion scintigraphy

    International Nuclear Information System (INIS)

    Bahri, Haifa

    2007-01-01

    Silent myocardial ischemia is a major cause of morbidity and mortality in diabetic patients. Its diagnosis by noninvasive means such as myocardial SPECT would improve the management of these patients. The purpose of this study is to assess the frequency of silent myocardial ischemia in asymptomatic diabetics and their evolution. As a result, the myocardial SPECT is a reliable tool for screening for silent myocardial ischemia in diabetic patients. Its prognostic value allows to stratify the cardiac risk and guide therapeutic management. Its integration into a screening strategy in Tunisia seems limited by its low availability and cost. The latter could be reduced by better patient selection.

  8. Silent ischemia in patients after the acute myocardial infarction

    International Nuclear Information System (INIS)

    Samarzija, M.

    1991-01-01

    The purpose of this study was to determine the frequency and importance of silent ischemia in patients (pts) after acute myocardial infarction (AMI) as well as to establish diagnostic and prognostic values of exercise stress test (EST), Holter (H) monitoring and thallium-201 (Tl) scintigraphy. All the tests were performed 2-4 months following the AMI. The criterion for diagnostic myocardial ischemia on EST and H is 1 mm or more of horizontal or down-sloping ST depression. Additional criteria for Holter imply that the ischemic episode should last one minute and be separated from other episodes by at least one minute. Planar thallium images were performed 5-10 minutes after the stress test; the delayed images were obtained after 3-6 hours. Visual and quantitative methods were employed in the analysis of Tl-scintigraphy. Scintigraphy was considered positive if exercise-induced perfusion defects showed redistribution. The study included 74 asymptomatic patients after the AMI. The patients were divided into two groups by results of quantitative Tl-scintigraphy: Group I - 44 pts with silent ischemia, Group II - 30 pts without ischemia. In Group I, out of 44 pts, 9 had a positive exercise stress test, 4 showed a painless ST depression on Holter and 7 had both tests positive, whereas 24 pts had only scintigraphy positive. In Group II one patient had positive EST and H. Sensitivity and specificity were determined by results of coronary arteriography performed on 33 pts: EST (Se=40%, Sp=80%), H (Se=21%, Sp=100%) and scintigraphy (Se=93%, Sp=80%). During the follow-up period lasting at least 12 months, in Group I 3 pts died, 1 developed a new myocardial infarction and 15 pts had painful ischemic occurrences. In Group II only 3 pts developed symptoms of angina pectoris. Tl-scintigraphy was the only non-invasive test showing significant correlation with the follow-up outcomes. The diagnostic and prognostic superiority of Tl-scintigraphy justifies its value as an initial

  9. Silent ischemia in patients after uncomplicated myocardial infarction

    International Nuclear Information System (INIS)

    Samarzija, M.; Tezak, S.

    1994-01-01

    The purpose of this study was to determine the frequency and importance of silent ischemia in patients (pts) after the acute myocardial infarction (A MI) as well as to establish diagnostic and prognostic value of exercise stress test (EST), Holter (H) monitoring and thallium-201 (Tl) scintigraphy. All the three tests were performed 2-4 months following the AMI. The criterion for diagnosing myocardial ischemia on EST and H is 1 mm or more of horizontal or down-sloping ST depression. Additional criteria for Holter imply the ischemic episode should last one minute and be separated from other episodes by at least one minute. Planar thallium images were performed 5-10 minute after the stress test; the delayed images were obtained after 3-6 hours. Visual and quantitative methods were employed in the analysis of TI-scintigraphy. Scintigraphy was considered positive if exercise- induced perfusion defects showed redistribution. The study included 74 asymptomatic patients after the AMI. The patients were divided into two groups by results of quantitative Tl-scintigraphy: Group I - 44 pts with silent ischemia, Group II - 30 pts without ischemia. In Group I, out of 44 pts, 9 had a positive exercise stress, 4 showed a painless ST depression on Holter and 7 had both tests positive, whereas 24 pts had only scintigraphy positive. In Group II one patient had positive EST and H. Sensitivity and specificity were determined by results of coronary arteriography performed on 33 pts: EST (Se=40%, Sp=80%), H (Se=219, Sp=100%) and scintigraphy (Se=93%, Sp =80%). During the follow-up period lasting at least 12 months, in Group I 3 pts died, 1 developed a new myocardial infarction and 15 pts had painful ischemic occurrences. In Group II only 3 pts developed symptoms of angina pectoris. Tl-scintigraphy was the only non-invasive test showing significant correlation with the follow-up outcomes. The diagnostic and prognostic superiority of Tl-scintigraphy justifies its value as the initial

  10. Silent angels the genetic and clinical aspects of Rett syndrome

    Directory of Open Access Journals (Sweden)

    Dziwota Ewelina

    2016-12-01

    Full Text Available Rett syndrome is a neurodevelopmental genetic disorder and, because of some behavioral characteristics, individuals affected by the disease are known as silent angels. Girls with Rett syndrome perform stereotyped movements, they have learning difficulties, their reaction time is prolonged, and they seem alienated in the environment. These children require constant pediatric, neurological and orthopedic care. In the treatment of Rett syndrome physical therapy, music therapy, hydrotherapy, hippotherapy, behavioral methods, speech therapy and diet, are also used. In turn, psychological therapy of the syndrome is based on the sensory integration method, using two or more senses simultaneously. In 80% of cases, the syndrome is related to mutations of the MECP2 gene, located on chromosome X. The pathogenesis of Rett syndrome is caused by the occurrence of a non-functional MeCP2 protein, which is a transcription factor of many genes, i.e. Bdnf, mef2c, Sgk1, Uqcrc1. Abnormal expression of these genes reveals a characteristic disease phenotype. Clinical symptoms relate mainly to the nervous, respiratory, skeletal and gastrointestinal systems. Currently causal treatment is not possible. However, researchers are developing methods by which, perhaps in the near future, it will be possible to eliminate the mutations in the MECP2 gene, and this will give a chance to the patient for normal functioning.

  11. The silent mass extinction of insect herbivores in biodiversity hotspots.

    Science.gov (United States)

    Fonseca, Carlos Roberto

    2009-12-01

    Habitat loss is silently leading numerous insects to extinction. Conservation efforts, however, have not been designed specifically to protect these organisms, despite their ecological and evolutionary significance. On the basis of species-host area equations, parameterized with data from the literature and interviews with botanical experts, I estimated the number of specialized plant-feeding insects (i.e., monophages) that live in 34 biodiversity hotspots and the number committed to extinction because of habitat loss. I estimated that 795,971-1,602,423 monophagous insect species live in biodiversity hotspots on 150,371 endemic plant species, which is 5.3-10.6 monophages per plant species. I calculated that 213,830-547,500 monophagous species are committed to extinction in biodiversity hotspots because of reduction of the geographic range size of their endemic hosts. I provided rankings of biodiversity hotspots on the basis of estimated richness of monophagous insects and on estimated number of extinctions of monophagous species. Extinction rates were predicted to be higher in biodiversity hotspots located along strong environmental gradients and on archipelagos, where high spatial turnover of monophagous species along the geographic distribution of their endemic plants is likely. The results strongly support the overall strategy of selecting priority conservation areas worldwide primarily on the basis of richness of endemic plants. To face the global decline of insect herbivores, one must expand the coverage of the network of protected areas and improve the richness of native plants on private lands.

  12. Silent Sinus Syndrome: A Retrospective Review of 11 Cases

    Directory of Open Access Journals (Sweden)

    Karima DARGHAL

    2014-06-01

    Full Text Available Objective: The purpose of this study is to describe the clinical and radiological features of SSS, and to review therapeutic possibilities and their outcomes.Patients and Methods: Retrospective observational case series in the department of Arthur Vernes Institute between Mars 2007 and  Novembre 2012. Clinical records, including ophthalmology and otolaryngology evaluations as well as computed tomography scans and operative reports, were carefully examined. A literature review for relevant studies was performed to examine similar cases.Results: Eleven cases of  SSS were identified. Nine men and two women (sex ratio 4.5, aged between 23 and 54 years (mean, 30 years. there was 3 to 4 mm enophthalmos in 10 cases (90.9%, and hypoglobus in all cases, with no effect on visual function. In all 11 cases, the maxillary roof (orbital floor was drawn downwards, and the one or more walls of the maxilla were concave. In 4 cases septal deviation was present. 8 patients (72.7% underwent endoscopic sinus surgery, while 3 refused it. Septoplasty was performed in 4 cases (36.3%.Conclusion: The silent sinus syndrome is a rare entity. It mainly presents as unilateral enophthalmos in younger people and has very characteristic clinical and radiologic signs.This case series reports our diagnostic and therapeutic experience with this syndrome.

  13. Silent Spring, the 50th anniversary of Rachel Carson's book.

    Science.gov (United States)

    Pimentel, David

    2012-09-27

    David Pimentel is a professor of ecology and agricultural sciences at Cornell University, Ithaca, NY 14853-0901. His Ph.D. is from Cornell University and had postdoctoral research at the University of Chicago, MIT, and fellowship at Oxford University (England). He was awarded a distinguished honorary degree from the University of Massachusetts. His research spans the fields of energy, population ecology, biological pest control, pesticides, sustainable agriculture, land and water conservation, livestock, and environmental policy. Pimentel has published more than 700 scientific papers and 37 books and has served on many national and government committees including the National Academy of Sciences; President's Science Advisory Council; U.S Department of Agriculture; U.S. Department of Energy; U.S. Department of Health, Education and Welfare; Office of Technology Assessment of the U.S. Congress; and the U.S. State Department. He is currently Editorial Advisor for BMC Ecology. In this article, he reflects on 50 years since the publication of Rachel Carson's influential book, Silent Spring.

  14. Sonographically determined clues to the symptomatic or silent cholelithiasis

    International Nuclear Information System (INIS)

    Saba, S.; Iqbal, Z.

    2007-01-01

    To determine an association between sonographically determined contractility with the symptomatic or silent nature of gallstone. Adult gallstone patients without (group I) and with biliary symptoms (group II) were compared with age and gender-matched controls. Demographic data, body mass index, risk factors, size, number and mobility of gallstone, gallbladder wall thickness (GBWT), volume and Ejection Fraction (EF) were determined on ultrasound before and after a standardized fatty meal (BFM and AFM). Demographic data, risk factors and gallstone characteristics were analyzed by Pearson Chi-square test and the gallbladder characteristics were analyzed by One-way ANOVA and Post Hoc tests by multiple comparisons on SPSS 11 with significance p=0.05. The gallbladder contractility as measured by changes in wall thickness and volume changes BFM and AFM, and ejection fraction was similar in controls and asymptomatic cholelithiasis groups and significantly reduced in symptomatic patients (p<.001). Multiparity (p=0.002), female gender (p=0.018), age less than 50 years (0.05), impacted calculi (p=0.001), multiple calculi (<.001) and calculi 5 mm (p<0.001) were associated with pain. A sluggishly emptying gallbladder was more significantly associated with symptomatic cholelithiasis compared to controls and asymptomatic cholelithiasis state in this series. Consideration of age, gender, impaction of calculi, number and size of calculi is important in causing symptom state and management options. (author)

  15. Construction of the Cylindrical Ozone Generator by Silent Discharge Method

    International Nuclear Information System (INIS)

    Agus Purwadi; Widdi Usada; Suryadi; Isyuniarto; Sri Sukmajaya

    2002-01-01

    It has been constructed the ozone generator by silent discharge method. Anode and cathode of discharge tube were made of stainless steel (SS) in the cylinder form with diameters of 22 mm and 25 mm, the length of 100 mm and 110 mm, the equal thickness of 1 mm respectively. The dielectric was made of cylinder glass with diameter of 23 cm, the length of 105 cm and the thickness of 1 mm. The testing of apparatus was carried out by using discharge voltage of 12.5 kV and frequency of 1.5 kHz. Identification of the ozone gas formation was marked by the existing of special ozone smell and the separated of iodine molecule (yellow colour) from the potassium iodide solution which contaminated gas out put from the ozonizer. By using absorbing method can be shown that the ozone production rate was 0.196 mg/s by using oxygen gas input and 0.065 mg/s by using ordinary air input. (author)

  16. Silent Aortic Dissection Presenting as Transient Locked-In Syndrome

    Science.gov (United States)

    Nadour, Wadih; Goldwasser, Brian; Biederman, Robert W.; Taffe, Kevin

    2008-01-01

    Acute aortic dissection is a medical emergency. Without prompt recognition and treatment, the mortality rate is high. An atypical presentation makes timely diagnosis difficult, especially if the patient is experiencing no characteristic pain. Many patients with aortic dissection are reported to have presented with various neurologic manifestations, but none with only a presentation of transient locked-in syndrome. Herein, we report a case of completely painless aortic dissection in a woman who presented with a transient episode of anarthria, quadriplegia, and preserved consciousness. On physical examination, she had a 40-point difference in blood pressure between her left and right arms, and a loud diastolic murmur. The diagnosis of acute aortic dissection was reached via a combination of radiography, computed tomography, echocardiography, and a high index of clinical suspicion. The patient underwent emergency surgery and ultimately experienced a successful outcome. To our knowledge, this is the 1st report of aortic dissection that presented solely as locked-in syndrome. We suggest that silent aortic dissection be added to the differential diagnosis for transient locked-in syndrome. PMID:18941610

  17. Agreement of the silent partnership – tax and legal consequences of its conclusion and execution

    OpenAIRE

    Monika Zieniewicz

    2016-01-01

    The institution of the silent partnership is not currently regulated by any legal act in the Polish legal system, although its importance in practice is not in doubt. As every action made in the economic sphere and economic execution of the contract is associated with specific effects on the basis of the tax laws. However, due to the lack of statutory regulation of the institution of silent partnership problematic is the question of determining the effects of tax legislation. Therefore, speci...

  18. The written voice: implicit memory effects of voice characteristics following silent reading and auditory presentation.

    Science.gov (United States)

    Abramson, Marianne

    2007-12-01

    After being familiarized with two voices, either implicit (auditory lexical decision) or explicit memory (auditory recognition) for words from silently read sentences was assessed among 32 men and 32 women volunteers. In the silently read sentences, the sex of speaker was implied in the initial words, e.g., "He said, ..." or "She said...". Tone in question versus statement was also manipulated by appropriate punctuation. Auditory lexical decision priming was found for sex- and tone-consistent items following silent reading, but only up to 5 min. after silent reading. In a second study, similar lexical decision priming was found following listening to the sentences, although these effects remained reliable after a 2-day delay. The effect sizes for lexical decision priming showed that tone-consistency and sex-consistency were strong following both silent reading and listening 5 min. after studying. These results suggest that readers create episodic traces of text from auditory images of silently read sentences as they do during listening.

  19. Influence of limb temperature on cutaneous silent periods.

    Science.gov (United States)

    Kofler, Markus; Valls-Solé, Josep; Vasko, Peter; Boček, Václav; Štetkárová, Ivana

    2014-09-01

    The cutaneous silent period (CSP) is a spinal inhibitory reflex mediated by small-diameter afferents (A-delta fibers) and large-diameter efferents (alpha motoneurons). The effect of limb temperature on CSPs has so far not been assessed. In 27 healthy volunteers (11 males; age 22-58 years) we recorded median nerve motor and sensory action potentials, median nerve F-wave and CSPs induced by noxious digit II stimulation in thenar muscles in a baseline condition at room temperature, and after randomly submersing the forearm in 42 °C warm or 15 °C cold water for 20 min each. In cold limbs, distal and proximal motor and sensory latencies as well as F-wave latencies were prolonged. Motor and sensory nerve conduction velocities were reduced. Compound motor and sensory nerve action potential amplitudes did not differ significantly from baseline. CSP onset and end latencies were more delayed than distal and proximal median nerve motor and sensory latencies, whereas CSP duration was not affected. In warm limbs, opposite but smaller changes were seen in nerve conduction studies and CSPs. The observed CSP shift "en bloc" towards longer latencies without affecting CSP duration during limb cooling concurs with slower conduction velocity in both afferent and efferent fibers. Disparate conduction slowing in afferents and efferents, however, suggests that nociceptive EMG suppression is mediated by fibers of different size in the afferent than in the efferent arm, indirectly supporting the contribution of A-delta fibers as the main afferent input. Limb temperature should be taken into account when testing CSPs in the clinical setting, as different limb temperatures affect CSP latencies more than large-diameter fiber conduction function. Copyright © 2014 International Federation of Clinical Neurophysiology. Published by Elsevier Ireland Ltd. All rights reserved.

  20. Immunological profile of silent brain infarction and lacunar stroke.

    Directory of Open Access Journals (Sweden)

    Paola Sarchielli

    Full Text Available Neuroinflammation is believed to be involved in the pathophysiological mechanisms of silent brain infarcts (SBI. However, the immunological profile of SBI has been scarcely investigated. In the context of a national research project named SILENCE, aimed at investigating clinical, biochemical and pathogenic features of SBI, we have measured the plasma profile of some inflammatory-related molecules in SBI patients (n = 21, patients with recent lacunar infarcts (LI, n = 28 and healthy controls (n = 31, consecutively enrolled in four Italian centres. A panel of chemokines (MIG, CTACK, IL16, SDF1a, MCP1, growth factors (SCF, SCGFb, HGF, IL3, immunoglobulin-type adhesion molecules (ICAM1, VCAM1, proinflammatory cytokines (IL18, INFa2, MIF, IL12p40, cell surface receptors on T-cells (IL2Ra, and inductors of apoptosis (TRAIL was assessed in plasma samples by Luminex xMAP™ technology. Immunological parameters were compared using non-parametric statistics and performance to distinguish SBI and LI was evaluated by receiver operating characteristic (ROC analysis. Plasma levels of ICAM1 were significantly higher in both SBI and LI patients as compared to controls (SBI≥LI>Ctrl. A different trend was observed for IL16 (SBICtrl, SCF (LICtrl and SCGFb (SBI>LICtrl and IL18 when compared to LI patients (Ctrl≤SBI>LI. All the other immunological markers did not significantly differ among groups. According to ROC analysis, the best predictor for SBI condition was the chemokine MIG (AUC = 0.84, sensitivity 86%, specificity 77%, while SCF had the best performance in distinguishing LI patients (AUC = 0.84, sensitivity 86%, specificity 68%. These results confirm the involvement of inflammatory processes in cerebrovascular disorders, particularly in SBI, a very common age-related condition. The differences in plasma profile of inflammatory molecules may underlie different pathological mechanisms in SBI and LI patients.

  1. Mass media effect on vaccines uptake during silent polio outbreak.

    Science.gov (United States)

    Sagy, Iftach; Novack, Victor; Gdalevich, Michael; Greenberg, Dan

    2018-03-14

    During 2013, isolation of a wild type 1 poliovirus from routine sewage sample in Israel, led to a national OPV campaign. During this period, there was a constant cover of the outbreak by the mass media. To investigate the association of media exposure and OPV and non-OPV vaccines uptake during the 2013 silent polio outbreak in Israel. We received data on daily immunization rates during the outbreak period from the Ministry of Health (MoH). We conducted a multivariable time trend analysis to assess the association between daily media exposure and vaccines uptake. Analysis was stratified by ethnicity and socio-economic status (SES). During the MoH supplemental immunization activity, 138,799 OPV vaccines were given. There was a significant association between media exposure and OPV uptake, most prominent in a lag of 3-5 days from the exposure among Jews (R.R 1.79C.I 95% 1.32-2.41) and high SES subgroups (R.R 1.71C.I 95% 1.27-2.30). These subgroups also showed increased non-OPV uptake in a lag of 3-5 days from the media exposure, in all vaccines except for MMR. Lower SES and non-Jewish subgroups did not demonstrate the same association. Our findings expand the understanding of public behaviour during outbreaks. The public response shows high variability within specific subgroups. These findings highlight the importance of tailored communication strategies for each subgroup. Copyright © 2018 Elsevier Ltd. All rights reserved.

  2. es

    Directory of Open Access Journals (Sweden)

    Esther Bernal Valls

    Full Text Available El uso de ejercicios en el tratamiento de pacientes con déficit vestibular crónico está incrementándose de forma notable, lo que evidencia que se trata de un procedimiento que resulta beneficioso para este tipo de pacientes. Los buenos resultados que se obtienen sugieren que los ejercicios vestibulares dan lugar a una estabilidad postural y a una disminución de la sensación de desequilibrio.

  3. ES-2 Dummy Biomechanical Responses.

    Science.gov (United States)

    Byrnes, Katie; Abramczyk, Joseph; Berliner, Jeff; Irwin, Annette; Jensen, Jack; Kowsika, Murthy; Mertz, Harold J; Rouhana, Stephen W; Scherer, Risa; Shi, Yibing; Sutterfield, Aleta; Xu, Lan; Tylko, Suzanne; Dalmotas, Dainius

    2002-11-01

    This technical paper presents the results of biomechanical testing conducted on the ES-2 dummy by the Occupant Safety Research Partnership and Transport Canada. The ES-2 is a production dummy, based on the EuroSID-1 dummy, that was modified to further improve testing capabilities as recommended by users of the EuroSID-1 dummy. Biomechanical response data were obtained by completing a series of drop, pendulum, and sled tests that are outlined in the International Organization of Standardization Technical Report 9790 that describes biofidelity requirements for the midsize adult male side impact dummy. A few of the biofidelity tests were conducted on both sides of the dummy to evaluate the symmetry of its responses. Full vehicle crash tests were conducted to verify if the changes in the EuroSID-1, resulting in the ES-2 design, did improve the dummy's testing capability. In addition to the biofidelity testing, the ES-2 dummy repeatability, reproducibility and durability are discussed. Finally, this technical paper will compare the biofidelity ratings of the current adult side impact dummies with the ES-2 dummy, which received an overall dummy biofidelity rating of 4.6.

  4. Left ventricular function abnormalities as a manifestation of silent myocardial ischemia.

    Science.gov (United States)

    Lambert, C R; Conti, C R; Pepine, C J

    1986-11-01

    A large body of evidence exists indicating that left ventricular dysfunction is a common occurrence in patients with severe coronary artery disease and represents silent or asymptomatic myocardial ischemia. Such dysfunction probably occurs early in the time course of every ischemic episode in patients with coronary artery disease whether symptoms are eventually manifested or not. The pathophysiology of silent versus symptomatic left ventricular dysfunction due to ischemia appears to be identical. Silent ischemia-related left ventricular dysfunction can be documented during spontaneous or stress-induced perturbations in the myocardial oxygen supply/demand ratio. It also may be detected by nitroglycerin-induced improvement in ventricular function or by salutary changes in wall motion following revascularization. Silent left ventricular dysfunction is a very early occurrence during ischemia and precedes electrocardiographic abnormalities. In this light, its existence should always be kept in mind when dealing with patients with ischemic heart disease. It can be hypothesized that because silent ischemia appears to be identical to ischemia with symptoms in a pathophysiologic sense, prognosis and treatment in both cases should be the same.

  5. Clinical study of correlation of pre-senile and senile depressive stage with silent cerebral infarction

    International Nuclear Information System (INIS)

    Fujikawa, Tokumi; Yamawaki, Shigeto; Fujita, Yasunobu; Shibata, Youko; Touhouda, Yoshikuni.

    1992-01-01

    The relationship between the pre-senile/senile depressive state and silent cerebral infarction was examined by MRI. Consecutive 56 depressive patients aged 50 years or older underwnt MRI. MRI revealed silent cerebral infarction in 60.3% of patients in whom depression occurred at the age of less than 65 years. The complication rate was significantly higher in these patients than the younger patients (60.9% vs 20%). Complications of silent cerebral infarction were found in 53.6% for patients in whom depression occurred at the age of less than 65 years and symptoms were deteriorated at the age of 65 years or older and in 100% for patients in whom it occurred at the age of 65 years or older and hospitalization was simultaneously required. These figures were remarkably higher than the age-related complication rate of silent cerebral infarction in non-depressive normal persons. This suggested that approximately half of depressive patients of pre-senile onset and majority of depressive patients of senile onset might have parenchymal involvement due to silent cerebral infarction. Both perforating-type and cortical-type infarcts were found. This has a implication for the involvement of multiple infarct-related foci in depressive state. For cortical-type infarcts, partial lesions were predominant, followed by frontal and temporal lesions. The incidence of left frontal infarcts was significanly higher than that of right frontal infarcts. Infarcts in both the parietal and left frontal lobes may be responsible for depressive state. (N.K.)

  6. The Right to Remain Silent in Criminal Trial

    Directory of Open Access Journals (Sweden)

    Gianina Anemona Radu

    2013-05-01

    Full Text Available A person's right not to incriminate oneself or to remain silent and not contribute to their own incrimination is a basic requirement of due process, although the right not to testify against oneself is not expressly guaranteed. This legal right is intended to protect the accused/ the defendant against the authorities’ abusive coercion. The scope of the right not to incriminate oneself is related to criminal matter under the Convention, and thus susceptible or applicable to criminal proceedings concerning all types of crimes as a guarantee to a fair trial. The European Court of Justice ruled that despite the fact that art. 6 paragraph 2 of the Convention does not expressly mention the right not to incriminate oneself and the right not to contribute to their own incrimination (nemo tenetur are ipsum accusare these are generally recognized international rules that are in consistence with the notion of “fair trial” stipulated in art. 6. By virtue of the right to silence, the person charged with a crime is free to answer the questions or not, as he/she believes it is in his/her interest. Therefore, the right to silence involves not only the right not to testify against oneself, but also the right of the accused/ defendant not to incriminate oneself. Thus, the accused/defendant cannot be compelled to assist in the production of evidence and cannot be sanctioned for failing to provide certain documents or other evidence. Obligation to testify against personal will, under the constraint of a fine or any other form of coercion constitutes an interference with the negative aspect of the right to freedom of expression which must be necessary in a democratic society. It is essential to clarify certain issues as far as this right is concerned. First of all, the statutory provision in question is specific to adversarial systems, which are found mainly in Anglo-Saxon countries and are totally different from that underlying the current Romanian Criminal

  7. STUDY OF IMMUNITY TO POLIOVIRUSES ON CERTAIN "SILENT" TERRITORIES OF RUSSIA

    Directory of Open Access Journals (Sweden)

    N. I. Romanenkova

    2011-01-01

    Full Text Available Abstract. The degree of immunity to polioviruses of three serotypes among children of different ages was analysed on certain "controlled" and "silent" territories of Russia in different periods of Polio Eradication Initiative. It was shown that the levels of immunity of children’s population to polioviruses on "controlled" and "silent" territories had no significant difference. It was stated that on the phase which preceded the certification for the absence of circulation of wild polioviruses, when the National Immunisation Days were conducted in the country, the percentage of eronegative children to polioviruses of different serotypes was low on all the territories of Russia. After Russia as a part of the WHO European region was certified as a polio free country and mass immunisation was stopped thepercentage of seronegative children increased, especially to poliovirus of serotype 3, both on the "controlled" and on the "silent" territories.

  8. Agreement of the silent partnership – tax and legal consequences of its conclusion and execution

    Directory of Open Access Journals (Sweden)

    Monika Zieniewicz

    2016-12-01

    Full Text Available The institution of the silent partnership is not currently regulated by any legal act in the Polish legal system, although its importance in practice is not in doubt. As every action made in the economic sphere and economic execution of the contract is associated with specific effects on the basis of the tax laws. However, due to the lack of statutory regulation of the institution of silent partnership problematic is the question of determining the effects of tax legislation. Therefore, special attention is needed to determine the issue of these effects on the basis of income tax, tax on goods and services, transfer tax and the tax on inheritance and donations, as well as the question of liability for the tax liabilities of the silent partnership.

  9. The clinical dilemma of "silent desensitization" in aspirin-exacerbated respiratory disease.

    Science.gov (United States)

    White, Andrew A; Bosso, John V; Stevenson, Donald D

    2013-01-01

    Aspirin desensitization is a treatment option for patients with aspirin-exacerbated respiratory disease (AERD). Some patients with an excellent history of aspirin or nonsteroidal anti-inflammatory drug (NSAID) reactions have negative aspirin challenges/desensitization. This study discusses the clinical entity of silent desensitization in AERD and the dilemma that this presents to the practicing allergist/immunologist. We discuss a series of patients with a strong history of NSAID reactions who initially underwent a negative challenge/silent desensitization. These patients were subsequently proven to have AERD after a second positive aspirin challenge. Silent desensitization is an uncommon but important outcome to recognize in AERD. Clinicians performing aspirin desensitization should understand that this can occur and consider a second confirmatory aspirin challenge in some patients.

  10. A Comparison of Reading Rates, Comprehension, and Stamina in Oral and Silent Reading of Fourth-Grade Students

    Science.gov (United States)

    Trainin, Guy; Hiebert, Elfrieda H.; Wilson, Kathleen M.

    2015-01-01

    This study examined the relationships between silent and oral reading fluency and comprehension. Findings indicated that fourth grade students had consistent levels of comprehension in both reading modes. Students of all reading levels showed a similar pattern across the segments of a text set in both oral and silent reading--a gradual increase in…

  11. Silent infarction on a second CT scan in 91 patients without manifest stroke in the Dutch TIA trial

    NARCIS (Netherlands)

    Herderscheê, D.; Hijdra, A.; Algra, A.; Kappelle, L. J.; Koudstaal, P. J.; van Gijn, J.

    1994-01-01

    The frequency of silent infarction is an important issue because it is a marker of vascular disease. We studied the occurrence of silent infarction in a sample of patients from the Dutch TIA trial, in which patients were randomized between 30 and 283 mg of aspirin. A total of 91 patients with TIA or

  12. Improvement of ozone yield by a multi-discharge type ozonizer using superposition of silent discharge plasma

    International Nuclear Information System (INIS)

    Song, Hyun-Jig; Chun, Byung-Joon; Lee, Kwang-Sik

    2004-01-01

    In order to improve ozone generation, we experimentally investigated the silent discharge plasma and ozone generation characteristics of a multi-discharge type ozonizer. Ozone in a multi-discharge type ozonizer is generated by superposition of a silent discharge plasma, which is simultaneously generated in separated discharge spaces. A multi-discharge type ozonizer is composed of three different kinds of superposed silent discharge type ozonizers, depending on the method of applying power to each electrode. We observed that the discharge period of the current pulse for a multi discharge type ozonizer can be longer than that of silent discharge type ozonizer with two electrodes and one gap. Hence, ozone generation is improved up to 17185 ppm and 783 g/kwh in the case of the superposed silent discharge type ozonizer for which an AC high voltages with a 180 .deg. phase difference were applied to the internal electrode and the external electrode, respectively, with the central electrode being grounded.

  13. Dual silent communication system development based on subvocal speech and Raspberry Pi

    Directory of Open Access Journals (Sweden)

    José Daniel Ramírez-Corzo

    2016-09-01

    Additionally, in this article we show the speech subvocal signals’ recording system realization. The average accuracy percentage was 72.5 %, and includes a total of 50 words by class, this is 200 signals. Finally, it demonstrated that using the Raspberry Pi it is possible to set a silent communication system, using subvocal. speech signals.

  14. Silent hepatitis E virus infection in Dutch blood donors, 2011 to 2012

    NARCIS (Netherlands)

    Slot, E.; Hogema, B. M.; Riezebos-Brilman, A.; Kok, T. M.; Molier, M.; Zaaijer, H. L.

    2013-01-01

    In Europe, the dynamics of endemic hepatitis E virus (HEV) infection remain enigmatic. We studied the presence of silent HEV infection among Dutch blood donors. Using donations collected throughout the Netherlands in 2011 and 2012, 40,176 donations were tested for HEV RNA in 459 pools of 48 or 480

  15. The Effect of Background Music While Silent Reading on EFL Learners’ Reading Comprehension

    Directory of Open Access Journals (Sweden)

    sakineh sahebdel

    2014-05-01

    Full Text Available This study attempted to determine the effect of background music while silent reading on Iranian EFL learners’ reading comprehension. The participants were 57 Iranian EFL learners between the ages of 14 and 16 in two 3rd grade high schoolclasses at pre-intermediate proficiency level. Before treatment,both experimental and control groups took a reading comprehension pretest. In the experimental group, the researchers played Mozart sonatas as background music and asked them to read the passage silently and then answer the reading comprehension questions. In the control group, the procedure was the same, but no music was played while silent reading by the students. After ten sessions, the students of both groups were asked to answer another independent but parallel form of reading section of PET as their post-test. The independent samples t-testresultsindicated that the experimental group outperformed the control group in reading comprehension posttest, and listening to background music while silent reading had a significantly positive effect on Iranian EFL learners’ reading comprehension. The results of the present study have implications for EFL students, teachers, and teacher educators as well as syllabus designers and materials developers.

  16. Characterisation of silent and active genes for a variable large protein of Borrelia recurrentis

    Directory of Open Access Journals (Sweden)

    Scragg Ian G

    2002-10-01

    Full Text Available Abstract Background We report the characterisation of the variable large protein (vlp gene expressed by clinical isolate A1 of Borrelia recurrentis; the agent of the life-threatening disease louse-borne relapsing fever. Methods The major vlp protein of this isolate was characterised and a DNA probe created. Use of this together with standard molecular methods was used to determine the location of the vlp1B. recurrentis A1 gene in both this and other isolates. Results This isolate was found to carry silent and expressed copies of the vlp1B. recurrentis A1 gene on plasmids of 54 kbp and 24 kbp respectively, whereas a different isolate, A17, had only the silent vlp1B. recurrentis A17 on a 54 kbp plasmid. Silent and expressed vlp1 have identical mature protein coding regions but have different 5' regions, both containing different potential lipoprotein leader sequences. Only one form of vlp1 is transcribed in the A1 isolate of B. recurrentis, yet both 5' upstream sequences of this vlp1 gene possess features of bacterial promoters. Conclusion Taken together these results suggest that antigenic variation in B. recurrentis may result from recombination of variable large and small protein genes at the junction between lipoprotein leader sequence and mature protein coding region. However, this hypothetical model needs to be validated by further identification of expressed and silent variant protein genes in other B. recurrentis isolates.

  17. Origin of the low-level EMG during the silent period following transcranial magnetic stimulation

    DEFF Research Database (Denmark)

    Butler, Jane E; Petersen, Nicolas C; Herbert, Robert D

    2012-01-01

    OBJECTIVE: The cortical silent period refers to a period of near silence in the electromyogram (EMG) after transcranial magnetic stimulation (TMS) of the motor cortex during contraction. However, low-level EMG of unknown origin is often present. We hypothesised that it arises through spinal...

  18. Silent Films and Strange Stories: Theory of Mind, Gender, and Social Experiences in Middle Childhood

    Science.gov (United States)

    Devine, Rory T.; Hughes, Claire

    2013-01-01

    In this study of two hundred and thirty 8- to 13-year-olds, a new "Silent Films" task is introduced, designed to address the dearth of research on theory of mind in older children by providing a film-based analogue of F. G. E. Happe's (1994) Strange Stories task. Confirmatory factor analysis showed that all items from both tasks loaded…

  19. Veratridine activates a silent sodium-channel in rat isolated aorta

    NARCIS (Netherlands)

    WERMELSKIRCHEN, D; WILFFERT, B; NEBEL, U; LEIDIG, A; WIRTH, A; Peters, Thies

    1992-01-01

    To investigate the existence of silent Na+ channels, isolated rat aorta was treated with veratridine (0.1 mM) and the resulting Ca2+ uptake was determined. After 30-min incubation the total tissue uptake of Ca2+ and Ca2+ uptake increased from 2.325 +/- 0.017 to 2.614 +/- 0.080 nmol/mg wet weight

  20. Cervical Cancer as a silent killer: A rare case report with review of literature

    Directory of Open Access Journals (Sweden)

    Deeksha Pandey

    2015-01-01

    Full Text Available Advanced-stage cervical cancer almost always presents either with abnormal vaginal bleeding or with foul-smelling vaginal discharge. We present here a rare case, where a postmenopausal lady presented almost silently with stage IVA cervical cancer. Fortunately, timely referral, correct diagnosis, and multispecialty team work could save her life.

  1. Direct and Indirect Effects of Print Exposure on Silent Reading Fluency

    Science.gov (United States)

    Mano, Quintino R.; Guerin, Julia M.

    2018-01-01

    Print exposure is an important causal factor in reading development. Little is known, however, of the mechanisms through which print exposure exerts an effect onto reading. To address this gap, we examined the direct and indirect effects of print exposure on silent reading fluency among college students (n = 52). More specifically, we focused on…

  2. BOOK REVIEW: ARE YOU AN ADVOCATE, TACIT SUPPORTER, CRITICAL SKEPTIC, OR SILENT SKEPTIC?

    Science.gov (United States)

    "Silent Sperm," "You're not half the man your grandfather was," "Assault on the Male," "Gender Benders,"-perhaps no other public health concern has given rise to the number of memorable sound bites than has the issue of whether environmental contaminants are causing adverse healt...

  3. Measuring the cortical silent period can increase diagnostic confidence for amyotrophic lateral sclerosis.

    NARCIS (Netherlands)

    Schelhaas, H.J.; Arts, I.M.P.; Overeem, S.; Houtman, C.J.; Janssen, H.; Kleine, B.U.; Munneke, M.; Zwarts, M.J.

    2007-01-01

    We evaluated a modified measurement of the cortical silent period (CSP) as a simple procedure to add further confidence in the diagnostic work-up for ALS. Thirty-seven consecutive patients with a suspicion of having ALS were included together with 25 healthy volunteers, and followed until a final

  4. Definition dependent properties of the cortical silent period in upper-extremity muscles, a methodological study

    NARCIS (Netherlands)

    Kuijk, A.A. van; Bakker, C.D.; Hendriks, J.C.M.; Geurts, A.C.; Stegeman, D.F.; Pasman, J.W.

    2014-01-01

    BACKGROUND: To explore if stimulus-response (S-R) characteristics of the silent period (SP) after transcranial magnetic stimulation (TMS) are affected by changing the SP definition and by changing data presentation in healthy individuals. This information would be clinically relevant to predict

  5. Definition dependent properties of the cortical silent period in upper-extremity muscles, a methodological study

    NARCIS (Netherlands)

    van Kuijk, A.A.; Bakker, C,; Hendriks, J.J.A.; Geurts, A.H.; Stegeman, D.F.; Pasman, J.W.

    2014-01-01

    Background: To explore if stimulus-response (S-R) characteristics of the silent period (SP) after transcranial magnetic stimulation (TMS) are affected by changing the SP definition and by changing data presentation in healthy individuals. This information would be clinically relevant to predict

  6. Neural responses to silent lipreading in normal hearing male and female subjects

    NARCIS (Netherlands)

    Ruytjens, Liesbet; Albers, Frans; van Dijk, Pim; Wit, Hero; Willemsen, Antoon

    In the past, researchers investigated silent lipreading in normal hearing subjects with functional neuroimaging tools and showed how the brain processes visual stimuli that are normally accompanied by an auditory counterpart. Previously, we showed activation differences between males and females in

  7. Scintigraphic diagnosis of silent aspiration following double-sided lung transplantation

    International Nuclear Information System (INIS)

    Toenshoff, G.; Stock, U.; Bohuslavizki, K.H.; Brenner, W.; Costard-Jaeckle, A.; Cremer, J.; Clausen, M.

    1996-01-01

    We present a case of a 25 year old patient who underwent double-sided lung transplantation and suffered from recurrent pneumonia. Silent aspiration was suspected clinically. Aspiration was proved by scintigraphy enabling to discriminate between direct oro-pulmonal aspiration and aspiration after gastro-esophageal reflux. (orig.) [de

  8. Whatever Happened to the Silent Scientific Revolution?--Research, Theory and Practice in Distance Education.

    Science.gov (United States)

    Morgan, Alistair

    The point of departure for this article is the title of a book edited by David Fetterman, "Qualitative Approaches to Educational Evaluation--The Silent Scientific Revolution." This article addresses the question of how the shift to a qualitative, phenomenological approach has impinged on research and evaluation in distance education.…

  9. El duelo es un trabajo

    OpenAIRE

    Mesa, Clara Cecilia

    2012-01-01

    Esta pregunta por lo nuevo en la atención en duelo invita a pensar en varias direcciones: qué hay de nuevo como oferta médica para ayudar a soportar la situación de pérdida que el duelo arrastra consigo, por un lado, pero por otro, qué hay de nuevo en el duelo? Es difícil saber si las condiciones de elaboración del duelo se modifican con las particularidades de una época o con las particularidades propias de cada modalidad de sufrimiento, igualmente existe una tesis que afirma que nuestra épo...

  10. El duelo es un trabajo

    Directory of Open Access Journals (Sweden)

    Clara Cecilia Mesa

    2001-02-01

    Full Text Available Esta pregunta por lo nuevo en la atención en duelo invita a pensar en varias direcciones: qué hay de nuevo como oferta médica para ayudar a soportar la situación de pérdida que el duelo arrastra consigo, por un lado, pero por otro, qué hay de nuevo en el duelo? Es difícil saber si las condiciones de elaboración del duelo se modifican con las particularidades de una época o con las particularidades propias de cada modalidad de sufrimiento, igualmente existe una tesis que afirma que nuestra época no es ya la época de la muerte romántica más bien que la condición de guerra haría a su vez que las
    coordenadas del duelo podrían pensarse de manera distinta, sin embargo detrás de lo nuevo siempre encontramos lo viejo: la muerte. Parafraseando el último verso de “Las Flores del Mal” de Baudelaire:

  11. Natural(es) remisión de V. ciencias natural(es).

    OpenAIRE

    2011-01-01

    [ES] Definición del término Natural(es) remisión de V. ciencias natural(es). en el diccionario Dicter. [EN] Definition of the word Natural(es) remisión de V. ciencias natural(es). in the dictionary Dicter.

  12. Silent Atrial Fibrillation in Elderly Pacemaker Users: A Randomized Trial Using Home Monitoring.

    Science.gov (United States)

    Lima, Ceb; Martinelli, M; Peixoto, G L; Siqueira, S F; Wajngarten, Maurício; Silva, Rodrigo Tavares; Costa, Roberto; Filho, Roberto; Ramires, José Antônio Franchini

    2016-05-01

    Pacemaker with remote monitoring (PRM) may be useful for silent atrial fibrillation (AF) detection. The aims of this study were to evaluate the incidence of silent AF, the role of PRM, and to determine predictors of silent AF occurrence. Three hundred elderly patients with permanent pacemaker (PPM) were randomly assigned to the remote group (RG) or control group (CG). All patients received PPM with remote monitoring capabilities. Primary end point was AF occurrence rate and the secondary end points were time to AF detection and number of days with AF. During the average follow-up of 15.7±7.7 months, AF episodes were detected in 21.6% (RG = 24% vs CG = 19.3%, P = 0.36]. There was no difference in the time to detect the first AF episode. However, the median time to detect AF recurrence in the RG was lower than that in the CG (54 days vs 100 days, P = 0.004). The average number of days with AF was 16.0 and 51.2 in the RG and CG, respectively (P = 0.028). Predictors of silent AF were left atrial diameter (odds ratio [OR] 1.2; 95% CI = 1.1-1.3; P pacemaker; left atrial diameter and diastolic dysfunction were predictors of its occurrence. AF monitoring by means of pacemaker is a valuable tool for silent AF detection and continuous remote monitoring allows early AF recurrence detection and reduces the number of days with AF. © 2015 Wiley Periodicals, Inc.

  13. In Situ Vitrification Engineering-Scale Test ES-INEL-4, ES-INEL-5, ES-INEL-6, and ES-INEL-7 Test Plan

    International Nuclear Information System (INIS)

    Weidner, J.R.; Stoots, P.R.

    1990-10-01

    The In Situ Vitrification Engineering-Scale Tests ES-4, ES-5, ES-6, and ES-7 Product Characterization Test Plan describes the methods and procedures to be used or the physical and chemical characterization of the solid product(s) resulting from the Idaho National Engineering Laboratory engineering scale in situ vitrification tests ES-4, ES-5, ES-6, and ES-7. The goals of this Test Plan are to insure that the product characterization results are sufficient to meet the data needs of the In Situ Vitrification Program and are technically and legally defensible. Important issues addressed by the test plan include sampling and analysis strategy, sampling procedures, laboratory analysis, sample control and document management, equipment, data reporting and validation, quality assurance, specific routine procedures to assess data representativeness, safety and training program, and data management. 9 refs., 1 fig., 3 tabs

  14. Religions mondialisées.

    Directory of Open Access Journals (Sweden)

    Sébastien Fath

    2002-05-01

    Full Text Available « Dès le début de l’histoire, les croyances religieuses manifestent une tendance à ne pas se renfermer dans une société politique étroitement délimitée : il y a en elles comme une aptitude naturelle à passer par-dessus les frontières, à se diffuser, à s’internationaliser ». Ces réflexions d’Émile Durkheim, extraites des Formes élémentaires de la vie religieuse , sont placées en exergue de l’ouvrage d’Ariel Colonomos consacré aux « Églises en réseau ». ...

  15. stockées Ephestia kuehniella (Lepidoptera)

    African Journals Online (AJOL)

    PR BOKO

    de Rebat (2008). [5] - B. DOUMANDJI-MITICHI. Etude d'un ravageur des denrées stockées E. Kuehiella, Am.El Harrach. (1997). [6] - F. TAIBI. Etude comparée du développement et de la reproduction chez deux ravageurs des denrées stockées Ephestia Kuehniella et Tenebrio molitor. Aspect endocrinien en rapport avec.

  16. Pensées intimes

    CERN Document Server

    Einstein, Albert

    2000-01-01

    A quelqu'un qui lui demandant pourquoi les hommes pouvaient découvrir les atomes, mais pas les moyens de les contrôler, Einstein répondit : " C'est simple, mon ami : parce que la politique est plus difficile que la physique ". Albert Einstein était un écrivain prolifique dont l'œuvre abonde en aphorismes. Les 550 citations de ce recueil, tirées des quelque 40 000 documents des Archives Einstein, nous font découvrir le Einstein de la légende, l'ami des écoliers et des étudiants fauchés, le philosophe de la vie quotidienne, doux et ironique, mais aussi la face plus sombre, parfois désespérée, de ce grand génie de l'ère moderne. Qu'il s'exprime sur des sujets aussi variés que l'Amérique et les Américains, l'Allemagne et les Allemands, les Juifs et le sionisme, la guerre et le pacifisme, la politique, la religion et la science, ou sur des thèmes plus personnels, tels que l'amour et le mariage, la jeunesse et la vieillesse l'avortement ou l'homosexualité, ses propos restent toujours mordants,...

  17. An investigation of the reduction of carbon dioxide in a silent electric discharge

    Science.gov (United States)

    Luce, R. S.; Greenough, B. (Editor)

    1978-01-01

    The reduction of CO2 to O2 and CO in a silent electric discharge was studied. It was found that current alone (in the ionized plasma induced by the silent electric discharge) was reponsible for the CO2 reduction process. Voltage and frequency were important only in so far as they induced current in the plasma. Pressure and temperature were of minimum influence in the process. The large power consumption in the process was recognized as resulting from the low power factor of the reactor vessel which electrically behaved like a capacitor. The power factor was subsequently improved by adding an inductive element to make the reactor vessel capacitance part of a resonant circuit. It was found that the CO2 reduction process was most efficient in terms of power vs reduction rate when a voltage was employed that was only slightly higher than that needed to induce the plasma.

  18. When Spiders Bite: The Use, Misuse, and Unintended Consequences of ``Silent Information''

    Science.gov (United States)

    Keenan, Thomas P.

    Spiders are the workhorses of the Internet, silently (and almost invisibly) traversing the online world, 24 hours a day, looking for information that may be of interest to someone. It is being archived, organized, and sold, usually without the knowledge or consent of the subject of the information. Serious consequences are starting to appear, such as the withdrawal of three candidates from the October 2008 Canadian Federal election because of previous online indiscretions. While these were intentional if mis-guided postings, information made available without our consent can have equally devastating effects. Advances in artificial intelligence, as well as the increasing tendency to post more and more information, such as videos, will make the gathering, aggregation, and republishing of this “silent information” an increasingly important issue that must be addressed from the technical, social, ethical and legal perspectives, and sooner rather than later.

  19. Dynamic wind turbine models in power system simulation tool DIgSILENT

    DEFF Research Database (Denmark)

    Hansen, Anca Daniela; Iov, F.; Sørensen, Poul Ejnar

    , connection of the wind turbine at different types of grid and storage systems. Different control strategies have been developed and implemented for these wind turbine concepts, their performance in normal or fault operation being assessed and discussed by means of simulations. The described control......This report presents a collection of models and control strategies developed and implemented in the power system simulation tool PowerFactory DIgSILENT for different wind turbine concepts. It is the second edition of Risø-R-1400(EN) and it gathers and describes a whole wind turbine model database...... of the interaction between the mechanical structure of the wind turbine and the electrical grid during different operational modes. The report provides thus a description of the wind turbines modelling, both at a component level and at a system level. The report contains both the description of DIgSILENT built...

  20. Typical and atypical (silent) subacute thyroiditis in a wife and husband

    International Nuclear Information System (INIS)

    Morrison, J.; Caplan, R.H.

    1978-01-01

    Typical subacute thyroiditis was diagnosed in a woman. Three weeks later, signs and symptoms of hyperthyroidism developed in her husband. Although the right lobe of his thyroid gland was slightly enlarged, pain and tenderness were absent throughout the course of his illness. The free thyroxine equivalent (FTE) value and the sedimentation rate were elevated; the low uptake of radioactive iodine by the thyroid gland was consistent with ''silent'' subacute thyroiditis. We postulate that a common etiology, probably viral, was operative in both cases. Nine additional cases of hyperthyroidism with low levels of thyroidal uptake of radioactive iodine are described. The thyroid glands of these patients were normal or slightly enlarged. Antithyroglobulin antibody levels determined in seven patients were not substantially elevated. The clinical course of these patients was characteristic of ''silent'' subacute thyroiditis. Although the origin of the syndrome remains unclear, the disease is self-limited and therapy, if any, is supportive

  1. Typical and atypical (silent) subacute thyroiditis in a wife and husband

    Energy Technology Data Exchange (ETDEWEB)

    Morrison, J.; Caplan, R.H.

    1978-01-01

    Typical subacute thyroiditis was diagnosed in a woman. Three weeks later, signs and symptoms of hyperthyroidism developed in her husband. Although the right lobe of his thyroid gland was slightly enlarged, pain and tenderness were absent throughout the course of his illness. The free thyroxine equivalent (FTE) value and the sedimentation rate were elevated; the low uptake of radioactive iodine by the thyroid gland was consistent with ''silent'' subacute thyroiditis. We postulate that a common etiology, probably viral, was operative in both cases. Nine additional cases of hyperthyroidism with low levels of thyroidal uptake of radioactive iodine are described. The thyroid glands of these patients were normal or slightly enlarged. Antithyroglobulin antibody levels determined in seven patients were not substantially elevated. The clinical course of these patients was characteristic of ''silent'' subacute thyroiditis. Although the origin of the syndrome remains unclear, the disease is self-limited and therapy, if any, is supportive.

  2. Psychosis and Silent Celiac Disease in a Down Syndrome Adolescent: A Case Report

    Directory of Open Access Journals (Sweden)

    Amparo Morant

    2011-01-01

    Full Text Available Celiac disease is an autoimmune systemic disorder. It presents gastrointestinal and nongastrointestinal manifestations as well as associated conditions. We report a 16-year-old Down syndrome girl who presented psychosis symptomatology, and she was diagnosed as having silent celiac disease. Olanzapine treatment and gluten-free diet were satisfactory. It is necessary to consider celiac disease in Down syndrome patients with psychiatric symptoms, mainly psychotic symptomatology.

  3. Silent reading of music and texts; eye movements and integrative reading mechanisms

    OpenAIRE

    Cara, Michel André; Gómez, Gabriela

    2016-01-01

    This study investigates to what extent structural units defined by physical and structural markers elicit different eye movement patterns when reading contrasting stimuli of music and verbal texts. Eye movements were tracked and compared in ten musicians undergoing Bachelor’s degrees as they silently read six texts and six pieces of music for piano: the music was contemporary, in modal style, and the style of the texts was informative and literary. Participants were music students at Universi...

  4. Harmonic Domain Modelling of Transformer Core Nonlinearities Using the DIgSILENT PowerFactory Software

    OpenAIRE

    Bak, Claus Leth; Bak-Jensen, Birgitte; Wiechowski, Wojciech

    2008-01-01

    This paper demonstrates the results of implementation and verification of an already existing algorithm that allows for calculating saturation characteristics of singlephase power transformers. The algorithm was described for the first time in 1993. Now this algorithm has been implemented using the DIgSILENT Programming Language (DPL) as an external script in the harmonic domain calculations of a power system analysis tool PowerFactory [10]. The algorithm is verified by harmonic measurements ...

  5. Dynamic wind turbine models in power system simulation tool DIgSILENT

    OpenAIRE

    Hansen, A.D.; Jauch, C.; Sørensen, Poul Ejnar; Iov, F.; Blaabjerg, F.

    2004-01-01

    The present report describes the dynamic wind turbine models implemented in the power system simulation tool DIgSILENT (Version 12.0). The developed models are a part of the results of a national research project, whose overall objective is to create amodel database in different simulation tools. This model database should be able to support the analysis of the interaction between the mechanical structure of the wind turbine and the electrical grid during different operational modes. The repo...

  6. Cumulus-specific genes are transcriptionally silent following somatic cell nuclear transfer in a mouse model*

    OpenAIRE

    Tong, Guo-qing; Heng, Boon-chin; Ng, Soon-chye

    2007-01-01

    This study investigated whether four cumulus-specific genes: follicular stimulating hormone receptor (FSHr), hyaluronan synthase 2 (Has2), prostaglandin synthase 2 (Ptgs2) and steroidogenic acute regulator protein (Star), were correctly reprogrammed to be transcriptionally silent following somatic cell nuclear transfer (SCNT) in a murine model. Cumulus cells of C57×CBA F1 female mouse were injected into enucleated oocytes, followed by activation in 10 µmol/L strontium chloride for 5 h and sub...

  7. Direct speech quotations promote low relative-clause attachment in silent reading of English.

    Science.gov (United States)

    Yao, Bo; Scheepers, Christoph

    2018-07-01

    The implicit prosody hypothesis (Fodor, 1998, 2002) proposes that silent reading coincides with a default, implicit form of prosody to facilitate sentence processing. Recent research demonstrated that a more vivid form of implicit prosody is mentally simulated during silent reading of direct speech quotations (e.g., Mary said, "This dress is beautiful"), with neural and behavioural consequences (e.g., Yao, Belin, & Scheepers, 2011; Yao & Scheepers, 2011). Here, we explored the relation between 'default' and 'simulated' implicit prosody in the context of relative-clause (RC) attachment in English. Apart from confirming a general low RC-attachment preference in both production (Experiment 1) and comprehension (Experiments 2 and 3), we found that during written sentence completion (Experiment 1) or when reading silently (Experiment 2), the low RC-attachment preference was reliably enhanced when the critical sentences were embedded in direct speech quotations as compared to indirect speech or narrative sentences. However, when reading aloud (Experiment 3), direct speech did not enhance the general low RC-attachment preference. The results from Experiments 1 and 2 suggest a quantitative boost to implicit prosody (via auditory perceptual simulation) during silent production/comprehension of direct speech. By contrast, when reading aloud (Experiment 3), prosody becomes equally salient across conditions due to its explicit nature; indirect speech and narrative sentences thus become as susceptible to prosody-induced syntactic biases as direct speech. The present findings suggest a shared cognitive basis between default implicit prosody and simulated implicit prosody, providing a new platform for studying the effects of implicit prosody on sentence processing. Copyright © 2018 Elsevier B.V. All rights reserved.

  8. Risk factors associated with the occurrence of silent pulmonary embolism in patients with deep venous thrombosis of the lower limb.

    Science.gov (United States)

    Li, Fenghe; Wang, Xuehu; Huang, Wen; Ren, Wei; Cheng, Jun; Zhang, Mao; Zhao, Yu

    2014-08-01

    The aim of our study is to investigate the prevalence of silent pulmonary embolism in patients with deep venous thrombosis in the lower limbs and to evaluate the associated risk factors. A total of 322 patients with acute deep venous thrombosis confirmed by CT venography or Doppler ultrasonography were studied. The diagnosis of silent pulmonary embolism was established by computed tomography pulmonary arteriography (CTPA). The association between covariates and the prevalence of silent pulmonary embolism in patients with deep venous thrombosis in lower limbs were assessed using chi-square test and multivariable regression. The incidence of silent pulmonary embolism was 33.5% (108 in 322 patients) in all patients with deep venous thrombosis in lower limbs. Chi-square test showed male gender, the right lower limb, proximal location of the thrombus, unprovoked venous thrombosis and coexisting heart diseases were related to a higher incidence of silent pulmonary embolism in patients with deep venous thrombosis in lower limbs. The multivariate regression analysis confirmed that the risk factors associated with silent pulmonary embolism in deep venous thrombosis patients included the right side and proximal location of the thrombus (odds ratio: 2.023, 95% CI: 1.215-3.368; odds ratio: 3.610, 95% CI: 1.772-7.354), unprovoked venous thrombosis (odds ratio: 2.037, 95% CI: 1.188-3.493), coexisting heart diseases (odds ratio: 4.507, 95% CI: 2.667-7.618). Silent pulmonary embolism occurred frequently in patients with deep venous thrombosis in lower limbs. The right side, the proximal location of the thrombus, unprovoked venous thrombosis and coexisting heart diseases increased the risk for the occurrence of silent pulmonary embolism. © The Author(s) 2013 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

  9. Gated single photon emission computer tomography for the detection of silent myocardial ischemia

    International Nuclear Information System (INIS)

    Pena Q, Yamile; Coca P, Marco Antonio; Batista C, Juan Felipe; Fernandez-Britto, Jose; Quesada P, Rodobaldo; Pena C; Andria

    2009-01-01

    Background: Asymptomatic patients with severe coronary atherosclerosis may have a normal resting electrocardiogram and stress test. Aim: To assess the yield of Gated Single Photon Emission Computer Tomography (SPECT) for the screening of silent myocardial ischemia in type 2 diabetic patients. Material and methods: Electrocardiogram, stress test and gated-SPECT were performed on 102 type 2 diabetic patients aged 60 ± 8 years without cardiovascular symptoms. All subjects were also subjected to a coronary angiography, whose results were used as gold standard. Results: Gated-SPECT showed myocardial ischemia on 26.5% of studied patients. The sensibility, specificity, accuracy, positive predictive value and negative predictive value were 92.3%, 96%, 95%, 88.8%, 97.3%, respectively. In four and six patients ischemia was detected on resting electrocardiogram and stress test, respectively. Eighty percent of patients with doubtful resting electrocardiogram results and 70% with a doubtful stress test had a silent myocardial ischemia detected by gated-SPECT. There was a good agreement between the results of gated-SPECT and coronary angiography (k =0.873). Conclusions: Gated-SPECT was an useful tool for the screening of silent myocardial ischemia

  10. The prevalence and the clinical characteristics of silent myocardial ischemia detected by stress thallium scintigraphy

    International Nuclear Information System (INIS)

    Matsuo, Hitoshi; Watanabe, Sachiro; Nishida, Yoshio

    1992-01-01

    The prevalence of silent myocardial ischemia was retrospectively assessed in a group of 100 consecutive patients with angiographically proved coronary artery disease, and diagnostic ECG, by symptom-limited exercise thallium-201 scintigraphy. Twenty-four patients had no evidence of ischemia despite adequate exercise level. So among 76 patients with exercise induced ischemia, only 33 patients (43%) stopped exercise due to anginal pain (symptomatic ischemia: Group 3). And 43 patients with asymptomatic ischemia composed of 23 patients (30%) with ECG change (Group 2B) and 20 patients (26%) without ECG change (Group 2A). Patients background including the history of old myocardial infarction and diabetes mellitus, were similar among Group 2A, 2B, and Group 3. Our Major observation was that the extent and severity of quantified SPECT perfusion defects was nearly identified between 3 groups. Thus in this study group, there was a rather high prevalence rate of silent ischemia (57%) by exercise thallium-201 criteria. Patients with silent ischemia, associated with positive and negative exercise ECG findings, and those with exercise angina had similar background and comparable amount of jeopardized myocardium. (author)

  11. Detecting Silent Data Corruption for Extreme-Scale Applications through Data Mining

    Energy Technology Data Exchange (ETDEWEB)

    Bautista-Gomez, Leonardo [Argonne National Lab. (ANL), Argonne, IL (United States); Cappello, Franck [Argonne National Lab. (ANL), Argonne, IL (United States)

    2014-01-16

    Supercomputers allow scientists to study natural phenomena by means of computer simulations. Next-generation machines are expected to have more components and, at the same time, consume several times less energy per operation. These trends are pushing supercomputer construction to the limits of miniaturization and energy-saving strategies. Consequently, the number of soft errors is expected to increase dramatically in the coming years. While mechanisms are in place to correct or at least detect some soft errors, a significant percentage of those errors pass unnoticed by the hardware. Such silent errors are extremely damaging because they can make applications silently produce wrong results. In this work we propose a technique that leverages certain properties of high-performance computing applications in order to detect silent errors at the application level. Our technique detects corruption solely based on the behavior of the application datasets and is completely application-agnostic. We propose multiple corruption detectors, and we couple them to work together in a fashion transparent to the user. We demonstrate that this strategy can detect the majority of the corruptions, while incurring negligible overhead. We show that with the help of these detectors, applications can have up to 80% of coverage against data corruption.

  12. Harmony hurts: participation and silent conflict at an Indonesian fish pond.

    Science.gov (United States)

    Tam, Chui-Ling

    2006-07-01

    Participatory environmental and resource management is premised on open communication to reach consensus. However, deliberate and open communication cannot adequately address silent conflict. This begs two questions. First, how is the existence of covert communication and silent conflict to be recognized and addressed? Second, how are the wider social relations and traditions that encompass communication and conflict to be described and explained? These questions revolve around communicative power. Communication of environmental knowledge is deeply embedded in social power structures, with direct implications for participatory resource planning and implementation. Ethnographic research conducted at a failed community-managed fish farming project in Southeast Sulawesi, Indonesia shows that a culture of harmony and respect for authority can silence environmental conflict in the hierarchical "community." Three propositions are offered. First, communication amnesia and exclusion jeopardize participation. Second, cultures of harmony and silent conflict shape planning processes and outcomes. Third, the weak use manipulation and communication strategy to acquire a "voice" while preserving harmony. These propositions address five unresolved issues in participatory resource management: analysis of groups, contextuality, social relationships, nonparticipants, and informal communication. Power, tradition, and social networks affect the valuing of knowledge relative to the power of different individuals and institutions to communicate priorities, values, and needs. These factors are critical to the inclusion of both participants and nonparticipants.

  13. Silent and a audible stereotypes: The constitution of "ethnic character" in Serbian epic poetry

    Directory of Open Access Journals (Sweden)

    Đerić Gordana

    2005-01-01

    Full Text Available The article deals with the explanatory relevance of the concept of stereotype in one of its original meanings - as a "mental image". This meaning of the term is the starting point for further differentiations, such as: between linguistic and behavioral stereotypes (in the sense of nonverbal, expected responses; universal and particular stereotypes; self representative and introspective stereotypes; permanent and contemporary stereotypes; and finally, what is most important for our purposes, the difference between silent and audible stereotypes. These distinctions, along with the functions of stereotype, are discussed in the first part of the paper. In the second part, the relations of silent and audible stereotypes are tested against the introduction of "innovative vocabularies" in popular lore. In other words, the explanatory power of this differentiation is checked through an analysis of unconventional motives in Serbian epic poems. The goal of the argument is to clarify the procedure of self creation of masculinity as a relevant feature of the "national character" through "tactic games" of silent and audible stereotypes. The examination of these "poetic strategies" serves a twofold purpose: to illustrate the process of constructing particular features of the "ethno type", on one hand, and to check hypotheses and models which are taken as frameworks in analyzing stereotypes, on the other.

  14. Estimation of cortical silent period following transcranial magnetic stimulation using a computerised cumulative sum method.

    Science.gov (United States)

    King, Nicolas K K; Kuppuswamy, Annapoorna; Strutton, Paul H; Davey, Nick J

    2006-01-15

    The cortical silent period (CSP) following transcranial magnetic stimulation (TMS) of the motor cortex can be used to measure intra-cortical inhibition and changes in a number of important pathologies affecting the central nervous system. The main drawback of this technique has been the difficulty in accurately identifying the onset and offset of the cortical silent period leading to inter-observer variability. We developed an automated method based on the cumulative sum (Cusum) technique to improve the determination of the duration and area of the cortical silent period. This was compared with experienced raters and two other automated methods. We showed that the automated Cusum method reliably correlated with the experienced raters for both duration and area of CSP. Compared with the automated methods, the Cusum also showed the strongest correlation with the experienced raters. Our results show the Cusum method to be a simple, graphical and powerful method of detecting low-intensity CSP that can be easily automated using standard software.

  15. Silent reading of direct versus indirect speech activates voice-selective areas in the auditory cortex.

    Science.gov (United States)

    Yao, Bo; Belin, Pascal; Scheepers, Christoph

    2011-10-01

    In human communication, direct speech (e.g., Mary said: "I'm hungry") is perceived to be more vivid than indirect speech (e.g., Mary said [that] she was hungry). However, for silent reading, the representational consequences of this distinction are still unclear. Although many of us share the intuition of an "inner voice," particularly during silent reading of direct speech statements in text, there has been little direct empirical confirmation of this experience so far. Combining fMRI with eye tracking in human volunteers, we show that silent reading of direct versus indirect speech engenders differential brain activation in voice-selective areas of the auditory cortex. This suggests that readers are indeed more likely to engage in perceptual simulations (or spontaneous imagery) of the reported speaker's voice when reading direct speech as opposed to meaning-equivalent indirect speech statements as part of a more vivid representation of the former. Our results may be interpreted in line with embodied cognition and form a starting point for more sophisticated interdisciplinary research on the nature of auditory mental simulation during reading.

  16. Detection of silent cells, synchronization and modulatory activity in developing cellular networks.

    Science.gov (United States)

    Hjorth, Johannes J J; Dawitz, Julia; Kroon, Tim; Pires, Johny; Dassen, Valerie J; Berkhout, Janna A; Emperador Melero, Javier; Nadadhur, Aish G; Alevra, Mihai; Toonen, Ruud F; Heine, Vivi M; Mansvelder, Huibert D; Meredith, Rhiannon M

    2016-04-01

    Developing networks in the immature nervous system and in cellular cultures are characterized by waves of synchronous activity in restricted clusters of cells. Synchronized activity in immature networks is proposed to regulate many different developmental processes, from neuron growth and cell migration, to the refinement of synapses, topographic maps, and the mature composition of ion channels. These emergent activity patterns are not present in all cells simultaneously within the network and more immature "silent" cells, potentially correlated with the presence of silent synapses, are prominent in different networks during early developmental periods. Many current network analyses for detection of synchronous cellular activity utilize activity-based pixel correlations to identify cellular-based regions of interest (ROIs) and coincident cell activity. However, using activity-based correlations, these methods first underestimate or ignore the inactive silent cells within the developing network and second, are difficult to apply within cell-dense regions commonly found in developing brain networks. In addition, previous methods may ignore ROIs within a network that shows transient activity patterns comprising both inactive and active periods. We developed analysis software to semi-automatically detect cells within developing neuronal networks that were imaged using calcium-sensitive reporter dyes. Using an iterative threshold, modulation of activity was tracked within individual cells across the network. The distribution pattern of both inactive and active, including synchronous cells, could be determined based on distance measures to neighboring cells and according to different anatomical layers. © 2015 Wiley Periodicals, Inc.

  17. Silent cerebral infarction, income, and grade retention among students with sickle cell anemia

    Science.gov (United States)

    King, Allison A.; Rodeghier, Mark J.; Panepinto, Julie Ann; Strouse, John J.; Casella, James F.; Quinn, Charles T.; Dowling, Michael M.; Sarnaik, Sharada A.; Thompson, Alexis A.; Woods, Gerald M.; Minniti, Caterina P.; Redding-Lallinger, Rupa C.; Kirby-Allen, Melanie; Kirkham, Fenella J.; McKinstry, Robert; Noetzel, Michael J.; White, Desiree A.; Kwiatkowski, Janet K.; Howard, Thomas H.; Kalinyak, Karen A.; Inusa, Baba; Rhodes, Melissa M.; Heiny, Mark E.; Fuh, Ben; Fixler, Jason M.; Gordon, Mae O.; DeBaun, Michael R.

    2014-01-01

    Children with sickle cell anemia have a higher-than-expected prevalence of poor educational attainment. We test two key hypotheses about educational attainment among students with sickle cell anemia, as measured by grade retention and use of special education services: (1) lower household per capita income is associated with lower educational attainment; (2) the presence of a silent cerebral infarct is associated with lower educational attainment. We conducted a multicenter, cross-sectional study of cases from 22 U.S. sites included in the Silent Infarct Transfusion Trial. During screening, parents completed a questionnaire that included sociodemographic information and details of their child’s academic status. Of 835 students, 670 were evaluable; 536 had data on all covariates and were used for analysis. The students’ mean age was 9.4 years (range: 5–15) with 52.2% male; 17.5% of students were retained one grade level and 18.3% received special education services. A multiple variable logistic regression model identified that lower household per capita income (odds ratio [OR] of quartile 1 = 6.36, OR of quartile 2 = 4.7, OR of quartile 3 = 3.87; P = 0.001 for linear trend), age (OR = 1.3; P sickle cell anemia, household per capita income is associated with grade retention, whereas the presence of a silent cerebral infarct is not. Future educational interventions will need to address both the medical and socioeconomic issues that affect students with sickle cell anemia. PMID:25042018

  18. El mundo es un paisaje sonoro

    OpenAIRE

    Rezza, Sol

    2009-01-01

    El sonido es movimiento, sin movimiento no hay sonido. Nuestras vidas cotidianas están plagadas de sonidos, el mundo es un mundo sonoro. Soundscape, paisajes sonoros, postales sonoras, ambientes sonoros son algunos de los nombres con los que se define al sonido o a la combinación de sonidos que conforman un entono específico, es decir un ambiente sonoro.

  19. Mosaic VSGs and the scale of Trypanosoma brucei antigenic variation.

    Directory of Open Access Journals (Sweden)

    James P J Hall

    Full Text Available A main determinant of prolonged Trypanosoma brucei infection and transmission and success of the parasite is the interplay between host acquired immunity and antigenic variation of the parasite variant surface glycoprotein (VSG coat. About 0.1% of trypanosome divisions produce a switch to a different VSG through differential expression of an archive of hundreds of silent VSG genes and pseudogenes, but the patterns and extent of the trypanosome diversity phenotype, particularly in chronic infection, are unclear. We applied longitudinal VSG cDNA sequencing to estimate variant richness and test whether pseudogenes contribute to antigenic variation. We show that individual growth peaks can contain at least 15 distinct variants, are estimated computationally to comprise many more, and that antigenically distinct 'mosaic' VSGs arise from segmental gene conversion between donor VSG genes or pseudogenes. The potential for trypanosome antigenic variation is probably much greater than VSG archive size; mosaic VSGs are core to antigenic variation and chronic infection.

  20. Rtt107/Esc4 binds silent chromatin and DNA repair proteins using different BRCT motifs

    Directory of Open Access Journals (Sweden)

    Jockusch Rebecca A

    2006-11-01

    Full Text Available Abstract Background By screening a plasmid library for proteins that could cause silencing when targeted to the HMR locus in Saccharomyces cerevisiae, we previously reported the identification of Rtt107/Esc4 based on its ability to establish silent chromatin. In this study we aimed to determine the mechanism of Rtt107/Esc4 targeted silencing and also learn more about its biological functions. Results Targeted silencing by Rtt107/Esc4 was dependent on the SIR genes, which encode obligatory structural and enzymatic components of yeast silent chromatin. Based on its sequence, Rtt107/Esc4 was predicted to contain six BRCT motifs. This motif, originally identified in the human breast tumor suppressor gene BRCA1, is a protein interaction domain. The targeted silencing activity of Rtt107/Esc4 resided within the C-terminal two BRCT motifs, and this region of the protein bound to Sir3 in two-hybrid tests. Deletion of RTT107/ESC4 caused sensitivity to the DNA damaging agent MMS as well as to hydroxyurea. A two-hybrid screen showed that the N-terminal BRCT motifs of Rtt107/Esc4 bound to Slx4, a protein previously shown to be involved in DNA repair and required for viability in a strain lacking the DNA helicase Sgs1. Like SLX genes, RTT107ESC4 interacted genetically with SGS1; esc4Δ sgs1Δ mutants were viable, but exhibited a slow-growth phenotype and also a synergistic DNA repair defect. Conclusion Rtt107/Esc4 binds to the silencing protein Sir3 and the DNA repair protein Slx4 via different BRCT motifs, thus providing a bridge linking silent chromatin to DNA repair enzymes.

  1. The association between saliva control, silent saliva penetration, aspiration, and videofluoroscopic findings in Parkinson's disease patients

    Science.gov (United States)

    Rajaei, Ali; Ashtari, Fereshteh; Azargoon, Seyed Abolfazl; Chitsaz, Ahmad; Nilforoush, Mohammad Hussein; Taheri, Masoud; Sadeghi, Saba

    2015-01-01

    Background: Dysphagia is a common disorder among patients with Parkinson's disease (PD). It occurs in up to 80% of all (PD) patients during the early stages of the disease and up to 95% in the advanced stages; but professionals may not hear from the patients about dysphagia symptoms until these symptoms reach an advanced stage and lead to medical complications. Materials and Methods: Thirty-three PD patients (mean age 66.09 ± 9.4 years; 24 men, nine women) participated in this study at our Neurology Institute, between April 20, 2013, and October 26, 2013. They were asked two questions; one about saliva control and the other about silent saliva penetration and aspiration. Next, they underwent the videofluoroscopic swallowing study (VFSS). Results: The Pearson Correlation coefficient between the Penetration–Aspiration Scale (PAS) scores and question 1 scores was 0.48 (P < 0.05, =0.25), and there was a significant correlation between the PAS scores and question 2 scores, and also question 1 scores + question 2 scores (r = 0.589, P < 0.05, =0 and r = 0589, P < 0.05, =0). Conclusions: This study showed a significant correlation between the questions about saliva control, silent saliva penetration, and aspiration, and laryngeal penetration and aspiration during VFSS. Therefore, by using these two questions, the potential silent laryngeal penetration and aspiration during meals could be detected before it led to aspiration pneumonia. Taking the benefit of these questions, as a part of the swallowing assessment of PD patients, is recommended. PMID:26261810

  2. Reliability of the exercise ECG in detecting silent ischemia in patients with prior myocardial infarction

    International Nuclear Information System (INIS)

    Yamagishi, Takashi; Matsuda, Yasuo; Satoh, Akira

    1991-01-01

    To assess the reliability of the exercise ECG in detecting silent ischemia, ECG results were compared with those of stress-redistribution thallium-201 single-photon emission computed tomography (SPECT) in 116 patients with prior myocardial infarction and in 20 normal subjects used as a control. The left ventricle (LV) was divided into 20 segmental images, which were scored blindly on a 5-point scale. The redistribution score was defined as thallium defect score of exercise subtracted by that of redistribution image and was used as a measure of amount of ischemic but viable myocardium. The upper limit of normal redistribution score (=4.32) was defined as mean+2 standard deviations derived from 20 normal subjects. Of 116 patients, 47 had the redistribution score above the normal range. Twenty-five (53%) of the 47 patients showed positive ECG response. Fourteen (20%) of the 69 patients, who had the normal redistribution score, showed positive ECG response. Thus, the ECG response had a sensitivity of 53% and a specificity of 80% in detecting transient ischemia. Furthermore, the 116 patients were subdivided into 4 groups according to the presence or absence of chest pain and ECG change during exercise. Fourteen patients showed both chest pain and ECG change and all these patients had the redistribution score above the normal range. Twenty-five patients showed ECG change without chest pain and 11 (44%) of the 25 patients had the abnormal redistribution. Three (43%) of 7 patients who showed chest pain without ECG change had the abnormal redistribution score. Of 70 patients who had neither chest pain nor ECG change, 19 (27%) had the redistribution score above the normal range. Thus, limitations exist in detecting silent ischemia by ECG in patients with a prior myocardial infarction, because the ECG response to the exercise test may have a low degree of sensitivity and a high degree of false positive and false negative results in detecting silent ischemia. (author)

  3. Dynamic wind turbine models in power system simulation tool DIgSILENT

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, A.C.; Jauch, C.; Soerensen, P.; Iov, F.; Blaabjerg, F.

    2003-12-01

    The present report describes the dynamic wind turbine models implemented in the power system simulation tool DIgSILENT (Version 12.0). The developed models are a part of the results of a national research project, whose overall objective is to create a model database in different simulation tools. This model database should be able to support the analysis of the interaction between the mechanical structure of the wind turbine and the electrical grid during different operational modes. The report provides a description of the wind turbines modelling, both at a component level and at a system level. The report contains both the description of DIgSILENT built-in models for the electrical components of a grid connected wind turbine (e.g. induction generators, power converters, transformers) and the models developed by the user, in the dynamic simulation language DSL of DIgSILENT, for the non-electrical components of the wind turbine (wind model, aerodynamic model, mechanical model). The initialisation issues on the wind turbine models into the power system simulation are also presented. However, the main attention in this report is drawn to the modelling at the system level of two wind turbine concepts: 1. Active stall wind turbine with induction generator 2. Variable speed, variable pitch wind turbine with doubly fed induction generator. These wind turbine concept models can be used and even extended for the study of different aspects, e.g. the assessment of power quality, control strategies, connection of the wind turbine at different types of grid and storage systems. For both these two concepts, control strategies are developed and implemented, their performance assessed and discussed by means of simulations. (au)

  4. Application of DIgSILENT POWERFACTORY software for modeling of industrial network relay protection system

    Directory of Open Access Journals (Sweden)

    Sučević Nikola

    2016-01-01

    Full Text Available This paper presents modeling of industrial network relay protection system using DIgSILENT PowerFactory software. The basis for the model of protection system is a model of a single substation in an industrial network. The paper presents the procedure for modeling of protective devices of 6 kV asynchronous motors, 6/0,4 kV/kV transformers as well as protection in the bus coupler and busbar protection. Protective relay system response for the simulated disturbances is shown in the paper.

  5. Static Aeroelastic Deformation Effects in Preliminary Wind-tunnel Tests of Silent Supersonic Technology Demonstrator

    OpenAIRE

    Makino, Yoshikazu; Ohira, Keisuke; Makimoto, Takuya; Mitomo, Toshiteru; 牧野, 好和; 大平, 啓介; 牧本, 卓也; 三友, 俊輝

    2011-01-01

    Effects of static aeroelastic deformation of a wind-tunnel test model on the aerodynamic characteristics are discussed in wind-tunnel tests in the preliminary design phase of the silent supersonic technology demonstrator (S3TD). The static aeroelastic deformation of the main wing is estimated for JAXA 2m x 2m transonic wind-tunnel and 1m x 1m supersonic wind-tunnel by a finite element method (FEM) structural analysis in which its structural model is tuned with the model deformation calibratio...

  6. "Luck's always to blame": silent wounds of a penetrating gunshot trauma sustained 20 years ago.

    Science.gov (United States)

    Tomos, Ioannis; Manali, Effrosyni D; Argentos, Stylianos; Raptakis, Thomas; Papiris, Spyros A

    2015-01-01

    Gunshot tracheal injuries represent life-threatening events and usually necessitate emergent surgical intervention. We report a case of an exceptional finding of a patient with retained ballistic fragments in the soft tissues of the thorax, proximal to the right subclavian artery and the trachea, carrying silently his wounds for two decades without any medical or surgical intervention. The bullet pellet on the upper part of the trachea seen accidentally in the chest computed tomography, was also found during bronchoscopy. In short "luck's always to blame".

  7. Osteoporosis - "a silent killer". A review of the current literature from clinician and physiotherapist perspective

    Directory of Open Access Journals (Sweden)

    Janusz Kocjan

    2015-07-01

    SUMMARY             Osteoporosis is a disease characterized by low bone mass and deterioration of bone structure that causes bone fragility and increases the risk of fracture. Individuals with osteoporosis are at high risk of suffering one or more fractures, which are often physically debilitating and can potentially lead to a downward spiral in physical and mental health. Article attempts to discuss this issue from the clinical and rehabilitation perspective. Following contents were included: diagnosis, types of osteoporosis, epidemiology, burden of osteoporosis, types of fractures, treatment and rehabilitation of osteoporosis.   Key words: osteoporosis, porous bone, low bone mass, silent disease.

  8. Incidence of postangiographic silent brain infarction detected by diffusion-weighted MR imaging

    International Nuclear Information System (INIS)

    Mori, Harushi; Hayashi, Naoto; Aoki, Shigeki

    2002-01-01

    We surveyed to assess for the incidence of clinically silent brain infarction after cerebral catheter angiography. Diffusion-weighted images were performed shortly after 33 cerebral catheter angiographies. We found totally 11 abnormally high intensity spots in 5 of 33 patients on diffusion-weighted images and, therefore, the incidence was calculated as 15.2%. This incidence is higher than has been estimated based on the incidence of neurological deficits (about 0.5%) after cerebral angiography. Diffusion-weighted MR imaging is suitable to monitor the safety of angiographic procedures and material. (author)

  9. Reflections on clinical expertise and silent know-how in voice therapy

    DEFF Research Database (Denmark)

    Iwarsson, Jenny

    2014-01-01

    The concept of ‘clinical expertise’ is described as a part of evidence-based practice (EBP) together with ‘external scientific evidence’ and ‘patient values and perspectives’. However, clinical expertise in the management of voice disorders has not been described or discussed in much detail....... The expertise seems to consist partly of silent know-how that, from the outside, may seem improperly related to the personality of the speech-language pathologist or exclusively dependent on the number of years in the field. In this paper, it is suggested that clinical expertise in voice therapy consists...

  10. Application of DIgSILENT POWERFACTORY software for modeling of industrial network relay protection system

    OpenAIRE

    Sučević Nikola; Milošević Dejan

    2016-01-01

    This paper presents modeling of industrial network relay protection system using DIgSILENT PowerFactory software. The basis for the model of protection system is a model of a single substation in an industrial network. The paper presents the procedure for modeling of protective devices of 6 kV asynchronous motors, 6/0,4 kV/kV transformers as well as protection in the bus coupler and busbar protection. Protective relay system response for the simulated disturbances is shown in the paper.

  11. Accuracy of Ultrasonography and Rectal Palpation in the Diagnosis of Silent Heat in Cows Compared to Plasma Progesterone Concentration

    International Nuclear Information System (INIS)

    Zdunczyk, S.; Janowski, T.; Ras, A.; Baranski, W.

    2009-01-01

    The study was carried out on five dairy herds in the North-East Poland. The cows, which showed no visible oestrus signs until day 60 postpartum, were examined by ultrasonography and rectal palpation twice, at a 10-d interval. A real-time, B-mode scanner with a 5 MHz probe was used. The plasma progesterone concentration was determined using RIA. A high progesterone level on the first examination, but low on the second, or low on the first and high on the second examination were interpreted as a silent heat. Based on the progesterone values, silent heat was diagnosed in 145 anoestrous cows, whereas ultrasonographically, 106 cows were found to have silent heat. The accuracy of the ultrasonography and rectal palpation in the diagnosis of silent heat in cows was 89.0 % and 69.7 %, respectively (P ≤ 0.05). For the diagnosis of the corpus luteum, the sensitivity and specificity of the ultrasonography was 94.7 % and 84.0 %, and for rectal palpation 86.2 % and 70.3 %, respectively (P ≤ 0.05). Our results showed that ultrasonography is a useful tool in the diagnosis of silent heat in cows. (authors)

  12. Silent Ischemia

    Science.gov (United States)

    ... Rounds Seminar Series & Daily Conferences Fellowships and Residencies School of Perfusion Technology Education Resources Library & Learning Resource Center CME Resources THI Journal THI Cardiac Society Register for the Cardiac Society ...

  13. Silent Struggles

    DEFF Research Database (Denmark)

    Girschik, Verena; Boxenbaum, Eva

    when overt contestation is not a viable option – for example when they must dampen conflict to foster collaboration. This paper presents a case study of a Danish pharmaceutical company that overcame framing contexts, gained local stakeholders’ support and became the orchestrator of collaborative...... arrangements aimed at improving diabetes care in Indonesia. Inductively following the framing process in real-time, the paper presents a model that explicates three moves through which frame alignment was constructed: interactively reconstructing the field, manufacturing a common understanding of actions...

  14. Silent thyroiditis

    Science.gov (United States)

    ... to the touch Rapid heart rate Shaking hands (tremor) Tests that may be done include: Radioactive iodine uptake Thyroid hormones T3 and T4 TSH Treatment Treatment is based on symptoms. Medicines called beta-blockers may be used to relieve rapid heart rate ...

  15. Development of the status of W and T for the realization of a long-term safety demonstration for the final repository using the examples VSG and Konrad. Report on the Working package 2. Review and development of safety-related assessments of disposal facilities of wastes with negligible heat generation; development and provision of the necessary set of tools using the example of the final repository Konrad; Entwicklung des Standes von W and T bei der Fuehrung eines Langzeitsicherheitsnachweises fuer Endlager an den Beispielen VSG und Konrad. Bericht zum Arbeitspaket 2. Untersuchung und Entwicklung von sicherheitstechnischen Bewertungen fuer Endlager fuer Abfaelle mit vernachlaessigbarer Waermeentwicklung und Bereitstellung des notwendigen Instrumentariums am Beispiel des Endlagers Konrad

    Energy Technology Data Exchange (ETDEWEB)

    Larue, Juergen; Fischer-Appelt, Klaus; Hartwig-Thurat, Eva

    2015-09-15

    In the research project on the ''Review and development of safety-related assessments of disposal facilities with negligible heat generation; development and provision of the necessary set of tools, using the example of the Konrad disposal facility'' (3612R03410), the state of the art in science and technology of the safety-related assessments and sets of tools for building a safety case was examined. The reports pertaining to the two work packages described the further development of the methodology for accident analyses (WP 1) and of building a safety case (WP 2); also, comparisons were drawn on a national and international scale with the methods applied in the licensing procedure of the Konrad disposal facility. A safety case as well as its underlying analyses and methods always has to be brought up to date with the development of the state of the art in science and technology. In Germany, two safety cases regarding the long-term safety of disposal facilities have been prepared. These are the licensing documentation for the Konrad disposal facility in the year 1990 and the research project regarding the preliminary safety case for the Gorleben site (Vorlaeufige Sicherheitsanalyse Gorleben - VSG) in the year 2013, both reflecting the state of development of building a safety case at the respective time. Comparing the two above-mentioned examples of safety cases and taking recent international recommendations and national regulations into account, this report on Work Package 2 presents the development of the international state of the art in science and technology. This has been done by summarising the essential differences and similarities of each element of the safety case for the Konrad disposal facility on the one hand and the VSG and the international status on the other hand.

  16. Bajo impacto de la infección silente por el virus de la hepatitis B en la incidencia de hepatitis postransfusional en Venezuela

    Directory of Open Access Journals (Sweden)

    Gutiérrez Cristina

    2001-01-01

    Full Text Available Objetivo. Detectar la presencia de ADN del VHB en sueros de donantes de sangre negativos en las pruebas de los marcadores serológicos de hepatitis B empleados en el tamizaje, con el fin de evaluar el impacto de la infección silente por VHB sobre la incidencia de hepatitis B postransfusional en Venezuela. Métodos. Los sueros de 2 075 donantes de sangre negativos en las pruebas de los marcadores serológicos pesquisados en bancos de sangre venezolanos fueron analizados en 53 muestras, compuestas por la mezcla de 25-50 donaciones (0,5-1,0 mL de cada suero. Estas fueron sometidos a ultracentrifugación previa a la extracción del ADN viral por el método de proteinasa K-fenol-cloroformo. Resultados. En estas mezclas de sueros no se detectó ADN del VHB en ninguno de dos ensayos anidados de reacción en cadena de la polimerasa, mediante cebadores altamente conservados de las regiones que codifican el antígeno de superficie y de la cápside virales. Se observaron niveles normales de aminotransferasas en 98% de 200 sueros evaluados. Conclusiones. Estos resultados sugieren que el riesgo de adquirir hepatitis B postransfusional en Venezuela es bajo.

  17. The Tzu Chi Silent Mentor Program: Application of Buddhist Ethics to Teach Student Physicians Empathy, Compassion, and Self-Sacrifice.

    Science.gov (United States)

    Santibañez, Scott; Boudreaux, Debra; Tseng, Guo-Fang; Konkel, Kimberly

    2016-10-01

    The Buddhist Tzu Chi Silent Mentor Program promotes the donation of one's body to science as a selfless act by appealing to the Buddhist ethics of compassion and self-sacrifice. Together, faculty, families, and donors help medical students to learn the technical, spiritual, emotional, and psychological aspects of medicine. Students assigned to each "Silent Mentor" visit the family to learn about the donor's life. They see photos and hear family members' stories. Afterwards, students write a brief biography of the donor which is posted on the program website, in the medical school, and on the dissection table. In this paper, we: (1) summarize the Silent Mentor Program; (2) describe findings from an assessment of medical students who recently completed a new version of the program in Malaysia; and (3) explore how healthcare settings could benefit from this innovative program.

  18. Diagnosis of silent myocardial ischemia in type 2 diabetic patients by electrocardiogram, ergometry and Gated-SPECT

    International Nuclear Information System (INIS)

    Penna Quian, Yamile; Fernandez-Britto Rodriguez, Jose; Bacallao Gallestey, Jorge; Batista Cuellar, Juan Felipe; Coca Perez, Marco Antonio; Toirac Garcia, Noresma; Penna Coego, Andria

    2008-01-01

    31 asymptomatic type 2 diabetic patients were studied by lab tests, electrocardiogram, ergometry, Gated-SPECT and coronariography to determine the relation between the atherosclerotic risk factors and the silent myocardial ischemia. Patients were classified into two groups: positive SPECT and negative SPECT. Association tests were made for each variable and ROC curves were constructed to identify risk markers. In 35.5% of the patients silent myocardial ischemia was detected with a good angiographic correlation. A significant association was evidenced between positive SPECT and the atherosclerotic risk factors, namely, low values of HDLc, family pathological history of ischemic heart disease and peripheral vascular disease. The logistic regression models showed that low values of HDLc together with family pathological history of ischemic heart disease may be strong predictors of silent myocardial ischemia in asymptomatic type 2 diabetic patients

  19. Neocortical inhibitory activities and long-range afferents contribute to the synchronous onset of silent states of the neocortical slow oscillation.

    Science.gov (United States)

    Lemieux, Maxime; Chauvette, Sylvain; Timofeev, Igor

    2015-02-01

    During slow-wave sleep, neurons of the thalamocortical network are engaged in a slow oscillation (<1 Hz), which consists of an alternation between the active and the silent states. Several studies have provided insights on the transition from the silent, which are essentially periods of disfacilitation, to the active states. However, the conditions leading to the synchronous onset of the silent state remain elusive. We hypothesized that a synchronous input to local inhibitory neurons could contribute to the transition to the silent state in the cat suprasylvian gyrus during natural sleep and under ketamine-xylazine anesthesia. After partial and complete deafferentation of the cortex, we found that the silent state onset was more variable among remote sites. We found that the transition to the silent state was preceded by a reduction in excitatory postsynaptic potentials and firing probability in cortical neurons. We tested the impact of chloride-mediated inhibition in the silent-state onset. We uncovered a long-duration (100-300 ms) inhibitory barrage occurring about 250 ms before the silent state onset in 3-6% of neurons during anesthesia and in 12-15% of cases during natural sleep. These inhibitory activities caused a decrease in cortical firing that reduced the excitatory drive in the neocortical network. That chain reaction of disfacilitation ends up on the silent state. Electrical stimuli could trigger a network silent state with a maximal efficacy in deep cortical layers. We conclude that long-range afferents to the neocortex and chloride-mediated inhibition play a role in the initiation of the silent state. Copyright © 2015 the American Physiological Society.

  20. UTILIZATION OF 5Es' CONSTRUCTIVIST APPROACH FOR ...

    African Journals Online (AJOL)

    Global Journal

    learning, the effective utilization of which can enhance biology teaching and learning. This paper focused on how ... KEYWORDS: Utilization, 5Es Constructivist approach, difficult concepts, Biology. ... gives hope to the development of the deep.

  1. University of Dar es Salaam Library Journal

    African Journals Online (AJOL)

    University of Dar es Salaam Library Journal. ... PROMOTING ACCESS TO AFRICAN RESEARCH ... These include organization and dissemination of information, library education and training, information technology and its application in ...

  2. Microbial communication leading to the activation of silent fungal secondary metabolite gene clusters

    Directory of Open Access Journals (Sweden)

    Tina eNetzker

    2015-04-01

    Full Text Available Microorganisms form diverse multispecies communities in various ecosystems. The high abundance of fungal and bacterial species in these consortia results in specific communication between the microorganisms. A key role in this communication is played by secondary metabolites (SMs, which are also called natural products. Recently, it was shown that interspecies ‘talk’ between microorganisms represents a physiological trigger to activate silent gene clusters leading to the formation of novel SMs by the involved species. This review focuses on mixed microbial cultivation, mainly between bacteria and fungi, with a special emphasis on the induced formation of fungal SMs in co-cultures. In addition, the role of chromatin remodeling in the induction is examined, and methodical perspectives for the analysis of natural products are presented. As an example for an intermicrobial interaction elucidated at the molecular level, we discuss the specific interaction between the filamentous fungi Aspergillus nidulans and Aspergillus fumigatus with the soil bacterium Streptomyces rapamycinicus, which provides an excellent model system to enlighten molecular concepts behind regulatory mechanisms and will pave the way to a novel avenue of drug discovery through targeted activation of silent SM gene clusters through co-cultivations of microorganisms.

  3. High frequency of silent brain infarcts associated with cognitive deficits in an economically disadvantaged population.

    Science.gov (United States)

    Squarzoni, Paula; Tamashiro-Duran, Jaqueline H; Duran, Fabio L S; Leite, Claudia C; Wajngarten, Mauricio; Scazufca, Marcia; Menezes, Paulo R; Lotufo, Paulo A; Alves, Tania C T F; Busatto, Geraldo F

    2017-08-01

    Using magnetic resonance imaging, we aimed to assess the presence of silent brain vascular lesions in a sample of apparently healthy elderly individuals who were recruited from an economically disadvantaged urban region (São Paulo, Brazil). We also wished to investigate whether the findings were associated with worse cognitive performance. A sample of 250 elderly subjects (66-75 years) without dementia or neuropsychiatric disorders were recruited from predefined census sectors of an economically disadvantaged area of Sao Paulo and received structural magnetic resonance imaging scans and cognitive testing. A high proportion of individuals had very low levels of education (4 years or less, n=185; 21 with no formal education). The prevalence of at least one silent vascular-related cortical or subcortical lesion was 22.8% (95% confidence interval, 17.7-28.5), and the basal ganglia was the most frequently affected site (63.14% of cases). The subgroup with brain infarcts presented significantly lower levels of education than the subgroup with no brain lesions as well as significantly worse current performance in cognitive test domains, including memory and attention (pcognitive deficits, and in the absence of magnetic resonance imaging data, this cognitive impairment may be considered simply related to ageing. Emphatic attention should be paid to potentially deleterious effects of vascular brain lesions in poorly educated elderly individuals from economically disadvantaged environments.

  4. Deafening silence? Time to reconsider whether organisations are silent or deaf when things go wrong.

    Science.gov (United States)

    Jones, Aled; Kelly, Daniel

    2014-09-01

    Several public inquiries into healthcare failings in the UK have noted that employees of failing organizations attempt to raise concerns about shortcomings in care, often over a prolonged period of time, only for those concerns to be ignored. However, healthcare literature has largely focused on how organizations and their employees are silent in the face of such failings, positioning employees as daring not to speak in response to serious workplace problems or issues. We argue that only focussing on organizational silence is a critical mistake which misrepresents actual events and overly-simplifies the complexities of workplace culture. The disregard shown by academics, practitioners and policy makers to employee voice strategies, which do not amount to whistle-blowing, but equally cannot either be defined as "silence", results in signals being ignored that can be effective in preventing and ending wrongdoing by others. In addition to understanding silence we suggest therefore that better understanding of why organizations are deaf to, or disregard, employee concerns are needed. We propose that a virtuous cycle is possible, whereby the introduction of systems that result in better listening and valuing of employee concerns reinforces a culture of speaking up and, in turn, organizational learning. Similarly, organizations that disregard employees concerns are destined not to learn, ultimately falling silent and failing. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  5. Direct effects of smoking on the heart: silent ischemic disturbances of coronary flow

    International Nuclear Information System (INIS)

    Deanfield, J.E.; Shea, M.J.; Wilson, R.A.; Horlock, P.; de Landsheere, C.M.; Selwyn, A.P.

    1986-01-01

    Cigarette smoking is strongly associated with ischemic heart disease and acute coronary events. The effect of smoking a single cigarette on regional myocardial perfusion was studied in 13 chronic smokers with typical stable angina pectoris using positron emission tomography and rubidium-82 ( 82 Rb). Findings were compared with the effects of physical exercise. After exercise, 8 patients (61%) had angina, ST depression and abnormal regional myocardial perfusion. Uptake of 82 Rb increased from 49 +/- 8 to 60 +/- 7 in remote myocardium, but decreased from 46 +/- 3 to 37 +/- 5 in an ischemic area. The remaining 5 patients (39%) had homogeneous increases in 82 Rb uptake without angina or ST depression. After smoking, 6 of the 8 patients with positive exercise test responses had a decrease in 82 Rb uptake, from 47 +/- 3 to 35 +/- 6 in the same segment of myocardium affected during exercise. However, in contrast to exercise, the events during smoking were largely silent. The absolute decreases in regional 82 Rb uptake after smoking occurred at significantly lower levels of myocardial oxygen demand than after exercise. This suggests that an impairment of coronary blood supply is responsible. Thus, in smokers with coronary artery disease, each cigarette can cause profound silent disturbances of regional myocardial perfusion that are likely to occur frequently during daily life. Such repeated insults may represent an important mechanism linking smoking with coronary events

  6. Public health response to the silent reintroduction of wild poliovirus to Israel, 2013-2014.

    Science.gov (United States)

    Moran-Gilad, J; Kaliner, E; Gdalevich, M; Grotto, I

    2016-12-01

    During 2013/14, Israel witnessed the silent reintroduction and sustained transmission of wild poliovirus type 1 (WPV1) detected through routine environmental surveillance performed on sewage samples. The public health response to silent poliovirus transmission in a population with high inactivated polio vaccine (IPV) coverage poses an emerging challenge towards the 'End Game' of global poliovirus eradication. This paper reviews the risk assessment, risk management and risk communication aspects of this poliovirus incident. Special emphasis is placed on the use of scientific data generated in the risk assessment phase to inform the public health response. Reintroducing a live vaccine in supplemental immunization activities in response to transmission of WPV or vaccine-derived poliovirus should be considered close to the 'End Game' of polio eradication, especially if targeting the population at risk is feasible. Such circumstances require a comprehensive contingency plan that will support the generation of important public health evidence at the risk assessment stage, thereby allowing to tailor the risk management approaches and underpin appropriate risk communication. Copyright © 2016 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

  7. Monstruos de la Universal: la etapa silente y los mitos del sonoro

    Directory of Open Access Journals (Sweden)

    David Fuentefría-Rodríguez

    2013-04-01

    Full Text Available En coincidencia con el centenario en 2012 de los legendarios Estudios Universal, este trabajo propone un exhaustivo análisis crítico sobre la construcción de sus principales símbolos terroríficos, la mayoría inspirados en la literatura, que entre los años 1923 y 1941 conformaron la estructura mitogénica del denominado “monstruo clásico”. Tanto en la etapa silente, como con la irrupción del sonoro, las películas de terror de la Universal marcaron un paso imprescindible en la evolución de este género canónico, y a ellas se debe buena parte del ingente desarrollo posterior del mismo.In coincidence with 2012 legendary Universal Studio´s centenary, this paper proposes an exhaustive critical analysis on the construction of its principal terrifying symbols, the majority inspired by literature, which between 1923 and 1941 shaped the myth structure of the so-called "classic monster". In both stages, silent and sonorous movies, the terror of Universal Studios marked an indispensable step in the evolution of this canonical genre, and to them it is owed a good deal of its enormous later development.

  8. THE EFFECT OF USING SHORT SILENT ANIMATIONS ON EFL LEARNERS WRITING

    Directory of Open Access Journals (Sweden)

    Hamid Marashi

    2017-06-01

    Full Text Available This study investigated the effect of short silent animations on pre-intermediate EFL learners writing. A homogenized group of 60 participants was non-randomly chosen and assigned as the control and experimental groups. Those in the control group watched five short animations with dialogue, while those in the experimental group had five short animations which were silent. The procedure lasted 10 sessions. In both groups, the participants were asked to write five writings regarding the subjects of the animations during the term and each of the writings should have contained a minimum of 90 and maximum of 140 words. The participants were provided both oral and written feedback. At the end of the instruction, a sample PET writing posttest was administered to both groups, an independent samples t-test was run on the mean scores of the two groups, and the results (t = -2.02, p = 0.037˂0.05 revealed that the experimental group outperformed the control group.

  9. Transformation of a Silent Adrencorticotrophic Pituitary Tumor Into Central Nervous System Melanoma

    Directory of Open Access Journals (Sweden)

    Brandon A. Miller MD, PhD

    2013-06-01

    Full Text Available Silent adrenocorticotrophic pituitary adenomas are nonfunctioning pituitary adenomas that express adrenocorticotrophic hormone (ACTH but do not cause the clinical or laboratory features of hypercortisolemia. Primary central nervous system (CNS melanoma is well documented, but rarely originates in the sellar region or pituitary gland. Here we report transformation of an aggressive silent adrenocorticotrophic pituitary adenoma that transformed into CNS melanoma and review other presentations of pituitary melanoma. A 37-year-old woman initially presented with apoplexy and an invasive nonfunctioning pituitary macroadenoma for which she underwent transphenoidal surgery. The patient underwent 3 subsequent surgeries as the tumor continued to progress. Pathology from the first 3 operations showed pituitary adenoma or carcinoma. Pathology from the final surgery showed melanoma and the magnetic resonance imaging characteristics of the tumor had changed to become consistent with CNS melanoma. Dermatologic and ophthalmologic examinations did not identify cutaneous or ocular melanoma. The patient’s disease progressed despite aggressive surgical, medical and radiologic treatment. To our knowledge, this is the first report demonstrating transformation of a primary pituitary tumor into melanoma. The mechanism of tumor transformation is unclear, but it is possible that a mutation in the original ACTH-producing tumor lead to increased cleavage of pro-opiomelanocortin or ACTH into α-melanocyte-stimulating hormone, which in turn stimulated the expression of microopthalmia transcription factor, leading to melanocytic phenotype transformation.

  10. Functional magnetic resonance imaging of hippocampal activation during silent mantra meditation.

    Science.gov (United States)

    Engström, Maria; Pihlsgård, Johan; Lundberg, Peter; Söderfeldt, Birgitta

    2010-12-01

    The objective of the present study was to investigate whether moderately experienced meditators activate hippocampus and the prefrontal cortex during silent mantra meditation, as has been observed in earlier studies on subjects with several years of practice. Subjects with less than 2 years of meditation practice according to the Kundalini yoga or Acem tradition were examined by functional magnetic resonance imaging during silent mantra meditation, using an on-off block design. Whole-brain as well as region-of-interest analyses were performed. The most significant activation was found in the bilateral hippocampus/parahippocampal formations. Other areas with significant activation were the bilateral middle cingulate cortex and the bilateral precentral cortex. No activation in the anterior cingulate cortex was found, and only small activation clusters were observed in the prefrontal cortex. In conclusion, the main finding in this study was the significant activation in the hippocampi, which also has been correlated with meditation in several previous studies on very experienced meditators. We propose that the hippocampus is activated already after moderate meditation practice and also during different modes of meditation, including relaxation. The role of hippocampal activity during meditation should be further clarified in future studies, especially by investigating whether the meditation-correlated hippocampal activity is related to memory consolidation.

  11. Impact of Insulin Resistance on Silent and Ongoing Myocardial Damage in Normal Subjects: The Takahata Study

    Directory of Open Access Journals (Sweden)

    Taro Narumi

    2012-01-01

    Full Text Available Background. Insulin resistance (IR is part of the metabolic syndrome (Mets that develops after lifestyle changes and obesity. Although the association between Mets and myocardial injury is well known, the effect of IR on myocardial damage remains unclear. Methods and Results. We studied 2200 normal subjects who participated in a community-based health check in the town of Takahata in northern Japan. The presence of IR was assessed by homeostasis model assessment ratio, and the serum level of heart-type fatty acid binding protein (H-FABP was measured as a maker of silent and ongoing myocardial damage. H-FABP levels were significantly higher in subjects with IR and Mets than in those without metabolic disorder regardless of gender. Multivariate logistic analysis showed that the presence of IR was independently associated with latent myocardial damage (odds ratio: 1.574, 95% confidence interval 1.1–2.3 similar to the presence of Mets. Conclusions. In a screening of healthy subjects, IR and Mets were similarly related to higher H-FABP levels, suggesting that there may be an asymptomatic population in the early stages of metabolic disorder that is exposed to myocardial damage and might be susceptible to silent heart failure.

  12. Chlamydia pneumoniae hides inside apoptotic neutrophils to silently infect and propagate in macrophages.

    Directory of Open Access Journals (Sweden)

    Jan Rupp

    Full Text Available BACKGROUND: Intracellular pathogens have developed elaborate strategies for silent infection of preferred host cells. Chlamydia pneumoniae is a common pathogen in acute infections of the respiratory tract (e.g. pneumonia and associated with chronic lung sequelae in adults and children. Within the lung, alveolar macrophages and polymorph nuclear neutrophils (PMN are the first line of defense against bacteria, but also preferred host phagocytes of chlamydiae. METHODOLOGY/PRINCIPAL FINDINGS: We could show that C. pneumoniae easily infect and hide inside neutrophil granulocytes until these cells become apoptotic and are subsequently taken up by macrophages. C. pneumoniae infection of macrophages via apoptotic PMN results in enhanced replicative activity of chlamydiae when compared to direct infection of macrophages, which results in persistence of the pathogen. Inhibition of the apoptotic recognition of C. pneumoniae infected PMN using PS- masking Annexin A5 significantly lowered the transmission of chlamydial infection to macrophages. Transfer of apoptotic C. pneumoniae infected PMN to macrophages resulted in an increased TGF-ss production, whereas direct infection of macrophages with chlamydiae was characterized by an enhanced TNF-alpha response. CONCLUSIONS/SIGNIFICANCE: Taken together, our data suggest that C. pneumoniae uses neutrophil granulocytes to be silently taken up by long-lived macrophages, which allows for efficient propagation and immune protection within the human host.

  13. Clinical aspects of silent cerebral infarction; MRI findings and its distribution

    Energy Technology Data Exchange (ETDEWEB)

    Ohnishi, Jiro (Kobe Univ. (Japan). School of Medicine); Kudo, Yutaka

    1991-06-01

    High-field MR scans have often showed patchy incidental findings especially in the elderly. We examined 91 patients, without episodes of cerebrovascular disorders previously, who had silent cerebral lesions noted by the 1.5 tesla superconductive system T2 weighted magnetic resonance imaging. They were divided into three subtypes by the localization of foci. The 23 subjects (25%) showed confined lesions to thalamus and/or internal capsule and/or basal ganglia (the basal ganglia type). The 39 subjects (43%) had lesions predominantly in cerebral cortex and/or subcortical white matter and/or cerebellum (the diffuse subcortical type). Finally, the 29 subjects (32%) had both features of abovementioned two groups (the mixed type). These subtypes were correlated with age, sex and some of the other risk factors, such as systolic blood pressure, diastolic blood pressure, serum total cholesterol and uric acid, for stroke. From the age extent and the correlation of subtypes to risk factors, the basal ganglia type was suspected to be based on the different origin from other two types. The authors proposed that the arteriosclerotic factor might play an important role in the incidence of the diffuse subcortical type and the mixed type silent cerebral infarctions and that the hemodynamic factor might play an important role in the incidence of the basal ganglia type. (J.P.N.).

  14. Measuring the prevalence of regional mutation rates: an analysis of silent substitutions in mammals, fungi, and insects

    Directory of Open Access Journals (Sweden)

    Tuch Brian B

    2008-06-01

    Full Text Available Abstract Background The patterns of mutation vary both within and across genomes. It has been shown for a few mammals that mutation rates vary within the genome, while for unknown reasons, the sensu stricto yeasts have uniform rates instead. The generality of these observations has been unknown. Here we examine silent site substitutions in a more expansive set (20 mammals, 27 fungi, 4 insects to determine why some genomes demonstrate this mosaic distribution and why others are uniform. Results We applied several intragene and intergene correlation tests to measure regional substitution patterns. Assuming that silent sites are a reasonable approximation to neutrally mutating sequence, our results show that all multicellular eukaryotes exhibit mutational heterogeneity. In striking contrast, all fungi are mutationally uniform – with the exception of three Candida species: C. albicans, C. dubliniensis, and C. tropicalis. We speculate that aspects of replication timing may be responsible for distinguishing these species. Our analysis also reveals classes of genes whose silent sites behave anomalously with respect to the mutational background in many species, indicating prevalent selective pressures. Genes associated with nucleotide binding or gene regulation have consistently low silent substitution rates in every mammalian species, as well as multiple fungi. On the other hand, receptor genes repeatedly exhibit high silent substitution rates, suggesting they have been influenced by diversifying selection. Conclusion Our findings provide a framework for understanding the regional mutational properties of eukaryotes, revealing a sharp difference between fungi and multicellular species. They also elucidate common selective pressures acting on eukaryotic silent sites, with frequent evidence for both purifying and diversifying selection.

  15. Development of the status of W and T for the realization of a long-term safety demonstration for the final repository using the examples VSG and Konrad. Report on the Working package 2. Review and development of safety-related assessments of disposal facilities of wastes with negligible heat generation; development and provision of the necessary set of tools using the example of the final repository Konrad

    International Nuclear Information System (INIS)

    Larue, Juergen; Fischer-Appelt, Klaus; Hartwig-Thurat, Eva

    2015-09-01

    In the research project on the ''Review and development of safety-related assessments of disposal facilities with negligible heat generation; development and provision of the necessary set of tools, using the example of the Konrad disposal facility'' (3612R03410), the state of the art in science and technology of the safety-related assessments and sets of tools for building a safety case was examined. The reports pertaining to the two work packages described the further development of the methodology for accident analyses (WP 1) and of building a safety case (WP 2); also, comparisons were drawn on a national and international scale with the methods applied in the licensing procedure of the Konrad disposal facility. A safety case as well as its underlying analyses and methods always has to be brought up to date with the development of the state of the art in science and technology. In Germany, two safety cases regarding the long-term safety of disposal facilities have been prepared. These are the licensing documentation for the Konrad disposal facility in the year 1990 and the research project regarding the preliminary safety case for the Gorleben site (Vorlaeufige Sicherheitsanalyse Gorleben - VSG) in the year 2013, both reflecting the state of development of building a safety case at the respective time. Comparing the two above-mentioned examples of safety cases and taking recent international recommendations and national regulations into account, this report on Work Package 2 presents the development of the international state of the art in science and technology. This has been done by summarising the essential differences and similarities of each element of the safety case for the Konrad disposal facility on the one hand and the VSG and the international status on the other hand.

  16. “Silent” Diabetes and Clinical Outcome After Treatment With Contemporary Drug-Eluting Stents : The BIO-RESORT Silent Diabetes Study

    NARCIS (Netherlands)

    von Birgelen, Clemens; Kok, Marlies M.; Sattar, Naveed; Zocca, Paolo; Doelman, Cees; Kant, Gert D.; Löwik, Marije M.; van der Heijden, Liefke C.; Sen, Hanim; van Houwelingen, Gert K.; Stoel, Martin G.; Louwerenburg, J. (Hans) W.; Hartmann, Marc; de Man, Frits H.A.F.; Linssen, Gerard C.M.; Doggen, Carine J.M.; Tandjung, Kenneth

    2018-01-01

    Objectives: This study sought to assess the prevalence and clinical impact of silent diabetes and pre-diabetes in “nondiabetic” percutaneous coronary intervention (PCI) all-comers. Background: Patients with undetected and thus untreated (silent) diabetes may have higher event risks after PCI with

  17. Cardiovascular risk evaluation and prevalence of silent myocardial ischemia in subjects with asymptomatic carotid artery disease

    Directory of Open Access Journals (Sweden)

    Ciccone M

    2011-03-01

    Full Text Available Marco Matteo Ciccone1, Artor Niccoli-Asabella2, Pietro Scicchitano1, Michele Gesualdo1, Antonio Notaristefano2, Domenico Chieppa1, Santa Carbonara1, Gabriella Ricci1, Marco Sassara1, Corinna Altini2, Giovanni Quistelli1, Mario Erminio Lepera1, Stefano Favale1, Giuseppe Rubini21Cardiovascular Diseases Section, Department of Emergency and Organ Transplantation (DETO, 2Nuclear Medicine Unit, Department of Internal Medicine and of Public Medicine, University of Bari, Bari, ItalyIntroduction: Silent ischemia is an asymptomatic form of myocardial ischemia, not associated with angina or anginal equivalent symptoms, which can be demonstrated by changes in ECG, left ventricular function, myocardial perfusion, and metabolism. The aim of this study was to evaluate the prevalence of silent myocardial ischemia in a group of patients with asymptomatic carotid stenosis.Methods: A total of 37 patients with asymptomatic carotid plaques, without chest pain or dyspnea, was investigated. These patients were studied for age, sex, hypertension, diabetes, dyslipidemia, smoking, and family history of cardiac disease, and underwent technetium-99 m sestamibi myocardial stress-rest scintigraphy and echo-color Doppler examination of carotid arteries.Results: A statistically significant relationship (P = 0.023 was shown between positive responders and negative responders to scintigraphy test when both were tested for degree of stenosis. This relationship is surprising in view of the small number of patients in our sample. Individuals who had a positive scintigraphy test had a mean stenosis degree of 35% ± 7% compared with a mean of 44% ± 13% for those with a negative test. Specificity of our detection was 81%, with positive and negative predictive values of 60% and 63%, respectively.Conclusion: The present study confirms that carotid atherosclerosis is associated with coronary atherosclerosis and highlights the importance of screening for ischemic heart disease in

  18. Silent Corticotroph Adenomas After Stereotactic Radiosurgery: A Case–Control Study

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Zhiyuan; Ellis, Scott; Lee, Cheng-Chia; Starke, Robert M. [Department of Neurological Surgery, University of Virginia, Charlottesville, Virginia (United States); Schlesinger, David [Department of Neurological Surgery, University of Virginia, Charlottesville, Virginia (United States); Department of Radiation Oncology, University of Virginia, Charlottesville, Virginia (United States); Lee Vance, Mary [Department of Neurological Surgery, University of Virginia, Charlottesville, Virginia (United States); Department of Internal Medicine, University of Virginia, Charlottesville, Virginia (United States); Lopes, M. Beatriz [Division of Neuropathology, University of Virginia, Charlottesville, Virginia (United States); Sheehan, Jason, E-mail: jsheehan@virginia.edu [Department of Neurological Surgery, University of Virginia, Charlottesville, Virginia (United States); Department of Radiation Oncology, University of Virginia, Charlottesville, Virginia (United States)

    2014-11-15

    Purpose: To investigate the safety and effectiveness of stereotactic radiosurgery (SRS) in patients with a silent corticotroph adenoma (SCA) compared with patients with other subtypes of non–adrenocorticotropic hormone staining nonfunctioning pituitary adenoma (NFA). Methods and Materials: The clinical features and outcomes of 104 NFA patients treated with SRS in our center between September 1994 and August 2012 were evaluated. Among them, 34 consecutive patients with a confirmatory SCA were identified. A control group of 70 patients with other subtypes of NFA were selected for review based on comparable baseline features, including sex, age at the time of SRS, tumor size, margin radiation dose to the tumor, and duration of follow-up. Results: The median follow-up after SRS was 56 months (range, 6-200 months). No patients with an SCA developed Cushing disease during the follow-up. Tumor control was achieved in 21 of 34 patients (62%) in the SCA group, compared with 65 of 70 patients (93%) in the NFA group. The median progression-free survival (PFS) was 58 months in the SCA group. The actuarial PFS was 73%, 46%, and 31% in the SCA group and was 94%, 87%, and 87% in the NFA group at 3, 5, and 8 years, respectively. Silent corticotroph adenomas treated with a dose of ≥17 Gy exhibited improved PFS. New-onset loss of pituitary function developed in 10 patients (29%) in the SCA group, whereas it occurred in 18 patients (26%) in the NFA group. Eight patients (24%) in the SCA group experienced worsening of a visual field deficit or visual acuity attributed to the tumor progression, as did 6 patients (9%) in the NFA group. Conclusion: Silent corticotroph adenomas exhibited a more aggressive course with a higher progression rate than other subtypes of NFAs. Stereotactic radiosurgery is an important adjuvant treatment for control of tumor growth. Increased radiation dose may lead to improved tumor control in SCA patients.

  19. Silent Corticotroph Adenomas After Stereotactic Radiosurgery: A Case–Control Study

    International Nuclear Information System (INIS)

    Xu, Zhiyuan; Ellis, Scott; Lee, Cheng-Chia; Starke, Robert M.; Schlesinger, David; Lee Vance, Mary; Lopes, M. Beatriz; Sheehan, Jason

    2014-01-01

    Purpose: To investigate the safety and effectiveness of stereotactic radiosurgery (SRS) in patients with a silent corticotroph adenoma (SCA) compared with patients with other subtypes of non–adrenocorticotropic hormone staining nonfunctioning pituitary adenoma (NFA). Methods and Materials: The clinical features and outcomes of 104 NFA patients treated with SRS in our center between September 1994 and August 2012 were evaluated. Among them, 34 consecutive patients with a confirmatory SCA were identified. A control group of 70 patients with other subtypes of NFA were selected for review based on comparable baseline features, including sex, age at the time of SRS, tumor size, margin radiation dose to the tumor, and duration of follow-up. Results: The median follow-up after SRS was 56 months (range, 6-200 months). No patients with an SCA developed Cushing disease during the follow-up. Tumor control was achieved in 21 of 34 patients (62%) in the SCA group, compared with 65 of 70 patients (93%) in the NFA group. The median progression-free survival (PFS) was 58 months in the SCA group. The actuarial PFS was 73%, 46%, and 31% in the SCA group and was 94%, 87%, and 87% in the NFA group at 3, 5, and 8 years, respectively. Silent corticotroph adenomas treated with a dose of ≥17 Gy exhibited improved PFS. New-onset loss of pituitary function developed in 10 patients (29%) in the SCA group, whereas it occurred in 18 patients (26%) in the NFA group. Eight patients (24%) in the SCA group experienced worsening of a visual field deficit or visual acuity attributed to the tumor progression, as did 6 patients (9%) in the NFA group. Conclusion: Silent corticotroph adenomas exhibited a more aggressive course with a higher progression rate than other subtypes of NFAs. Stereotactic radiosurgery is an important adjuvant treatment for control of tumor growth. Increased radiation dose may lead to improved tumor control in SCA patients

  20. Dynamic wind turbine models in power system simulation tool DIgSILENT

    Energy Technology Data Exchange (ETDEWEB)

    Hansen, A.D.; Iov, F.; Soerensen, Poul.; Cutululis, N.; Jauch, C.; Blaabjerg, F.

    2007-08-15

    This report presents a collection of models and control strategies developed and implemented in the power system simulation tool PowerFactory DIgSILENT for different wind turbine concepts. It is the second edition of Risoe-R-1400(EN) and it gathers and describes a whole wind turbine model database built-op and developed during several national research projects, carried out at Risoe DTU National Laboratory for Sustainable Energy and Aalborg University, in the period 2001-2007. The overall objective of these projects was to create a wind turbine model database able to support the analysis of the interaction between the mechanical structure of the wind turbine and the electrical grid during different operational modes. The report provides thus a description of the wind turbines modelling, both at a component level and at a system level. The report contains both the description of DIgSILENT built-in models for the electrical components of a grid connected wind turbine (e.g. induction generators, power converters, transformers) and the models developed by the user, in the dynamic simulation language DSL of DIgSILENT, for the non-electrical components of the wind turbine (wind model, aerodynamic model, mechanical model). The initialisation issues on the wind turbine models into the power system simulation are also presented. The main attention in the report is drawn to the modelling at the system level of the following wind turbine concepts: (1) Fixed speed active stall wind turbine concept (2) Variable speed doubly-fed induction generator wind turbine concept (3) Variable speed multi-pole permanent magnet synchronous generator wind turbine concept These wind turbine concept models can be used and even extended for the study of different aspects, e.g. the assessment of power quality, control strategies, connection of the wind turbine at different types of grid and storage systems. Different control strategies have been developed and implemented for these wind turbine

  1. ¿Es la Internet un derecho?

    Directory of Open Access Journals (Sweden)

    Eduardo Villanueva Mansilla

    2010-09-01

    Full Text Available Internet ha sido declarado como derecho, lo que hace que su acceso, uso y penetración sean considerados como prioritarios en todas las zonas del planeta. La intención de este ensayo es esbozar cuáles serían estos efectos. El derecho al Internet es simplemente la garantía de poder participar de la vida en sociedad sea como ciudadano o como consumidor sin restricción alguna. El acceso al Internet no es simple ni barato, implica un conjunto de acciones que requieren intervención del Estado, de varios actores económicos y del propio ciudadano. Asume el tratamiento de las complejidades de este derecho y el desafío para Latinoamérica.

  2. Case Report: Anteromedial temporosphenoidal encephalocele with a clinically silent lateral bony defect in the greater wing of the sphenoid

    International Nuclear Information System (INIS)

    Pandey, Anoop Kumar

    2009-01-01

    Anteromedial temporosphenoidal encephalocele is the least common type of temporal encephalocele. It commonly presents with spontaneous cerebrospinal fluid rhinorrhea in adults. This article presents the CT cisternography and MRI findings of one such case, which also had an associated clinically silent defect in the greater wing of the sphenoid on the same side

  3. Case Report: Anteromedial temporosphenoidal encephalocele with a clinically silent lateral bony defect in the greater wing of the sphenoid

    Directory of Open Access Journals (Sweden)

    Pandey Anoop

    2009-01-01

    Full Text Available Anteromedial temporosphenoidal encephalocele is the least common type of temporal encephalocele. It commonly presents with spontaneous cerebrospinal fluid rhinorrhea in adults. This article presents the CT cisternography and MRI findings of one such case, which also had an associated clinically silent defect in the greater wing of the sphenoid on the same side.

  4. The Effects of the Sustained Silent Reading Program on Cultivating Students' Habits and Attitudes in Reading Books for Leisure

    Science.gov (United States)

    Chua, Siah Poh

    2008-01-01

    The author examines the effects of the sustained silent reading program on cultivating students' habits and attitudes in reading books for leisure. The author used a time-series design and measured students' reading habits and attitudes three times in twelve months. It was expected that if the program created positive effects on cultivating…

  5. The silent information regulator 1 (Sirt1) is a positive regulator of the Notch pathway in Drosophila

    Czech Academy of Sciences Publication Activity Database

    Horváth, Matěj; Mihajlović, Zorana; Slaninová, Věra; Perez-Gomez, Raquel; Moshkin, Y.; Krejčí, Alena

    2016-01-01

    Roč. 473, č. 22 (2016), s. 4129-4143 ISSN 0264-6021 R&D Projects: GA ČR(CZ) GA14-08583S Institutional support: RVO:60077344 Keywords : Drosophila * silent information regulator 1 * Notch pathway Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.797, year: 2016

  6. Towards Contactless Silent Speech Recognition Based on Detection of Active and Visible Articulators Using IR-UWB Radar.

    Science.gov (United States)

    Shin, Young Hoon; Seo, Jiwon

    2016-10-29

    People with hearing or speaking disabilities are deprived of the benefits of conventional speech recognition technology because it is based on acoustic signals. Recent research has focused on silent speech recognition systems that are based on the motions of a speaker's vocal tract and articulators. Because most silent speech recognition systems use contact sensors that are very inconvenient to users or optical systems that are susceptible to environmental interference, a contactless and robust solution is hence required. Toward this objective, this paper presents a series of signal processing algorithms for a contactless silent speech recognition system using an impulse radio ultra-wide band (IR-UWB) radar. The IR-UWB radar is used to remotely and wirelessly detect motions of the lips and jaw. In order to extract the necessary features of lip and jaw motions from the received radar signals, we propose a feature extraction algorithm. The proposed algorithm noticeably improved speech recognition performance compared to the existing algorithm during our word recognition test with five speakers. We also propose a speech activity detection algorithm to automatically select speech segments from continuous input signals. Thus, speech recognition processing is performed only when speech segments are detected. Our testbed consists of commercial off-the-shelf radar products, and the proposed algorithms are readily applicable without designing specialized radar hardware for silent speech processing.

  7. Variability in State-Based Recommendations for Management of Alpha Thalassemia Trait and Silent Carrier Detected on the Newborn Screen.

    Science.gov (United States)

    Fogel, Benjamin N; Nguyen, Hong Loan T; Smink, Gayle; Sekhar, Deepa L

    2018-04-01

    We conducted an inventory of state-based recommendations for follow-up of alpha thalassemia silent carrier and trait identified on newborn screen. We found wide variability in the nature and timing of these recommendations. We recommend a standardized recommendation to guide pediatricians in evidenced-based care for this population. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. Altered Modulation of Silent Period in Tongue Motor Cortex of Persistent Developmental Stuttering in Relation to Stuttering Severity.

    Science.gov (United States)

    Busan, Pierpaolo; Del Ben, Giovanni; Bernardini, Simona; Natarelli, Giulia; Bencich, Marco; Monti, Fabrizio; Manganotti, Paolo; Battaglini, Piero Paolo

    2016-01-01

    Motor balance in developmental stuttering (DS) was investigated with Transcranial Magnetic Stimulation (TMS), with the aim to define novel neural markers of persistent DS in adulthood. Eleven DS adult males were evaluated with TMS on tongue primary motor cortex, compared to 15 matched fluent speakers, in a "state" condition (i.e. stutterers vs. fluent speakers, no overt stuttering). Motor and silent period thresholds (SPT), recruitment curves, and silent period durations were acquired by recording tongue motor evoked potentials. Tongue silent period duration was increased in DS, especially in the left hemisphere (Pstuttering severity. Pre-TMS electromyography data gave overlapping evidence. Findings suggest the existence of a complex intracortical balance in DS tongue primary motor cortex, with a particular interplay between excitatory and inhibitory mechanisms, also in neural substrates related to silent periods. Findings are discussed with respect to functional and structural impairments in stuttering, and are also proposed as novel neural markers of a stuttering "state" in persistent DS, helping to define more focused treatments (e.g. neuro-modulation).

  9. Implementation of IEC Generic Model of Type 1 Wind Turbine Generator in DIgSILENT PowerFactory

    DEFF Research Database (Denmark)

    Zhao, Haoran; Wu, Qiuwei; Margaris, Ioannis

    2013-01-01

    The implementation method for the International Electrotechnical Commission (IEC) generic models of Type 1 wind turbine generator (WTG) in DIgSILENT PowerFactory is presented. The following items are described, i.e. model structure, model blocks and how to implement these blocks in the PowerFactory...

  10. Silent films and strange stories: theory of mind, gender, and social experiences in middle childhood.

    Science.gov (United States)

    Devine, Rory T; Hughes, Claire

    2013-01-01

    In this study of two hundred and thirty 8- to 13-year-olds, a new "Silent Films" task is introduced, designed to address the dearth of research on theory of mind in older children by providing a film-based analogue of F. G. E. Happé's (1994) Strange Stories task. Confirmatory factor analysis showed that all items from both tasks loaded onto a single theory-of-mind latent factor. With effects of verbal ability and family affluence controlled, theory-of-mind latent factor scores increased significantly with age, indicating that mentalizing skills continue to develop through middle childhood. Girls outperformed boys on the theory-of-mind latent factor, and the correlates of individual differences in theory of mind were gender specific: Low scores were related to loneliness in girls and to peer rejection in boys. © 2012 The Authors. Child Development © 2012 Society for Research in Child Development, Inc.

  11. Treatment of Egyptian Maghara coal by plasma ozone synthesized by silent discharge

    CERN Document Server

    Salem, M A; Garamoon, A A; Hassouba, M A

    2003-01-01

    A sample of pyrite rich bituminous coal collected from the main coal seam of Maghara mine, northern sinai, was treated by ozone plasma. The latter was synthesized using silent discharge method (10 kv a.c. and 50 hz). The room temperature Moessbauer spectra of untreated coal sample was easily fitted to two doublet, whose parameters matched those of pyrite (FeS sub 2) and sulfate (FeSO sub 4.H sub 2 O) in addition to hematite. After treatment by ozone plasma, a doublet ascribed to pyrite was observed. The extent of pyrite oxidation to jarosite (Fe sub 2 (SO sub 4) sub 3. nH sub 2 O) was monitored by their relative spectral areas, the incomplete oxidation of pyrite may be attributed to the presence of calcium sulfate layer which acts a screen of ozone.

  12. Analysis of a silent voice: a qualitative inquiry of embroidery created by a patient with schizophrenia.

    Science.gov (United States)

    Blakeman, John R; Samuelson, Sheryl J; McEvoy, Kimberly N

    2013-06-01

    A poster-sized piece of embroidery, completed in the 1960s, hangs in the Glore Psychiatric Museum, a testament to the daily experience of a woman who rarely spoke and was diagnosed with schizophrenia. The embroidery document was analyzed by three researchers who came to agreement on themes via triangulation and constant comparison. The woman's lived experience was considered. The analysis found that although the patient was silent, she was connected in interesting ways to the environment around her. Implications for nursing care include awareness of the importance of milieu to patients, that silence should not be inferred to be detachment, and nurses should continue to develop creative ways to engage patients who may communicate in nontraditional ways. Copyright 2013, SLACK Incorporated.

  13. Enteropathy-associated T cell lymphoma as a complication of silent celiac disease

    Directory of Open Access Journals (Sweden)

    Margarida Dantas Brito

    2014-12-01

    Full Text Available Celiac disease is an autoimmune disorder in which a genetic predisposition and the ingestion of wheat gluten triggers a deleterious immune response. This response is complex and may lead to manifestations other than enteropathyha: hepatitis, dermatitis and neuropathy. There is higher risk for neoplasia. We observed an atypical case, corresponding to a 69-year old female presenting with complicated celiac disease. The patient was referred following the histological examination of an enterectomy specimen, which unexpectedly revealed an enteropathy-associated T cell lymphoma in a background of celiac disease. Patient’s previous medical history comprised several abdominal surgical procedures, without other prior symptoms suggestive of celiac disease. Indeed, the patient was obese and no signs of malabsortion were apparent. This case draws our attention to clinically silent celiac disease, which represents a diagnostic challenge. Thus, this should be kept in mind whenever a patient presents with abdominal relapsing complications, otherwise unexplained.

  14. Rape Survivors' Experiences of the Silent Protest: Implications for Promoting Healing and Resilience.

    Science.gov (United States)

    Padmanabhanunni, Anita; Edwards, David

    2016-05-01

    This article examines the experiences of nine rape survivors who participated in the Silent Protest, an annual protest march at Rhodes University that aims to highlight the sexual abuse of women, validate the harm done, and foster solidarity among survivors. Participants responded to a semi-structured interview focusing on the context of their rape and its impact, and their experiences of participation in the Protest In the first phase of data analysis, synoptic case narratives were written. In the second, themes from participants' experience were identified using interpretative phenomenological analysis. In the third, the data were examined in light of questions around the extent to which participation contributed to healing. Participants reported experiences of validation and empowerment but the majority were suffering from posttraumatic stress disorder. In some cases, participation had exacerbated self-blame and avoidant coping. Recommendations are made about the provision of psychoeducation and counseling at such events. © The Author(s) 2015.

  15. Occurrence of silent cerebral infarction in pre-senile, senile subjects with depressive states

    International Nuclear Information System (INIS)

    Fujikawa, Tokumi; Yamawaki, Shigeto; Touhouda, Yoshikuni.

    1993-01-01

    We examined the relationship between pre-senile, senile depressive states and silent cerebral infarction (SCI) using magnetic resonance imaging (MRI). The diagnostic criteria of major depression according to DSM-3-R was used to diagnose. Patients in whom stroke had occurred or who had local neurologic symptoms were not included. About half of the patients with depressive states of pre-senile onset and most of the patients with those of senile onset had SCI, were considered to be organic-depressive states complicated with SCI. Because patients with depressive states with SCI are at high risk of occurrence of stroke, we designated this condition 'pre-stroke depression', and classified it with endogenous depression. At this time, it is important to begin therapy for cerebrovascular disease. (author)

  16. Silent film: The Carlsberg Foundation’s Oceanographic Expedition Round the World, 1928–30

    DEFF Research Database (Denmark)

    Poulsen, Bo

    2016-01-01

    the surveys conducted onboard, as well as encounters with local populations round the World. This silent film consists of c. 20 different sequences. There is a very instructive introduction to the fishing gear, as it is being deployed in the sea, although this is supplemented by camera shots from what......Danish marine scientist, Johannes Schmidt was also a pioneer when it comes to popularizing deep-sea marine research through the use of mass media. When Schmidt headed the Carlsberg Foundation’s Oceanographical Expedition Round the World, 1928-1930, he brought along a film camera, documenting...... is clearly an aquarium, where the functioning of the water sampler is shown in action. As the Dana moves into the Pacific Ocean the focus of the film also changes. In the sections from the Pacific and Indian Oceans the film includes captions describing the local inhabitants of the Polynesian islands...

  17. Punctuation and Implicit Prosody in Silent Reading: An ERP Study Investigating English Garden-Path Sentences.

    Science.gov (United States)

    Drury, John E; Baum, Shari R; Valeriote, Hope; Steinhauer, Karsten

    2016-01-01

    This study presents the first two ERP reading studies of comma-induced effects of covert (implicit) prosody on syntactic parsing decisions in English. The first experiment used a balanced 2 × 2 design in which the presence/absence of commas determined plausibility (e.g., John, said Mary, was the nicest boy at the party vs. John said Mary was the nicest boy at the party ). The second reading experiment replicated a previous auditory study investigating the role of overt prosodic boundaries in closure ambiguities (Pauker et al., 2011). In both experiments, commas reliably elicited CPS components and generally played a dominant role in determining parsing decisions in the face of input ambiguity. The combined set of findings provides further evidence supporting the claim that mechanisms subserving speech processing play an active role during silent reading.

  18. Harmonic Domain Modelling of Transformer Core Nonlinearities Using the DIgSILENT PowerFactory Software

    DEFF Research Database (Denmark)

    Bak, Claus Leth; Bak-Jensen, Birgitte; Wiechowski, Wojciech

    2008-01-01

    This paper demonstrates the results of implementation and verification of an already existing algorithm that allows for calculating saturation characteristics of singlephase power transformers. The algorithm was described for the first time in 1993. Now this algorithm has been implemented using...... the DIgSILENT Programming Language (DPL) as an external script in the harmonic domain calculations of a power system analysis tool PowerFactory [10]. The algorithm is verified by harmonic measurements on a single-phase power transformer. A theoretical analysis of the core nonlinearities phenomena...... in single and three-phase transformers is also presented. This analysis leads to the conclusion that the method can be applied for modelling nonlinearities of three-phase autotransformers....

  19. Punctuation and Implicit Prosody in Silent Reading: An ERP Study Investigating English Garden-Path Sentences

    Science.gov (United States)

    Drury, John E.; Baum, Shari R.; Valeriote, Hope; Steinhauer, Karsten

    2016-01-01

    This study presents the first two ERP reading studies of comma-induced effects of covert (implicit) prosody on syntactic parsing decisions in English. The first experiment used a balanced 2 × 2 design in which the presence/absence of commas determined plausibility (e.g., John, said Mary, was the nicest boy at the party vs. John said Mary was the nicest boy at the party). The second reading experiment replicated a previous auditory study investigating the role of overt prosodic boundaries in closure ambiguities (Pauker et al., 2011). In both experiments, commas reliably elicited CPS components and generally played a dominant role in determining parsing decisions in the face of input ambiguity. The combined set of findings provides further evidence supporting the claim that mechanisms subserving speech processing play an active role during silent reading. PMID:27695428

  20. Punctuation and implicit prosody in silent reading: An ERP study investigating English garden-path sentences

    Directory of Open Access Journals (Sweden)

    John E. Drury

    2016-09-01

    Full Text Available This study presents the first two ERP reading studies of comma-induced effects of covert (implicit prosody on syntactic parsing decisions in English. The first experiment used a balanced 2 x 2 design in which the presence/absence of commas determined plausibility (e.g., John, said Mary, was the nicest boy at the party versus John said Mary was the nicest boy at the party. The second reading experiment replicated a previous auditory study investigating the role of overt prosodic boundaries in closure ambiguities (Pauker et al., 2011. In both experiments, commas reliably elicited CPS components and generally played a dominant role in determining parsing decisions in the face of input ambiguity. The combined set of findings provides further evidence supporting the claim that mechanisms subserving speech processing play an active role during silent reading.

  1. Modeling of the wind power plant using software DIgSILENT Power factory

    International Nuclear Information System (INIS)

    Mladenovski, Ljubisha; Iliev, Atanas; Fushtikj, Vangel

    2004-01-01

    This paper presents a method for creating a model of the wind power plant NORDEX N-60 in the DIgSILENT Power factory software. At the beginning, the characteristics of the wind power plant and the used software are shortly described. The next step is modeling the part of the power system where the wind power plant will be connected to the grid The modeling of the turbine part and the generator part of the wind power plant is made with blocks, which are part of the machine block of the composite model. Finally, the results obtained from performed practically oriented simulations are presented in graphical form. Design of the model of the wind power plant NORDEX N-60 was performed at the Faculty of Electrical Engineering, at the University of Rostock, Germany, as a part of the DYSIMAC project. (Author)

  2. Clinically silent subdural hemorrhage causes bilateral vocal fold paralysis in newborn infant.

    Science.gov (United States)

    Alshammari, Jaber; Monnier, Yan; Monnier, Philippe

    2012-10-01

    Bilateral congenital vocal fold paralysis (BVFP) may result from multiple etiologies or remain idiopathic when no real cause can be identified. If obstructive dyspnea is significant and requires urgent stabilization of the airway, then intubation is performed first and an MRI of the brain is conducted to rule out an Arnold-Chiari malformation that can benefit from a shunt procedure and thus alleviate the need for a tracheostomy. Clinically silent subdural hemorrhage without any birth trauma represents another cause of neonatal BVFP that resolves spontaneously within a month. It is of clinical relevance to recognize this potential cause of BVFP as its short duration may alleviate the need for a tracheostomy. In this article, we present such a case and review the literature to draw the otolaryngologist's attention to this possible etiology. Copyright © 2012. Published by Elsevier Ireland Ltd.

  3. ULCERA GASTRODUODENAL EM CÃES

    Directory of Open Access Journals (Sweden)

    Francisco Assis Uma Costa

    1993-12-01

    Full Text Available As ulcerações no sistema digestivo de cães são consideradas raras. São descritos dois casos de úlcera gastroduodenal em cães. O primeiro animal apresentou úlcera no duodeno próxima!. O segundo mostrou úlcera perfurada na região pilórica do estômago. Nenhum dos animais apresentou evidências de sangramento, mas as lesões eram profundas e arredondadas. Não houve evidência de patologias concorrentes.

  4. A cost-effectiveness analysis of screening for silent atrial fibrillation after ischaemic stroke.

    Science.gov (United States)

    Levin, Lars-Åke; Husberg, Magnus; Sobocinski, Piotr Doliwa; Kull, Viveka Frykman; Friberg, Leif; Rosenqvist, Mårten; Davidson, Thomas

    2015-02-01

    The purpose of this study was to estimate the cost-effectiveness of two screening methods for detection of silent AF, intermittent electrocardiogram (ECG) recordings using a handheld recording device, at regular time intervals for 30 days, and short-term 24 h continuous Holter ECG, in comparison with a no-screening alternative in 75-year-old patients with a recent ischaemic stroke. The long-term (20-year) costs and effects of all alternatives were estimated with a decision analytic model combining the result of a clinical study and epidemiological data from Sweden. The structure of a cost-effectiveness analysis was used in this study. The short-term decision tree model analysed the screening procedure until the onset of anticoagulant treatment. The second part of the decision model followed a Markov design, simulating the patients' health states for 20 years. Continuous 24 h ECG recording was inferior to intermittent ECG in terms of cost-effectiveness, due to both lower sensitivity and higher costs. The base-case analysis compared intermittent ECG screening with no screening of patients with recent stroke. The implementation of the screening programme on 1000 patients resulted over a 20-year period in 11 avoided strokes and the gain of 29 life-years, or 23 quality-adjusted life years, and cost savings of €55 400. Screening of silent AF by intermittent ECG recordings in patients with a recent ischaemic stroke is a cost-effective use of health care resources saving costs and lives and improving the quality of life. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author 2014. For permissions please email: journals.permissions@oup.com.

  5. Prevalence of silent vertebral fractures detected by vertebral fracture assessment in young Portuguese men with hyperthyroidism.

    Science.gov (United States)

    Barbosa, Ana Paula; Rui Mascarenhas, Mário; Silva, Carlos Francisco; Távora, Isabel; Bicho, Manuel; do Carmo, Isabel; de Oliveira, António Gouveia

    2015-02-01

    Hyperthyroidism is a risk factor for reduced bone mineral density (BMD) and osteoporotic fractures. Vertebral fracture assessment (VFA) by dual-energy X-ray absorptiometry (DXA) is a radiological method of visualization of the spine, which enables patient comfort and reduced radiation exposure. This study was carried out to evaluate BMD and the prevalence of silent vertebral fractures in young men with hyperthyroidism. We conducted a cross-sectional study in a group of Portuguese men aged up to 50 years and matched in hyperthyroidism (n=24) and control (n=24) groups. A group of 48 Portuguese men aged up to 50 years was divided and matched in hyperthyroidism (n=24) and control (n=24) groups. BMD (g/cm(2)) at L1-L4, hip, radius 33%, and whole body as well as the total body masses (kg) were studied by DXA. VFA was used to detect fractures and those were classified by Genant's semiquantitative method. No patient had previously been treated for hyperthyroidism, osteoporosis, or low bone mass. Adequate statistical tests were used. The mean age, height, and total fat mass were similar in both groups (P≥0.05). The total lean body mass and the mean BMD at lumbar spine, hip, and whole body were significantly decreased in the hyperthyroidism group. In this group, there was also a trend for an increased prevalence of reduced BMD/osteoporosis and osteoporotic vertebral fractures. The results obtained using VFA technology (confirmed by X-ray) suggest that the BMD changes in young men with nontreated hyperthyroidism may lead to the development of osteoporosis and vertebral fractures. This supports the pertinence of using VFA in the routine of osteoporosis assessment to detect silent fractures precociously and consider early treatment. © 2015 European Society of Endocrinology.

  6. Prognostic significance of silent myocardial ischemia on a thallium stress test

    International Nuclear Information System (INIS)

    Heller, L.I.; Tresgallo, M.; Sciacca, R.R.; Blood, D.K.; Seldin, D.W.; Johnson, L.L.

    1990-01-01

    The clinical significance of silent ischemia is not fully known. The purpose of this study was to determine whether the presence or absence of angina during a thallium stress test positive for ischemia was independently predictive of an adverse outcome. Two hundred thirty-four consecutive patients with ischemia on a thallium stress test were identified. Ischemia was defined as the presence of defect(s) on the immediate postexercise scans not in the distribution of prior infarctions that redistributed on 4-hour scans. During the test 129 patients had angina, defined as characteristic neck, jaw, arm, back or chest discomfort, while the remaining 105 patients had no angina. Follow-up ranged from 2 to 8.2 years (mean 5.2 +/- 2.1) and was successfully obtained in 156 patients. Eighty-two of the 156 patients had angina (group A) and 74 had silent ischemia (group S). Group A patients were significantly older (62 +/- 8 vs 59 +/- 8 years, p less than 0.05). There was no significant difference between the 2 groups in terms of sex, history of prior infarction or presence of left main/3-vessel disease. A larger percentage of patients in group A were receiving beta blockers (60 vs 41%, p less than 0.05) and nitrates (52 vs 36%, 0.05 less than p less than 0.10). There was a large number of cardiac events (myocardial infarction, revascularization and death) in both groups (37 of 82 [45%] in group A; 28 of 72 [38%] in group S) but no statistically significant difference between the groups. Similarly, life-table analysis revealed no difference in mortality between the 2 groups

  7. Silent myocardial ischemia in patients with symptomatic intracranial atherosclerosis: associated factors.

    Science.gov (United States)

    Arenillas, Juan F; Candell-Riera, Jaume; Romero-Farina, Guillermo; Molina, Carlos A; Chacón, Pilar; Aguadé-Bruix, Santiago; Montaner, Joan; de León, Gustavo; Castell-Conesa, Joan; Alvarez-Sabín, José

    2005-06-01

    Optimization of coronary risk evaluation in stroke patients has been encouraged. The relationship between symptomatic intracranial atherosclerosis and occult coronary artery disease (CAD) has not been evaluated sufficiently. We aimed to investigate the prevalence of silent myocardial ischemia in patients with symptomatic intracranial atherosclerosis and to identify factors associated with its presence. From 186 first-ever transient ischemic attack or ischemic stroke patients with intracranial stenoses, 65 fulfilled selection criteria, including angiographic confirmation of a symptomatic atherosclerotic stenosis and absence of known CAD. All patients underwent a maximal-stress myocardial perfusion single-photon emission computed tomography (SPECT). Lipoprotein(a) [Lp(a)], C-reactive protein, and homocysteine (Hcy) levels were determined before SPECT. Stress-rest SPECT detected reversible myocardial perfusion defects in 34 (52%) patients. Vascular risk factors associated with a pathologic SPECT were hypercholesterolemia (P=0.045), presence of >2 risk factors (P=0.004) and high Lp(a) (P=0.023) and Hcy levels (P=0.018). Ninety percent of patients with high Lp(a) and Hcy levels had a positive SPECT. Existence of a stenosed intracranial internal carotid artery (ICA; odds ratio [OR], 7.22, 2.07 to 25.23; P=0.002) and location of the symptomatic stenosis in vertebrobasilar arteries (OR, 4.89, 1.19 to 20.12; P=0.027) were independently associated with silent myocardial ischemia after adjustment by age, sex, and risk factors. More than 50% of the patients with symptomatic intracranial atherosclerosis and not overt CAD show myocardial perfusion defects on stress-rest SPECT. Stenosed intracranial ICA, symptomatic vertebrobasilar stenosis and presence of high Lp(a) and Hcy levels may characterize the patients at a higher risk for occult CAD.

  8. Silent Majority, Violent Majority: The Counter-Revolution in 70s Cinema

    Directory of Open Access Journals (Sweden)

    Peter Andrew Novick

    2012-12-01

    Full Text Available «There is one question, Inspector Callahan: Why do they call you ‘Dirty Harry’?» Harry, it is explained, «…Hates everybody: Limeys, Micks, Hebes, Fat Degos, Niggers, Honkies, Chinks…especially Spics». Don Siegel’s Dirty Harry (1971, famously labeled «fascist» by prominent film critic Pauline Kael, nonetheless represented something new and unique—the “Silent Majority’s” entry into liberal New Hollywood, a veritable counter-reformation to the new social movements having sprung up in the late Sixties and early Seventies. Far from the traditional American Right, however, and distinctly un-Fascist (in as much as the term means more than a simple epithet, these films acted to unite traditional European philosophy and revolutionary thought with organic conservative American tendencies, resulting in hybrid films which challenged the new social movements, while working within the medium of liberal New American Cinema. The article will address three themes from the era: violence and race in the city, revenge against “liberated women”, and fear and loathing of homosexuality. In each instance, using primary evidence from films and critical reviews from the Seventies and the present era, in addition to American and European theorists, the article will show how the counter-revolution in Seventies cinema failed to expunge the “revolutionary spirit” of the era. Rather, the Silent Majority’s visions of visual violence and reactionary values became part and parcel of the new liberated culture of the “Me Decade,” forever bounding the conservative celluloid revolt to the new cinematic culture.

  9. Reducing calorie sales from supermarkets - 'silent' reformulation of retailer-brand food products.

    Science.gov (United States)

    Jensen, Jørgen Dejgård; Sommer, Iben

    2017-08-23

    Food product reformulation is seen as one among several tools to promote healthier eating. Reformulating the recipe for a processed food, e.g. reducing the fat, sugar or salt content of the foods, or increasing the content of whole-grains, can help the consumers to pursue a healthier life style. In this study, we evaluate the effects on calorie sales of a 'silent' reformulation strategy, where a retail chain's private-label brands are reformulated to a lower energy density without making specific claims on the product. Using an ecological study design, we analyse 52 weeks' sales data - enriched with data on products' energy density - from a Danish retail chain. Sales of eight product categories were studied. Within each of these categories, specific products had been reformulated during the 52 weeks data period. Using econometric methods, we decompose the changes in calorie turnover and sales value into direct and indirect effects of product reformulation. For all considered products, the direct effect of product reformulation was a reduction in the sale of calories from the respective product categories - between 0.5 and 8.2%. In several cases, the reformulation led to indirect substitution effects that were counterproductive with regard to reducing calorie turnover. However, except in two insignificant cases, these indirect substitution effects were dominated by the direct effect of the reformulation, leading to net reductions in calorie sales between -3.1 and 7.5%. For all considered product reformulations, the reformulation had either positive, zero or very moderate negative effects on the sales value of the product category to which the reformulated product belonged. Based on these findings, 'silent' reformulation of retailer's private brands towards lower energy density seems to contribute to lowering the calorie intake in the population (although to a moderate extent) with moderate losses in retailer's sales revenues.

  10. Lithium toxicity precipitated by thyrotoxicosis due to silent thyroiditis: cardiac arrest, quadriplegia, and coma.

    Science.gov (United States)

    Sato, Yoshinori; Taki, Katsumi; Honda, Yuki; Takahashi, Shoichiro; Yoshimura, Ashio

    2013-06-01

    Lithium is widely used to treat bipolar disorders. Lithium toxicity is generally caused by inappropriately high doses of lithium or impaired lithium excretion. Most lithium is eliminated via the kidneys and, since thyroid hormone increases tubular reabsorption of lithium, thyrotoxicosis could contribute to the development of lithium toxicity. We report a case of severe lithium toxicity that was apparently precipitated by the onset of thyrotoxicosis resulting from silent thyroiditis and dehydration. The patient was a 64-year-old woman who was admitted for muscle weakness in the lower extremities, diarrhea, and palpitations. She had bipolar disorder and was being treated with lithium carbonate, which she discontinued one week before admission. Her circulating lithium levels had been monitored yearly. Early in her admission she was dehydrated and had febrile episodes, paroxysmal atrial fibrillation, and muscle weakness. Initially, fluid therapy was started, but she lost consciousness and had a cardiac arrest for 2 minutes due to prolonged sinus arrest. Chest compression and manual artificial ventilation were performed, and body surface pacing was started. Serum lithium was markedly elevated to 3.81 mEq/L (therapeutic range, 0.4-1.0 mEq/L), and thyroid hormone levels were increased (free triiodothyronine, 8.12 pg/mL; free thyroxine, 4.45 ng/dL), while thyrotropin (TSH) was suppressed (quadriplegia and deep coma. She gradually recovered. On day 36, she was discharged without any neurological symptoms or thyrotoxicosis. A 64-year-old woman taking lithium for bipolar disorder developed lithium toxicity in the setting of what seemed likely to be a recent onset of thyrotoxicosis due to silent thyroiditis. Thyrotoxicosis may be a contributing cause of lithium toxicity, particularly if it is abrupt in onset and even with cessation of lithium therapy if renal function is compromised. Thyroid function should be assessed immediately in patients with suspected lithium

  11. Silent music reading: auditory imagery and visuotonal modality transfer in singers and non-singers.

    Science.gov (United States)

    Hoppe, Christian; Splittstößer, Christoph; Fliessbach, Klaus; Trautner, Peter; Elger, Christian E; Weber, Bernd

    2014-11-01

    In daily life, responses are often facilitated by anticipatory imagery of expected targets which are announced by associated stimuli from different sensory modalities. Silent music reading represents an intriguing case of visuotonal modality transfer in working memory as it induces highly defined auditory imagery on the basis of presented visuospatial information (i.e. musical notes). Using functional MRI and a delayed sequence matching-to-sample paradigm, we compared brain activations during retention intervals (10s) of visual (VV) or tonal (TT) unimodal maintenance versus visuospatial-to-tonal modality transfer (VT) tasks. Visual or tonal sequences were comprised of six elements, white squares or tones, which were low, middle, or high regarding vertical screen position or pitch, respectively (presentation duration: 1.5s). For the cross-modal condition (VT, session 3), the visuospatial elements from condition VV (session 1) were re-defined as low, middle or high "notes" indicating low, middle or high tones from condition TT (session 2), respectively, and subjects had to match tonal sequences (probe) to previously presented note sequences. Tasks alternately had low or high cognitive load. To evaluate possible effects of music reading expertise, 15 singers and 15 non-musicians were included. Scanner task performance was excellent in both groups. Despite identity of applied visuospatial stimuli, visuotonal modality transfer versus visual maintenance (VT>VV) induced "inhibition" of visual brain areas and activation of primary and higher auditory brain areas which exceeded auditory activation elicited by tonal stimulation (VT>TT). This transfer-related visual-to-auditory activation shift occurred in both groups but was more pronounced in experts. Frontoparietal areas were activated by higher cognitive load but not by modality transfer. The auditory brain showed a potential to anticipate expected auditory target stimuli on the basis of non-auditory information and

  12. Modeling the spread of polio in an IPV-vaccinated population: lessons learned from the 2013 silent outbreak in southern Israel.

    Science.gov (United States)

    Yaari, Rami; Kaliner, Ehud; Grotto, Itamar; Katriel, Guy; Moran-Gilad, Jacob; Sofer, Danit; Mendelson, Ella; Miller, Elizabeth; Huppert, Amit; Anis, E; Kopel, E; Manor, Y; Mor, O; Shulman, L; Singer, R; Weil, M

    2016-06-23

    Polio eradication is an extraordinary globally coordinated health program in terms of its magnitude and reach, leading to the elimination of wild poliovirus (WPV) in most parts of the world. In 2013, a silent outbreak of WPV was detected in Israel, a country using an inactivated polio vaccine (IPV) exclusively since 2005. The outbreak was detected using environmental surveillance (ES) of sewage reservoirs. Stool surveys indicated the outbreak to be restricted mainly to children under the age of 10 in the Bedouin population of southern Israel. In order to curtail the outbreak, a nationwide vaccination campaign using oral polio vaccine (OPV) was conducted, targeting all children under 10. A transmission model, fitted to the results of the stool surveys, with additional conditions set by the ES measurements, was used to evaluate the prevalence of WPV in Bedouin children and the effectiveness of the vaccination campaign. Employing the parameter estimates of the model fitting, the model was used to investigate the effect of alternative timings, coverages and dosages of the OPV campaign on the outcome of the outbreak. The mean estimate for the mean reproductive number was 1.77 (95 % credible interval, 1.46-2.30). With seasonal variation, the reproductive number maximum range was between zero and six. The mean estimate for the mean infectious periods was 16.8 (8.6-24.9) days. The modeling indicates the OPV campaign was effective in curtailing the outbreak. The mean estimate for the attack rate in Bedouin children under 10 at the end of 2014 was 42 % (22-65 %), whereas without the campaign the mean projected attack rate was 57 % (35-74 %). The campaign also likely shortened the duration of the outbreak by a mean estimate of 309 (2-846) days. A faster initiation of the OPV campaign could have reduced the incidence of WPV even if a lower coverage was reached, at the risk of prolonging the outbreak. OPV campaigns are essential for interrupting WPV transmission, even in a

  13. Excreta Disposal in Dar-es-salaam

    NARCIS (Netherlands)

    Chaggu, E.; Mashouri, D.; Buuren, van J.C.L.; Sanders, W.T.M.; Lettinga, G.

    2002-01-01

    The sociocultural and socioeconomic situation of sanitation in Dar-es-Salaam (Dsm), Tanzania, was studied with explicit emphasis on pit-latrines. Without considering the sociocultural conditions, the so-called best solution might not be the right one. Therefore, in order to achieve the intended

  14. El punto de partida es nuestra identidad

    OpenAIRE

    Alcalde, Pamela

    2016-01-01

    Néstor tiene claro que su identidad es algo primordial en su arte, desde los mantos pre incas de la cultura Paracas hasta el indigenismo con José Sabogal. Además, considera necesario tener una proyección social, buscar que la gente se sienta reflejada en sus obras.

  15. The Origins of dEs

    Science.gov (United States)

    Skillman, Evan D.

    With the new discoveries that some dEs are rotationally supported and that dIs may show a large variety in star formation histories, the perceived relationships between these two families of galaxies are changing. There are at least three viable channels for the origin of dwarf elliptical galaxies with strong observational evidence that support their reality. I will discuss the observational evidence for each of these channels and the likely physical processes which determine each channel.

  16. ¿Que es TeleSUR?

    Directory of Open Access Journals (Sweden)

    Carlos Arcila Calderón

    2014-12-01

    Full Text Available Telesur nace en el seno de proyecto político, de resistencia contra el orden mundial actual, en el convencimiento de que la comunicación es capaz de lograr metas importantes en los procesos de cohesión de las sociedades. El desafío fue crear un medio de comunicación independiente de las empresas comerciales.

  17. ¿Qué es conducta?

    Directory of Open Access Journals (Sweden)

    Esteve Freixa i Baqué

    2003-01-01

    Full Text Available La definición de la Psicología como ciencia de la conducta adoptada por el Conductismo supone e implica a su vez una conceptualización clara y unívoca de dicho concepto. Pero tal definición se enfrenta con una serie de malentendidos tenaces que dificultan no sólo la comprensión de dicho concepto básico sino también, en consecuencia, la propia conceptualización conductista. El propósito del presente trabajo es intentar exponer algunos de estos malentendidos, entre los que destacan los errores categoriales groseros, los procesos de reificación abusiva, los razonamientos tautológicos disfrazados, la generalización imprudente del modelo médico al ámbito de la conducta y la confusión nefasta entre un fenómeno y su conceptualización. Para ello, y con un tono más didáctico que académico, se recurre a una serie de metáforas de la vida cotidiana: la parte escondida del iceberg no es más que iceberg, las piedras no caen por su propio peso, los hombres y las mujeres no mueren porque son mortales, el bacilo de Koch existe y la máscara no es el rostro.

  18. Investigation of low pressure ES-SAGD

    Energy Technology Data Exchange (ETDEWEB)

    Ivory, J.; Zheng, R.; Nasr, T.; Deng, X.; Beaulieu, G.; Heck, G. [Alberta Research Council, Edmonton, AB (Canada)

    2008-10-15

    This paper described a scaled model experiment conducted to investigate the effectiveness of expanding solvent steam assisted gravity drainage (ES-SAGD) processes at low pressures. Lower SAGD pressures typically result in reduced oil production as a result of correspondingly lower steam temperatures. However, lower pressures may also result in a reduced steam to oil ratio (SOR) and a higher vaporization heat. Steam was injected into an injection well at 33 cm{sup 3} per minute and in a production well at 31 cm{sup 3} per minute. Steam and solvents were then co-injected into the injection well at a temperature of 206 degrees C. The experiment was history-matched and a parametric analysis was conducted using a simulation tool. The 2-D and 3-D field-scale simulations investigated the impact of operating pressures, injection rates; sub-cool; oil and gas phase diffusion and dispersion; live oil versus dead oil performance; and the use of drawdown when oil rates declined. Low pressure ES-SAGD was then compared with low-pressure SAGD. Results of the study suggested that production pressures, sub-cool and solvent concentrations are important parameters in ES-SAGD processes. At 1500 kPa production pressure and 10 degrees C sub-cool, the co-injection of solvent with steam increased average oil rates by 15 per cent more than the SAGD process. SOR was also reduced. 6 refs., 8 tabs., 20 figs.

  19. "Silent" Sleep Apnea in Dentofacial Deformities and Prevalence of Daytime Sleepiness After Orthognathic and Intranasal Surgery.

    Science.gov (United States)

    Posnick, Jeffrey C; Adachie, Anayo; Singh, Neeru; Choi, Elbert

    2018-04-01

    The purposes of this study were to determine the occurrence of undiagnosed "silent" obstructive sleep apnea (OSA) in dentofacial deformity (DFD) patients at initial surgical presentation and to report on the level of daytime sleepiness in DFD patients with OSA and chronic obstructive nasal breathing (CONB) after undergoing bimaxillary, chin, and intranasal surgery. A retrospective cohort study of patients with a bimaxillary DFD and CONB was implemented. Patients were divided into those with no OSA (group I) and those with OSA (group II). Group II was further subdivided into patients referred with polysomnogram (PSG)-confirmed OSA (group IIa) and those with a diagnosis of OSA only after surgical consultation, airway evaluation, and a positive PSG (group IIb). Group II patients were analyzed at a minimum of 1 year after surgery (range, 1 to 10 years) for daytime sleepiness with the Epworth Sleepiness Scale. Patients with postoperative excessive daytime sleepiness were assessed for risk factors and continued need for OSA treatment. Patients in group II were studied to determine which DFD patterns were most associated with OSA. We compared the prevalence of OSA between our study population and the general population. Two hundred sixty-two patients met the inclusion criteria. Of these, 23% (60 of 262) had PSG-confirmed OSA (group II). This rate was much higher than that found in the general population. Of the patients, 7% (19 of 262) were known to have OSA at initial surgical consultation (group IIa). An additional 16% (41 of 262) were later confirmed by PSG to have OSA (group IIb). Patients with primary mandibular deficiency and short face DFDs were most likely to have OSA (P surgery. A significant association was found between group II patients with postoperative excessive daytime sleepiness ("sleepy" or "very sleepy") and a preoperative body mass index category of overweight (P = .026). Our study found silent OSA to be frequent in the DFD population. The

  20. "So oft to the movies they've been": British fan writing and female audiences in the silent cinema

    Directory of Open Access Journals (Sweden)

    Lisa Rose Stead

    2011-03-01

    Full Text Available This article aims to address the ways in which working-class and lower-middle-class British women used silent-era fan magazines as a space for articulating their role within the development of a female film culture. The article focuses on letter pages that formed a key site for female contribution to British fan magazines across the silent era. In contributing to these pages, women found a space to debate and discuss the appeal and significance of particular female representations within film culture. Using detailed archival research tracing the content of a specific magazine, Picturegoer, across a 15-year period (1913–28, the article will show the dominance of particular types of female representation in both fan and "official" magazine discourses, analyzing the ways in which British women used these images to work through national tensions regarding modern femininity and traditional ideas of female propriety and restraint.

  1. Alkaline electrolyzer and V2G system DIgSILENT models for demand response analysis in future distribution networks

    DEFF Research Database (Denmark)

    Diaz de Cerio Mendaza, Iker; Bak-Jensen, Birgitte; Chen, Zhe

    2013-01-01

    Grid instabilities originated by unsteady generation, characteristic consequence of some renewable energy resources such as wind and solar power, claims for new power balance solutions in largely penetrated systems. Denmark's solid investment in these energy sources has awaked a need of rethinking...... about the future control and operation of the power system. A widespread idea to face these challenges is to have a flexible demand easily adjustable to the system variations. Electrothermal loads, electric vehicles and hydrogen generation are among the most mentioned technologies capable to respond......, under certain strategies, to these variations. This paper presents two DIgSILENT PowerFactory models: an alkaline electrolyzer and a vehicle to the grid system. The models were performed using DIgSILENT Simulation Language, aiming to be used for long-term distribution systems simulations. Two voltage...

  2. Radio jets and gamma-ray emission in radio-silent narrow-line Seyfert 1 galaxies

    Science.gov (United States)

    Lähteenmäki, A.; Järvelä, E.; Ramakrishnan, V.; Tornikoski, M.; Tammi, J.; Vera, R. J. C.; Chamani, W.

    2018-06-01

    We have detected six narrow-line Seyfert 1 (NLS1) galaxies at 37 GHz that were previously classified as radio silent and two that were classified as radio quiet. These detections reveal the presumption that NLS1 galaxies labelled radio quiet or radio silent and hosted by spiral galaxies are unable to launch jets to be incorrect. The detections are a plausible indicator of the presence of a powerful, most likely relativistic jet because this intensity of emission at 37 GHz cannot be explained by, for example, radiation from supernova remnants. Additionally, one of the detected NLS1 galaxies is a newly discovered source of gamma rays and three others are candidates for future detections. 37 GHz data are only available in electronic form at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/614/L1

  3. Female’s Silent Resistance against Hegemony in The Scarlet Letter, Bekisar Merah, and Belantik: A Comparative Analysis

    Directory of Open Access Journals (Sweden)

    RB. Edi Pramono

    2013-08-01

    Full Text Available Social patriarchy is a gender-biased hegemonic value that is structured for the benefits of men but unfortunately disadvantages women. Lasiyah, the protagonist of Bekisar Merah and Belantik, and Hester Prynne, the protagonist of The Scarlet Letter, experienced those hegemonic values that were oppressive, from their patriarchal societies i.e. Java and Puritans. By using the theories of both Hegemony and Comparative Literature, this discussion reveals the two protagonists’ similar silent resistance against the hegemonic values in that this brought them to become new persons with new personality and identity. They were similarly reborn. Both women had comparable factors driving them to conduct silent resistance: pride, dignity, and love. Woman, who is in general considered weak and powerless, is in fact strong and powerful.

  4. Promises of silent salesman to the FMCG industry: an investigation using linear discriminant analysis approach

    Directory of Open Access Journals (Sweden)

    Shekhar Suraj Kushe

    2015-12-01

    Full Text Available Packaging which is often called as the ‘silent salesman’ is an important component of marketing. Today the importance of packaging has risen to such an extent that product packaging is rightly called as the fifth ‘P’ of marketing mix. FMCG are products which are utilized by large number of people. The present study examined the discriminating power of five selected FMCG packaging variables namely ‘picture’, ‘colour’, ‘size’, ‘shape’ and ‘material’ amidst those who purchased FMCG based on these packaging variables and for those who purchased FMCG not based on these packaging variables. Descriptive research was carried out in the study. Respondents (students were asked to rate four packaging variable on a five point Likert’s scale. Discriminant analysis showed that only two variables namely ‘Colour’ (.706 and ‘Shape’ (–.527 were good predictors. Variables ‘Picture’, ‘size’ and ‘material’ were considered as poor predictors as far as the student communities were considered. The cross validated classification showed that out of the 240 samples drawn, 91.8% of the cases were correctly classified.

  5. Exercise-induced silent myocardial ischemia: Evaluation by thallium-201 emission computed tomography

    International Nuclear Information System (INIS)

    Kurata, C.; Sakata, K.; Taguchi, T.; Kobayashi, A.; Yamazaki, N.

    1990-01-01

    Factors associated with silent myocardial ischemia (SMI) during exercise testing were studied by means of thallium-201 emission computed tomography (ECT) in 471 patients. Coronary angiography was done in 290, of whom 167 were found to have significant coronary artery disease (CAD). Exercise-induced ischemia and its severity were defined with ECT. During exercise 108 (62%) of 173 patients with ischemia and 57 (50%) of 115 with ischemia and angiographically documented CAD had no chest pain. One third of the patients showed an inconsistency between scintigraphic ischemia and ischemia ST depression. Age, sex, prior myocardial infarction, and diabetes mellitus were not related to SMI. Patients with SMI had less severe ischemia despite a higher peak double product compared to those with painful ischemia. Among 91 with prior myocardial infarction and exercise-induced ischemia, 51 with periinfarction ischemia had a higher frequency of SMI than did 14 with ischemia remote from the prior infarct zone despite similarities in the severity of ischemia. In conclusion, factors localized within ischemic myocardium such as less severe ischemia or adjacency to a prior infarct made SMI more prevalent

  6. Synthetic mimetics of the endogenous gastrointestinal nanomineral: Silent constructs that trap macromolecules for intracellular delivery.

    Science.gov (United States)

    Pele, Laetitia C; Haas, Carolin T; Hewitt, Rachel E; Robertson, Jack; Skepper, Jeremy; Brown, Andy; Hernandez-Garrido, Juan Carlos; Midgley, Paul A; Faria, Nuno; Chappell, Helen; Powell, Jonathan J

    2017-02-01

    Amorphous magnesium-substituted calcium phosphate (AMCP) nanoparticles (75-150nm) form constitutively in large numbers in the mammalian gut. Collective evidence indicates that they trap and deliver luminal macromolecules to mucosal antigen presenting cells (APCs) and facilitate gut immune homeostasis. Here, we report on a synthetic mimetic of the endogenous AMCP and show that it has marked capacity to trap macromolecules during formation. Macromolecular capture into AMCP involved incorporation as shown by STEM tomography of the synthetic AMCP particle with 5nm ultra-fine iron (III) oxohydroxide. In vitro, organic cargo-loaded synthetic AMCP was taken up by APCs and tracked to lysosomal compartments. The AMCP itself did not regulate any gene, or modify any gene regulation by its cargo, based upon whole genome transcriptomic analyses. We conclude that synthetic AMCP can efficiently trap macromolecules and deliver them to APCs in a silent fashion, and may thus represent a new platform for antigen delivery. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.

  7. Current perspectives on the etiology and manifestation of the "silent" component of the Female Athlete Triad

    Directory of Open Access Journals (Sweden)

    Mallinson RJ

    2014-05-01

    Full Text Available Rebecca J Mallinson, Mary Jane De SouzaDepartment of Kinesiology, Women's Health and Exercise Laboratory in Noll Laboratory, Pennsylvania State University, University Park, PA, USAAbstract: The Female Athlete Triad (Triad represents a syndrome of three interrelated conditions that originate from chronically inadequate energy intake to compensate for energy expenditure; this environment results in insufficient stored energy to maintain physiological processes, a condition known as low energy availability. The physiological adaptations associated with low energy availability, in turn, contribute to menstrual cycle disturbances. The downstream effects of both low energy availability and suppressed estrogen concentrations synergistically impair bone health, leading to low bone mineral density, compromised bone structure and microarchitecture, and ultimately, a decrease in bone strength. Unlike the other components of the Triad, poor bone health often does not have overt symptoms, and therefore develops silently, unbeknownst to the athlete. Compromised bone health among female athletes increases the risk of fracture throughout the lifespan, highlighting the long-term health consequences of the Triad. The purpose of this review is to examine the current state of Triad research related to the third component of the Triad, ie, poor bone health, in an effort to summarize what we know, what we are learning, and what remains unknown.Keywords: female athlete Triad, bone health, treatment

  8. Importance of 201Tl scintigraphy during exercise for diagnosis of silent myocardial ischemia

    International Nuclear Information System (INIS)

    Kasalicky, J.; Kidery, J.; Svacinka, J.; Vanko, J.; Brunova, J.; Bartos, V.

    1990-01-01

    Using thallium scintigraphy during exercise (TSE), suspect silent myocardial ischemia (SIM) was diagnosed in subjects without angina pectoris. 21 active pilots with suspect SIM were examined after previous exercise ECG as well as 33 patients with diabetes type I and II. In six pilots (28.6%) TSE showed accumulation defects suggesting ischemic disorders of the large coronary arteries. Five pilots showed obvious depressions of the ST segment in ECG during submaximal exercise TSE. In another group of five pilots small depressions of the ST segment were associated with normal TSE. Twelve diabetic patients (36.4%) had minor accumulation defects on TSE. Only two showed a ST depression under 2 mm in ECG during TSE. Based on data in the literature suggesting higher sensitivity and specificity of exercise thallium scintigraphy as compared with exercise ECG and the possibility of a false positive diagnosis of SIM from exercise ECG alone, it is recommended to also use TSE. A more detailed diagnosis of SIM is essential not only with regard to the assessment of work capacity but also for a long-term follow-up of patients with SIM for assessment of its incidence, impact and prognosis in the population. (author). 4 figs., 4 tabs., 25 refs

  9. Screaming Body and Silent Healthcare Providers: A Case Study with a Childhood Sexual Abuse Survivor

    Directory of Open Access Journals (Sweden)

    Sigrun Sigurdardottir

    2018-01-01

    Full Text Available Stressful early life experiences cause immune dysregulation across the lifespan. Despite the fact that studies have identified childhood sexual abuse (CSA survivors as a particularly vulnerable group, only a few attempts have been made to study their lived-experience of the physical health consequences of CSA. The aim of this study was to explore a female CSA survivor’s lived-experience of the physical health consequences of CSA and how she experienced the reactions of healthcare providers. Seven interviews were conducted with this 40-year-old woman, Anne, using a phenomenological research approach. Anne was still a young child (two to three years old when her father started to rape her. Since her childhood, she has experienced complex and widespread physical health consequences such as repeated vaginal and abdominal infections, widespread and chronic pain, sleeping problems, digestive problems, chronic back problems, fibromyalgia, musculoskeletal problems, repeated urinary tract infections, cervical dysplasia, inflammation of the Fallopian tubes, menorrhagia, endometrial hyperplasia, chlamydia, ovarian cysts, ectopic pregnancies, uterus problems, severe adhesions, and ovarian cancer. Anne disclosed her CSA experience to several healthcare providers but they were silent and failed to provide trauma-informed care. Anne’s situation, albeit unique, might reflect similar problems in other female CSA survivors.

  10. Complex behavior in a network with time-dependent connections and silent nodes

    International Nuclear Information System (INIS)

    Marro, J; Torres, J J; Cortes, J M

    2008-01-01

    We studied, both analytically and numerically, excitable networks in which connections are time-dependent and some of the nodes remain silent at each time step, and we show that these two features may induce intriguing functional complexity. More specifically, we consider (a) a heterogeneous distribution of connection weights such that, depending on the current degree of order, some connections are reinforced/weakened with strength Φ on short timescales, and (b) that only a fraction ρ of nodes are simultaneously active. The resulting dynamics has attractors which, for a range of Φ values and ρ exceeding a threshold, become unstable, the instability depending critically on the value of ρ. We observe that (i) the activity describes a trajectory in which the close neighborhood of some of the attractors is constantly visited, (ii) the number of attractors visited increases with ρ, and (iii) the trajectory may change from regular to chaotic and vice versa as ρ is, even slightly modified. Furthermore, (iv) time series show a power-law spectra under conditions in which the attractors' space tends to be most efficiently explored. We argue on the possible qualitative relevance of this phenomenology to networks in several natural contexts

  11. Silent information regulator T1 in aqueous humor of patients with cataract

    Directory of Open Access Journals (Sweden)

    Kondo A

    2016-02-01

    Full Text Available Aki Kondo,1 Mari Goto,2 Tatsuya Mimura,1 Masao Matsubara1 1Department of Ophthalmology, Tokyo Women’s Medical University Medical Center East, 2Tokyo Metropolitan Cancer and Infectious Diseases Center, Komagome Hospital, Tokyo, Japan Purpose: Silent information regulator T1 (SIRT1, a member of the sirtuin family, has a preventive role in various ocular diseases. We evaluated the relations between the aqueous humor level of SIRT1 and age, sex, systemic diseases, the severity of lens opacity, and other factors. Setting: This study was conducted at a university teaching hospital in Tokyo, Japan. Design: This study was designed based on the consecutive case series. Methods: Aqueous humor samples were obtained from 29 eyes of the 21 consecutive patients undergoing surgery for age-related cataract (ARC. SIRT1 levels were determined by enzyme-linked immunosorbent assay. Results: Aqueous humor levels of SIRT1 showed a positive correlation with visual acuity (logarithm of the minimum angle of resolution and with the severity of nuclear cataract (r=0.32 and 0.30, respectively, P<0.05. However, only visual acuity was correlated with SIRT1 according to the stepwise multiple regression analysis (P<0.05. Conclusion: These findings suggest that SIRT1 may have an effect on the formation of ARC, acting as a defensive factor against ARC. Keywords: SIRT1, sirtuin, cataract surgery, oxidative stress, resveratrol, ocular aging

  12. Silent left ventricular dysfunction during routine activity after thrombolytic therapy for acute myocardial infarction

    International Nuclear Information System (INIS)

    Kayden, D.S.; Wackers, F.J.; Zaret, B.L.

    1990-01-01

    To investigate prospectively the occurrence and significance of postinfarction transient left ventricular dysfunction, 33 ambulatory patients who underwent thrombolytic therapy after myocardial infarction were monitored continuously for 187 +/- 56 min during normal activity with a radionuclide left ventricular function detector at the time of hospital discharge. Twelve patients demonstrated 19 episodes of transient left ventricular dysfunction (greater than 0.05 decrease in ejection fraction, lasting greater than or equal to 1 min), with no change in heart rate. Only two episodes in one patient were associated with chest pain and electrocardiographic changes. The baseline ejection fraction was 0.52 +/- 0.12 in patients with transient left ventricular dysfunction and 0.51 +/- 0.13 in patients without dysfunction (p = NS). At follow-up study (19.2 +/- 5.4 months), cardiac events (unstable angina, myocardial infarction or death) occurred in 8 of 12 patients with but in only 3 of 21 patients without transient left ventricular dysfunction (p less than 0.01). During submaximal supine bicycle exercise, only two patients demonstrated a decrease in ejection fraction greater than or equal to 0.05 at peak exercise; neither had a subsequent cardiac event. These data suggest that transient episodes of silent left ventricular dysfunction at hospital discharge in patients treated with thrombolysis after myocardial infarction are common and associated with a poor outcome. Continuous left ventricular function monitoring during normal activity may provide prognostic information not available from submaximal exercise test results

  13. Culturally sensitive strategies designed to target the silent epidemic of hepatitis B in a Filipino community.

    Science.gov (United States)

    Marineau, Michelle; Tice, Alan D; Taylor-Garcia, David; Akinaka, Kenneth T; Lusk, Heather; Ona, Fernando

    2007-06-01

    Hepatitis B is frequent in the Philippines. A high rate of immigration to the United States has brought many Filipinos with infections who are asymptomatic yet will go on to develop liver cancer and cirrhosis unless diagnose and evaluated. Interventions are necessary to educate this ethnic community, identify those infected, and offer therapy. In an effort to reach this high risk population in Hawai'i an intervention program was designed to address the silent epidemic of hepatitis. Ethnic barriers were crossed through involvement of trusted, key stakeholders and individuals within the Filipino health care and church communities, along with groups that had joint missions to address viral hepatitis. After extensive planning and meetings with faith-based organizations and health care providers in the Filipino community, it was decided to hold a community health fair in the Filipino community to provide culturally appropriate health information and services. More than 500 individuals attended the health fair; 167 participated in a survey and were tested for hepatitis B. Significant knowledge gaps were found in relation to risk factors, prevention strategies, and transmission. Five individuals tested positive; all were immigrants and did not know of their disease. The objective to educate people and test them for hepatitis was successful through utilizing ethnic community leaders, religious organizations, health care professionals, and a collaborative health fair.

  14. Temporal integration of sequential auditory events: silent period in sound pattern activates human planum temporale.

    Science.gov (United States)

    Mustovic, Henrietta; Scheffler, Klaus; Di Salle, Francesco; Esposito, Fabrizio; Neuhoff, John G; Hennig, Jürgen; Seifritz, Erich

    2003-09-01

    Temporal integration is a fundamental process that the brain carries out to construct coherent percepts from serial sensory events. This process critically depends on the formation of memory traces reconciling past with present events and is particularly important in the auditory domain where sensory information is received both serially and in parallel. It has been suggested that buffers for transient auditory memory traces reside in the auditory cortex. However, previous studies investigating "echoic memory" did not distinguish between brain response to novel auditory stimulus characteristics on the level of basic sound processing and a higher level involving matching of present with stored information. Here we used functional magnetic resonance imaging in combination with a regular pattern of sounds repeated every 100 ms and deviant interspersed stimuli of 100-ms duration, which were either brief presentations of louder sounds or brief periods of silence, to probe the formation of auditory memory traces. To avoid interaction with scanner noise, the auditory stimulation sequence was implemented into the image acquisition scheme. Compared to increased loudness events, silent periods produced specific neural activation in the right planum temporale and temporoparietal junction. Our findings suggest that this area posterior to the auditory cortex plays a critical role in integrating sequential auditory events and is involved in the formation of short-term auditory memory traces. This function of the planum temporale appears to be fundamental in the segregation of simultaneous sound sources.

  15. Comorbidity of internal derangement of the temporomandibular joint and silent dysfunction of the cervical spine.

    Science.gov (United States)

    Stiesch-Scholz, M; Fink, M; Tschernitschek, H

    2003-04-01

    The aim of this evaluation was to examine correlations between internal derangement of the temporomandibular joint (TMJ) and cervical spine disorder (CSD). A prospective controlled clinical study was carried out. Thirty patients with signs and symptoms of internal derangement but without any subjective neck problems and 30 age- and gender-matched control subjects without signs and symptoms of internal derangement were examined. The investigation of the temporomandibular system was carried out using a 'Craniomandibular Index'. Afterwards an examiner-blinded manual medical investigation of the craniocervical system was performed. This included muscle palpation of the cervical spine and shoulder girdle as well as passive movement tests of the cervical spine, to detect restrictions in the range of movement as well as segmental intervertebral dysfunction. The internal derangement of the TMJ was significantly associated with 'silent' CSD (t-test, P temporomandibular system exhibited significantly more often pain on pressure of the neck muscles than patients without muscle tenderness of the temporomandibular system (t-test, P < 0.05). As a result of the present study, for patients with internal derangement of the TMJ an additional examination of the craniocervical system should be recommended.

  16. Silent sinus syndrome an acquired condition and the essential role of otorhinolaryngologist consultation: a retrospective study.

    Science.gov (United States)

    Martínez-Capoccioni, Gabriel; Varela-Martínez, Ernesto; Martín-Martín, Carlos

    2016-10-01

    The silent sinus syndrome (SSS) is a rare clinical entity characterized by painless spontaneous enophthalmos, hypoglobus, and facial deformities secondary to chronic maxillary sinus atelectasis. The aim of this study was to present an SSS diagnostic feature and evaluate the relationship between nasal septum deviation and maxillary sinus volume. A retrospective chart review of the clinical characteristics of 20 patients diagnosed with SSS between January 2013 and July 2014 were analyzed by the Department of Otorhinolaryngology of University Hospital Complex of Santiago de Compostela. 14 patients were females and six males. The mean age was 43 years (range 28-67 years). The right maxillary sinus was involved in 12 patients and the left maxillary sinus in eight patients. There was no statistical difference between gender and the presence of SSS. Maxillary sinus sizes were significantly smaller on the same side as the deviation (p craneo-caudal photographs. The present study demonstrates that, in adult patients, SSS generally presents a septal deviation to the affected maxillary sinus. We recommend performing a paranasal sinus CT scan when the patient has a deviated nasal septum, retraction of the malar eminence (evidenced from the viewpoint cranio-caudal facial) and hypoglobus. FESS performing postero-anterior uncinectomy and enlargement of the maxillary ostium is recommended to restore sinus pressure and prevent progression of the enophthalmos, hypoglobus and facial deformities.

  17. Packed-bed reactor/silent-discharge plasma design data report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-05-01

    In 1992, Congress passed the Federal Facility Compliance Act requiring the U.S. Department of Energy (DOE) to treat and dispose of its mixed waste in accordance with Resource Conservation and Recovery Act (RCRA) land disposal restrictions (LDRs). The DOE Albuquerque Operations Office (AL) currently does not have adequate systems to treat the mixed wastes generated and stored at the nine DOE-AL sites. In response to the need for mixed-waste treatment capacity, DOE-AL organized a Treatment Selection Team under the Mixed-Waste Treatment Program (MWTP) to match mixed wastes with treatment options and develop a strategy for treatment of its mixed waste. The strategy developed by the Treatment Selection Team, as described in the AL Mixed-Waste Treatment Plan (DOE 1994), is to use available off-site commercial treatment facilities for all wastes that can be successfully and cost-effectively treated by such facilities. Where no appropriate commercial treatment facilities exist, mobile treatment units (MTUs) would be developed to treat wastes at the sites where the wastes are generated. Treatment processes used for mixed waste must not only address the hazardous component (i.e., meet LDRs) but also must contain the radioactive component in a form that allows final disposal while protecting workers, the public, and the environment. The packed-bed reactor/silent discharge plasma was chosen as a potential candidate for the treatment of the mixed wastes. The process is described.

  18. Packed-bed reactor/silent-discharge plasma design data report

    International Nuclear Information System (INIS)

    1996-05-01

    In 1992, Congress passed the Federal Facility Compliance Act requiring the U.S. Department of Energy (DOE) to treat and dispose of its mixed waste in accordance with Resource Conservation and Recovery Act (RCRA) land disposal restrictions (LDRs). The DOE Albuquerque Operations Office (AL) currently does not have adequate systems to treat the mixed wastes generated and stored at the nine DOE-AL sites. In response to the need for mixed-waste treatment capacity, DOE-AL organized a Treatment Selection Team under the Mixed-Waste Treatment Program (MWTP) to match mixed wastes with treatment options and develop a strategy for treatment of its mixed waste. The strategy developed by the Treatment Selection Team, as described in the AL Mixed-Waste Treatment Plan (DOE 1994), is to use available off-site commercial treatment facilities for all wastes that can be successfully and cost-effectively treated by such facilities. Where no appropriate commercial treatment facilities exist, mobile treatment units (MTUs) would be developed to treat wastes at the sites where the wastes are generated. Treatment processes used for mixed waste must not only address the hazardous component (i.e., meet LDRs) but also must contain the radioactive component in a form that allows final disposal while protecting workers, the public, and the environment. The packed-bed reactor/silent discharge plasma was chosen as a potential candidate for the treatment of the mixed wastes. The process is described

  19. Silent Speech Recognition as an Alternative Communication Device for Persons with Laryngectomy.

    Science.gov (United States)

    Meltzner, Geoffrey S; Heaton, James T; Deng, Yunbin; De Luca, Gianluca; Roy, Serge H; Kline, Joshua C

    2017-12-01

    Each year thousands of individuals require surgical removal of their larynx (voice box) due to trauma or disease, and thereby require an alternative voice source or assistive device to verbally communicate. Although natural voice is lost after laryngectomy, most muscles controlling speech articulation remain intact. Surface electromyographic (sEMG) activity of speech musculature can be recorded from the neck and face, and used for automatic speech recognition to provide speech-to-text or synthesized speech as an alternative means of communication. This is true even when speech is mouthed or spoken in a silent (subvocal) manner, making it an appropriate communication platform after laryngectomy. In this study, 8 individuals at least 6 months after total laryngectomy were recorded using 8 sEMG sensors on their face (4) and neck (4) while reading phrases constructed from a 2,500-word vocabulary. A unique set of phrases were used for training phoneme-based recognition models for each of the 39 commonly used phonemes in English, and the remaining phrases were used for testing word recognition of the models based on phoneme identification from running speech. Word error rates were on average 10.3% for the full 8-sensor set (averaging 9.5% for the top 4 participants), and 13.6% when reducing the sensor set to 4 locations per individual (n=7). This study provides a compelling proof-of-concept for sEMG-based alaryngeal speech recognition, with the strong potential to further improve recognition performance.

  20. The diagnosis of silent myocardial ischemia. Motion-Frozen (or morphing) myocardial perfusion imaging.

    Science.gov (United States)

    Chang, Cheng; Ye, Bo; Xie, Wenhui; Zhang, Daoliang; Lei, Bei; Ye, Xiaodan

    2016-01-01

    Silent myocardial ischemia is typically defined as objective evidence of myocardial ischemia in patients without subjective ischemia symptoms. Currently, coronary artery angiography is the gold standard for diagnosis of asymptomatic coronary artery disease (CAD). Computed tomography coronary angiography (CTCA) can visually demonstrate the morphology, trend and extent of coronary stenosis and is commonly used in clinical screening of CAD. Myocardial perfusion imaging can be used not only to identify whether anatomical stenosis causes myocardial dysfunction, but to also assess the risk stratification and prognosis of myocardial disease (MD). Myocardial perfusion imaging using morphing combined with CTCA can simultaneously show the relationship between CAD and myocardial ischemia from an anatomical and functional aspect. This allows earlier diagnosis of asymptomatic CAD myocardial ischemia, accurate identification of the culprit vessels, and could prevent unnecessary interventional therapy. The 1-day dobutamine stress/resting met-hod is also one of the methods used. The combination of CTCA and the morphing technique can provide anatomical and functional information on coronary arteries at the same time, significantly improving the diagnostic sensitivity, specificity, and accuracy of MD.

  1. Syntactically Silent Subjects: Luis Muñoz and the Poetry of Ellipsis

    Directory of Open Access Journals (Sweden)

    Judith Nantell

    2012-06-01

    Full Text Available Luis Muñoz (1966 is one of contemporary Spain’s most salient poets. His work has been described as demonstrating a discourse of ellipsis; yet no study has examined in detail his masterful use of syntactic and figurative omission. In fact, even though Muñoz’s published collections to date span two centuries, no single study has been devoted to his decidedly innovative expressivity. His work has been commented on in various panoramic essays considering contemporary poetry published in Spain at this temporal intersection and a number of his poems have been gathered into noteworthy anthologies of this same era. His poetry has been nominated for prestigious awards in Spain and in 2001 Correspondencias ‘Correspondences’ received the fourth Premio Internacional de Poesía del 27 as well as the Premio de Ojo Crítico de Poesía . The present study examines Muñoz’s most recent Querido silencio (2006 ‘Dear Silence’ where ellipsis figures prominently as the poet maximizes and exploits conceptual and linguistic efficiency. In one exemplary poem, “Dejar la poesía” ‘Leave Poetry,’ two syntactically silent subjects engage in an innovative conversation concerning the nature of poetry. At the same time this intriguing dialogue also offers a unique response to the essential question framing this poem and the collection as a whole: Why is poetry an addiction?

  2. Shortened cortical silent period in adductor spasmodic dysphonia: evidence for widespread cortical excitability.

    Science.gov (United States)

    Samargia, Sharyl; Schmidt, Rebekah; Kimberley, Teresa Jacobson

    2014-02-07

    The purpose of this study was to compare cortical inhibition in the hand region of the primary motor cortex between subjects with focal hand dystonia (FHD), adductor spasmodic dysphonia (AdSD), and healthy controls. Data from 28 subjects were analyzed (FHD n=11, 53.25 ± 8.74 y; AdSD: n=8, 56.38 ± 7.5 y; and healthy controls: n=941.67 ± 10.85 y). All subjects received single pulse TMS to the left motor cortex to measure cortical silent period (CSP) in the right first dorsal interosseus (FDI) muscle. Duration of the CSP was measured and compared across groups. A one-way ANCOVA with age as a covariate revealed a significant group effect (p<0.001). Post hoc analysis revealed significantly longer CSP duration in the healthy group vs. AdSD group (p<0.001) and FHD group (p<0.001). These results suggest impaired intracortical inhibition is a neurophysiologic characteristic of FHD and AdSD. In addition, the shortened CSP in AdSD provides evidence to support a widespread decrease in cortical inhibition in areas of the motor cortex that represent an asymptomatic region of the body. These findings may inform future investigations of differential diagnosis as well as alternative treatments for focal dystonias. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  3. Detecting Silent Data Corruptions in Aerospace-Based Computing Using Program Invariants

    Directory of Open Access Journals (Sweden)

    Junchi Ma

    2016-01-01

    Full Text Available Soft error caused by single event upset has been a severe challenge to aerospace-based computing. Silent data corruption (SDC is one of the results incurred by soft error. SDC occurs when a program generates erroneous output with no indications. SDC is the most insidious type of results and very difficult to detect. To address this problem, we design and implement an invariant-based system called Radish. Invariants describe certain properties of a program; for example, the value of a variable equals a constant. Radish first extracts invariants at key program points and converts invariants into assertions. It then hardens the program by inserting the assertions into the source code. When a soft error occurs, assertions will be found to be false at run time and warn the users of soft error. To increase the coverage of SDC, we further propose an extension of Radish, named Radish_D, which applies software-based instruction duplication mechanism to protect the uncovered code sections. Experiments using architectural fault injections show that Radish achieves high SDC coverage with very low overhead. Furthermore, Radish_D provides higher SDC coverage than that of either Radish or pure instruction duplication.

  4. 201Tl myocardial SPECT and β-endorphin levels in patients with suspected silent ischemia

    International Nuclear Information System (INIS)

    Lind, P.; Binter, G.; Koeltringer, P.; Eber, O.; Eber, B.; Klein, W.; Brandt, D.

    1990-01-01

    Today silent myocardial ischemia (SMI) is a well-recognized phenomenon. Treadmill exercise according to the Bruce protocol, 201 Tl myocardial SPECT and coronary angiography were performed in a total of 106 patients with suspected SMI. In group I (high probability of ischemia; n=46), reversible defects detected by SPECT correlated well with significant stenoses and irreversible defects with subtotal stenoses or complete occlusions. SPECT sensitivity in the detection of ischemia was 91%, its specificity 96%. In group II (low probability of ischemia; n=60), SPECT sensitivity was as high as in group I (94%) but due to a high number of false-positive results (e.g. cardiomyopathy) specificity was only 75%. However, SPECT was superior to exercise ECG (sensitivity 70%; specificity 56%) in the detection of SMI. In addition, β-endorphin levels were determined in 180 healthy subjects, 37 patients with symptomatic CAD and in 34 patients with SMI before and during maximum exercise. Exercise values in patients with SMI were significantly higher than in healthy subjects or in patients with symptomatic CAD. (orig./MG) [de

  5. Evaluation of the sympathetic nervous system in silent ischemia with 123I-metaiodobenzylguanidine (MIBG)

    International Nuclear Information System (INIS)

    Guertner, C.; Schacherer, C.; Krause, B.J.; Zickmann, J.; Klepzig, H. Jr.; Hoer, G.

    1996-01-01

    Stress and rest myocardial perfusion scintigraphy using either Thallium-201 or 99m Tc-isonitrile was performed in SPECT technique in order to localize ischemia or scar associated perfusion defects. 15 min and 4 h p.i. static anterior 123 I-MIBG uptake was acquired. In order to localize norepinephrine depletion 4 h p.i. additional 123 I-MIBG SPECT acquistion was performed. Incidence of arrhythmias was investigated by Holter ECG. Patients with diabetes mellitus were excluded. SPECT images showed in all patients regional 123 I-MIBG depletion which corresponded with scintigraphically infarcted or ischemic regions. Well perfused myocardial regions matched with regular 123 I-MIBG utpake. There was no evidence of increased arrhythmias in long-term ECG. The finding of regular 123 I-MIBG uptake in well-perfused myocardium and infarction- or ischemia-associated regional 123 I-MIBG depletion confirms that silent ischemia is not caused by a global sympathetic nervous dysfunction in a sense of cardiac polyneuropathy. (orig.) [de

  6. Silent slips, trips and broken hips in the under 60s: A review of the literature.

    Science.gov (United States)

    Janes, Gillian; Serrant, Laura; Sque, Magi

    2018-02-24

    This critical review of the literature regarding the recovery experiences and healthcare needs of people under 60 following a fragility hip fracture seeks to identify the associated implications for nursing practice and inform care delivery. Forty papers were included following a structured database, citation and grey literature search and filtering of results in line with specified inclusion criteria. Hip fracture is a common, serious and complex injury and an important cause of morbidity, mortality and rising healthcare costs worldwide. This review indicates that although commonly associated with the elderly, incidence and impact in the under 60s has been under-explored. Current health policy, professional and social norms almost exclusively focus on the elderly, surgical interventions and short-term outcomes, rendering the under 60s an inadvertently marginalised, relatively 'silent' sub-set of the hip fracture population. Nurses must be aware, however, of the different recovery needs of this younger group. The limited evidence available indicates these include work related needs and long term physical and psychosocial limitations in this socially and economically active group. Priorities are identified for research to inform policy and practice. Meanwhile, nurses can address the needs of this group by listening to and involving them and their families as healthcare partners. Copyright © 2018. Published by Elsevier Ltd.

  7. Killing of Pseudomonas aeruginosa by Chicken Cathelicidin-2 Is Immunogenically Silent, Preventing Lung Inflammation In Vivo

    Science.gov (United States)

    Coorens, Maarten; Banaschewski, Brandon J. H.; Baer, Brandon J.; Yamashita, Cory; van Dijk, Albert; Veldhuizen, Ruud A. W.; Veldhuizen, Edwin J. A.

    2017-01-01

    ABSTRACT The development of antibiotic resistance by Pseudomonas aeruginosa is a major concern in the treatment of bacterial pneumonia. In the search for novel anti-infective therapies, the chicken-derived peptide cathelicidin-2 (CATH-2) has emerged as a potential candidate, with strong broad-spectrum antimicrobial activity and the ability to limit inflammation by inhibiting Toll-like receptor 2 (TLR2) and TLR4 activation. However, as it is unknown how CATH-2 affects inflammation in vivo, we investigated how CATH-2-mediated killing of P. aeruginosa affects lung inflammation in a murine model. First, murine macrophages were used to determine whether CATH-2-mediated killing of P. aeruginosa reduced proinflammatory cytokine production in vitro. Next, a murine lung model was used to analyze how CATH-2-mediated killing of P. aeruginosa affects neutrophil and macrophage recruitment as well as cytokine/chemokine production in the lung. Our results show that CATH-2 kills P. aeruginosa in an immunogenically silent manner both in vitro and in vivo. Treatment with CATH-2-killed P. aeruginosa showed reduced neutrophil recruitment to the lung as well as inhibition of cytokine and chemokine production, compared to treatment with heat- or gentamicin-killed bacteria. Together, these results show the potential for CATH-2 as a dual-activity antibiotic in bacterial pneumonia, which can both kill P. aeruginosa and prevent excessive inflammation. PMID:28947647

  8. Silent Crooke’s cell corticotroph adenoma of the pituitary gland presenting as delayed puberty

    Directory of Open Access Journals (Sweden)

    Dinesh Giri

    2017-03-01

    Full Text Available Corticotroph adenomas are extremely rare in children and adolescents. We present a 15-year-old boy who was investigated for delayed puberty (A1P2G1, bilateral testicular volumes of 3 mL each. There was no clinical or laboratory evidence suggestive of chronic illness, and the initial clinical impression was constitutional delay in puberty. Subsequently, MRI scan of the brain revealed the presence of a mixed cystic and solid pituitary lesion slightly displacing the optic chiasma. The lesion was removed by transphenoidal surgery and the biopsy confirmed the lesion to be pituitary adenoma. Furthermore, the adenoma cells also had Crooke’s hyaline changes and were intensely positive for ACTH. However there was no clinical/biochemical evidence of ACTH excess. There was a spontaneous pubertal progression twelve months after the surgery (A2P4G4, with bilateral testicular volume of 8 mL. Crooke’s cell adenoma is an extremely rare and aggressive variant of corticotroph adenoma that can uncommonly present as a silent corticotroph adenoma in adults. We report for the first time Crooke’s cell adenoma in an adolescent boy presenting with delayed puberty.

  9. Relationship between manic state after presenile onset and silent cerebral infarction; MRI findings and its distribution

    Energy Technology Data Exchange (ETDEWEB)

    Fujikawa, Tokumi; Yamawaki, Shigeto (Hiroshima Univ. (Japan). School of Medicine); Touhouda, Yoshikuni

    1993-11-01

    Magnetic resonance (MR) imaging was performed in 12 patients who incurred manic state after the age of 50 (manic group). Twelve other age- and sex-matched patients who incurred emotional disturbance at the young age served as controls. Patients with a history of cerebral stroke and local neurologic symptoms were excluded. Silent cerebral infarction (SCI) were concomitantly seen on MR images in 66.7% in the manic group, which was significantly higher than the control group (16.7%). Approximately half of the patients in the manic group seemed to be in the parenchymal manic state associated with SCI. Patients in the manic state associated with SCI was at a risk for developing cerebral stroke. Therefore, the treatment such as antithrombin therapy for cerebrovascular disorder was considered important, from the viewpoint of early treatment of cerebral infarction. Since lesions were frequently observed in the right frontal lobe and basal nucleus in manic patients with the associated SCI, these sites may be in part involved in the occurrence of manic state. (N.K.).

  10. Toward General Software Level Silent Data Corruption Detection for Parallel Applications

    Energy Technology Data Exchange (ETDEWEB)

    Berrocal, Eduardo; Bautista-Gomez, Leonardo; Di, Sheng; Lan, Zhiling; Cappello, Franck

    2017-12-01

    Silent data corruption (SDC) poses a great challenge for high-performance computing (HPC) applications as we move to extreme-scale systems. Mechanisms have been proposed that are able to detect SDC in HPC applications by using the peculiarities of the data (more specifically, its “smoothness” in time and space) to make predictions. However, these data-analytic solutions are still far from fully protecting applications to a level comparable with more expensive solutions such as full replication. In this work, we propose partial replication to overcome this limitation. More specifically, we have observed that not all processes of an MPI application experience the same level of data variability at exactly the same time. Thus, we can smartly choose and replicate only those processes for which the lightweight data-analytic detectors would perform poorly. In addition, we propose a new evaluation method based on the probability that a corruption will pass unnoticed by a particular detector (instead of just reporting overall single-bit precision and recall). In our experiments, we use four applications dealing with different explosions. Our results indicate that our new approach can protect the MPI applications analyzed with 7–70% less overhead (depending on the application) than that of full duplication with similar detection recall.

  11. Myocardial perfusion scintigraphy in the detection of silent ischemia in asymptomatic diabetic patients

    Energy Technology Data Exchange (ETDEWEB)

    Oki, Glaucia Celeste Rossatto [Clinica Diagnoson and Hospital Aristides Maltez, Salvador, BA (Brazil). Servicos de Medicina Nuclear; Pavin, Elizabeth Joao; Parisi, Maria Candida R. [Universidade Estadual de Campinas (Unicamp), Campinas, SP (Brazil). Department of Internal Medicine. Service of Endocrinology; Coelho, Otavio Rizzi; Almeida, Raitany C. [Universidade Estadual de Campinas (Unicamp), Campinas, SP (Brazil). Department of Internal Medicine. Service of Cardiology; Etchebehere, Elba Cristina Sa de Camargo; Ramos, Celso Dario, E-mail: cdramos@unicamp.br [Universidade Estadual de Campinas (Unicamp), Campinas, SP (Brazil). Department of Radiology. Service of Nuclear Medicine; Camargo, Edwaldo Eduardo [Hospital Sirio-Libanes, Campinas, SP (Brazil). Service of Nuclear Medicine

    2013-01-15

    Objective: This study was aimed to evaluate myocardial perfusion in asymptomatic patients with type 1 (DM1) and type 2 diabetes mellitus (DM2) without previous diagnoses of coronary artery disease (CAD) or cerebral infarction. Materials and Methods: Fifty-nine consecutive asymptomatic patients (16 DM1, 43 DM2) underwent myocardial perfusion scintigraphy with {sup 99m}Tc-sestamibi (MPS). They were evaluated for body mass index, metabolic control of DM, type of therapy, systemic arterial hypertension, dyslipidemia, nephropathy, retinopathy, peripheral neuropathy, smoking, and familial history of CAD. Results: MPS was abnormal in 15 patients (25.4%): 12 (20.3%) with perfusion abnormalities, and 3 with isolated left ventricular dysfunction. The strongest predictors for abnormal myocardial perfusion were: age 60 years and above (p = 0.017; odds ratio [OR] = 6.0), peripheral neuropathy (p = 0.028; OR = 6.1), nephropathy (p = 0.031; OR = 5.6), and stress ECG positive for ischemia (p = 0.049; OR = 4.08). Conclusion: Silent myocardial ischemia occurs in more than one in five asymptomatic diabetic patients. The strongest predictors of ischemia in this study were: patient age, peripheral neuropathy, nephropathy, retinopathy and a stress ECG positive for ischemia. (author)

  12. Myocardial perfusion scintigraphy in the detection of silent ischemia in asymptomatic diabetic patients

    International Nuclear Information System (INIS)

    Oki, Glaucia Celeste Rossatto; Pavin, Elizabeth Joao; Parisi, Maria Candida R.; Coelho, Otavio Rizzi; Almeida, Raitany C.; Etchebehere, Elba Cristina Sa de Camargo; Ramos, Celso Dario; Camargo, Edwaldo Eduardo

    2013-01-01

    Objective: This study was aimed to evaluate myocardial perfusion in asymptomatic patients with type 1 (DM1) and type 2 diabetes mellitus (DM2) without previous diagnoses of coronary artery disease (CAD) or cerebral infarction. Materials and Methods: Fifty-nine consecutive asymptomatic patients (16 DM1, 43 DM2) underwent myocardial perfusion scintigraphy with 99m Tc-sestamibi (MPS). They were evaluated for body mass index, metabolic control of DM, type of therapy, systemic arterial hypertension, dyslipidemia, nephropathy, retinopathy, peripheral neuropathy, smoking, and familial history of CAD. Results: MPS was abnormal in 15 patients (25.4%): 12 (20.3%) with perfusion abnormalities, and 3 with isolated left ventricular dysfunction. The strongest predictors for abnormal myocardial perfusion were: age 60 years and above (p = 0.017; odds ratio [OR] = 6.0), peripheral neuropathy (p = 0.028; OR = 6.1), nephropathy (p = 0.031; OR = 5.6), and stress ECG positive for ischemia (p = 0.049; OR = 4.08). Conclusion: Silent myocardial ischemia occurs in more than one in five asymptomatic diabetic patients. The strongest predictors of ischemia in this study were: patient age, peripheral neuropathy, nephropathy, retinopathy and a stress ECG positive for ischemia. (author)

  13. Ventricular Fibrillation Associated With Dynamic Changes in J-Point Elevation in a Patient With Silent Thyroiditis.

    Science.gov (United States)

    Karashima, Shigehiro; Tsuda, Toyonobu; Wakabayashi, Yusuke; Kometani, Mitsuhiro; Demura, Masashi; Ichise, Taro; Kawashiri, Masa-Aki; Takeda, Yoshiyu; Hayashi, Kenshi; Yoneda, Takashi

    2018-02-01

    A J wave is a common electrocardiographic finding in the general population. Individuals with prominent J waves in multiple electrocardiogram (ECG) leads have a higher risk of lethal arrhythmias than those with low-amplitude J waves. There are few reports about the relationship between thyroid function and J-wave amplitude. We report the case of a 45-year-old man who had unexpected ventricular fibrillation (VF). He had dynamic J-point elevation in multiple ECG leads. Possible early repolarization syndrome was diagnosed. He also had thyrotoxicosis caused by silent thyroiditis, and his J-wave amplitude decreased according to changes in thyroid function because of spontaneous remission of silent thyroiditis. There was a positive correlation between serum triiodothyronine levels and J-wave amplitudes. The findings in case suggested silent thyroiditis may contribute to the occurrence of VF in a patient with dynamic changes in J-point elevation in multiple ECG leads. Thyrotoxicosis is a relatively common endocrine disease; therefore, clinicians should pay attention to J-wave amplitude in the ECG of patients with thyrotoxicosis.

  14. Hypoxia-Induced neonatal seizures diminish silent synapses and long-term potentiation in hippocampal CA1 neurons

    Science.gov (United States)

    Zhou, Chengwen; Bell, Jocelyn J. Lippman; Sun, Hongyu; Jensen, Frances E.

    2012-01-01

    Neonatal seizures can lead to epilepsy and long-term cognitive deficits in adulthood. Using a rodent model of the most common form of human neonatal seizures, hypoxia-induced seizures (HS), we aimed to determine whether these seizures modify long-term potentiation (LTP) and “silent” N-methyl-D-aspartate receptor (NMDAR)-only synapses in hippocampal CA1. At 48-72 hours (hrs) post-HS, electrophysiology and immunofluorescent confocal microscopy revealed a significant decrease in the incidence of silent synapses, and an increase in amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptors (AMPARs) at the synapses. Coincident with this decrease in silent synapses, there was an attenuation of LTP elicited by either tetanic stimulation of Schaffer collaterals or a pairing protocol, and persistent attenuation of LTP in slices removed in later adulthood after P10 HS. Furthermore, post-seizure treatment in vivo with the AMPAR antagonist 2,3-dihydroxy-6-nitro-7-sulfonyl-benzo[f]quinoxaline (NBQX) protected against the HS-induced depletion of silent synapses and preserved LTP. Thus, this study demonstrates a novel mechanism by which early-life seizures could impair synaptic plasticity, suggesting a potential target for therapeutic strategies to prevent long-term cognitive deficits. PMID:22171027

  15. Ventricular Fibrillation Associated With Dynamic Changes in J-Point Elevation in a Patient With Silent Thyroiditis

    Science.gov (United States)

    Tsuda, Toyonobu; Wakabayashi, Yusuke; Kometani, Mitsuhiro; Demura, Masashi; Ichise, Taro; Kawashiri, Masa-aki; Takeda, Yoshiyu; Hayashi, Kenshi; Yoneda, Takashi

    2018-01-01

    A J wave is a common electrocardiographic finding in the general population. Individuals with prominent J waves in multiple electrocardiogram (ECG) leads have a higher risk of lethal arrhythmias than those with low-amplitude J waves. There are few reports about the relationship between thyroid function and J-wave amplitude. We report the case of a 45-year-old man who had unexpected ventricular fibrillation (VF). He had dynamic J-point elevation in multiple ECG leads. Possible early repolarization syndrome was diagnosed. He also had thyrotoxicosis caused by silent thyroiditis, and his J-wave amplitude decreased according to changes in thyroid function because of spontaneous remission of silent thyroiditis. There was a positive correlation between serum triiodothyronine levels and J-wave amplitudes. The findings in case suggested silent thyroiditis may contribute to the occurrence of VF in a patient with dynamic changes in J-point elevation in multiple ECG leads. Thyrotoxicosis is a relatively common endocrine disease; therefore, clinicians should pay attention to J-wave amplitude in the ECG of patients with thyrotoxicosis. PMID:29383332

  16. Silent somatotroph tumour revisited from a study of 80 patients with and without acromegaly and a review of the literature.

    Science.gov (United States)

    Chinezu, Laura; Vasiljevic, Alexandre; Trouillas, Jacqueline; Lapoirie, Marion; Jouanneau, Emmanuel; Raverot, Gérald

    2017-02-01

    Silent somatotroph tumours are growth hormone (GH) immunoreactive (IR) pituitary tumours without clinical and biological signs of acromegaly. Their better characterisation is required to improve the diagnosis. Twenty-one silent somatotroph tumours were compared to 59 somatotroph tumours with acromegaly. Tumours in each group were classified into GH and plurihormonal (GH/prolactin (PRL)/±thyroid-stimulating hormone (TSH)) and into densely granulated (DG) and sparsely granulated (SG) types. The two groups were then compared with regards to proliferation (Ki-67, p53 indexes and mitotic count), differentiation (expression of somatostatin receptors SSTR 2A -SSTR 5 and transcription factor Pit-1) and secretory activity (% of GH- and PRL-IR cells). The silent somatotroph tumours represented 2% of all tested pituitary tumours combined. They were more frequent in women than in men (P = 0.002), more frequently plurihormonal and SG (P acromegaly. They all expressed SSTR 2A , SSTR 5 and Pit-1. The plurihormonal (GH/PRL/±TSH) tumours were mostly observed in women (sex ratio: 3/1) and in patients who were generally younger than those with acromegaly (P acromegaly. A low secretory activity of these tumours might explain the normal plasma values for GH and insulin-like growth factor 1 (IGF1) and the absence of clinical signs of acromegaly. © 2017 European Society of Endocrinology.

  17. ¿Es usted socialmente responsable?

    Directory of Open Access Journals (Sweden)

    Leonel Mosquera

    2016-06-01

    El objetivo de este ensayo es dar a conocer no solo a la comunidad laica sino a la sociedad que nuestra propuesta incluye un cambio de actitud, una revolución de prácticas sociales que serán plasmadas con toda la información detallada de la realización del proyecto antes mencionado y por consiguiente, se realizará la ejecución de un Manual de procedimientos con indicadores de prácticas sociales de la Universidad Laica Vicente Rocafuerte de Guayaquil

  18. ¿Es posible el capitalismo sostenible?

    Directory of Open Access Journals (Sweden)

    James O´Connor

    2000-01-01

    Full Text Available ¿Es posible el capitalismo sostenible? En este artículo se analiza una evidencia relativa a esta pregunta, haciendo énfasis en algunos de los diferentes conceptos de "sostenibilidad" planteados por los verdes y por el sector empresarial. Se hace un breve recuento de las condiciones de sostenibilidad económica y se discute la "primera" contradicción del capitalismo y la naturaleza de la acumulación capitalista, además de un breve examen del proceso de formación de una crisis mundial en la década de los ochenta.

  19. ES 1010 software for testing CAMAC modules

    International Nuclear Information System (INIS)

    Ableev, V.G.; Basiladze, S.G.; Zaporozhets, S.A.; Piskunov, N.M.; Ryabtsov, V.D.; Sitnik, I.M.; Strokovskij, E.A.; Sharov, V.I.

    1977-01-01

    Test programs for digital and analog-digital CAMAC modules applied in physical experiments are described. Algorithms were written in FORTRAN-4 language for testing, data acquisition, processing and data control. ASSEMBLER ES 1010 subroutines were used for data acquisition and CAMAC module control. This allowed one to take advantages of a high level language for data processing and display, as well as for achieving an interface with the CAMAC hardware. Software applied enables one to improve considerably adjustment of CAMAC modules and to obtain their operational characteristics

  20. Un guijarro no es un canto rodado

    Directory of Open Access Journals (Sweden)

    Coronado Castillo, Ángel

    2006-06-01

    Full Text Available The sense or meaning of a word resides in thought and only manifests itself when the word is used. Yet the sense conveyed can be equivocal if the word is taken out of its context, spatial as well as temporal. Considering the present time then, we are dealing with the determination of a space, with exploring around the contextual area. The study that resulted in this paper involves geography, but is no geographical research; at most research on human geography. Although it involves speech, its direct object is not language. Neither it is, in strictness, ethnography nor cultural anthropology. But it concerns all of these fields and, therefore, cannot stay away from any of them. Only one concept, perhaps, overrides the whole undertaking and meets the double condition of being simple and complex at the same time: the concept of elementary area. This concept rests upon the seminal idea of taking the sense and meaning of something (in this case, a name or a noun as the use given to such something (such name or noun in a particular space: a here and a now. One word or signifier, one single meaning; that is all there is. Yet it is this extreme simplification that which allows freedom of speculation, clear and refined.

    El sentido de una palabra está en el pensamiento y sólo se hace manifiesto a través de dicha palabra. Pero la información que conlleva la misma es equívoca si hacemos abstracción de un lugar y de un tiempo. Sea el tiempo actual. Se trata, pues, de la determinación de un lugar, de indagar acerca del territorio. El estudio propuesto trata, pues, de geografía, pero no es geografía; acaso geografía humana. Concierne al habla, pero su objeto directo no es la lengua. No es tampoco, en sentido estricto, etnografía ni antropología cultural. Pero siendo un poco todo ello, no puede prescindir de nada. Sólo uno de sus conceptos, quizá, presida todo el conjunto y reúna la doble condición de ser complejo y a la vez simple:

  1. CAUSAS DE MORTE E RAZÕES PARA EUTANÁSIA DE CÃES

    OpenAIRE

    Rafael Almeida Fighera

    2008-01-01

    A crescente aproximação afetiva entre os cães e o homem fez com que nos últimos anos fosse gerada muita informação científica sobre medicina canina. Entretanto, como a maior parte dessas informações é obtida através da literatura internacional, é comum que os clínicos e patologistas veterinários brasileiros necessitem extrapolar dados referentes à prevalência das diferentes doenças que causam morte de cães para nossa realidade. Baseado nisso, este estudo tem como objetivo principal dete...

  2. Silent circulation of St. Louis encephalitis virus prior to an encephalitis outbreak in Cordoba, Argentina (2005.

    Directory of Open Access Journals (Sweden)

    Luis Adrian Díaz

    2012-01-01

    Full Text Available St. Louis encephalitis virus is a complex zoonoses. In 2005, 47 laboratory-confirmed and probable clinical cases of SLEV infection were reported in Córdoba, Argentina. Although the causes of 2005 outbreak remain unknown, they might be related not only to virological factors, but also to ecological and environmental conditions. We hypothesized that one of the factors for SLE reemergence in Córdoba, Argentina, was the introduction of a new SLEV genotype (SLEV genotype III, with no previous activity in the area. In order to evaluate this hypothesis we carried out a molecular characterization of SLEV detections from mosquitoes collected between 2001 and 2004 in Córdoba city. A total of 315 mosquito pools (11,002 individuals including 12 mosquitoes species were analyzed. Overall, 20 pools (8 mosquitoes species were positive for SLEV. During this study, genotypes II, V and VII were detected. No mosquito pool infected with genotype III was detected before the 2005 outbreak. Genotype V was found every year and in the 8 sampled sites. Genotypes II and VII showed limited temporal and spatial activities. We cannot dismiss the association of genotype II and V as etiological agents during the outbreak. However, the silent circulation of other SLEV strains in Córdoba city before the 2005 outbreak suggests that the introduction of genotype III was an important factor associated to this event. Not mutually exclusive, other factors such as changes in avian hosts and mosquitoes vectors communities, driven by climatic and environmental modifications, should also be taken into consideration in further studies.

  3. Silent Discharge Plasma Technology for the Treatment of Air Toxics and Other Applications

    Energy Technology Data Exchange (ETDEWEB)

    Rosocha, Louis A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Chase, Peter J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gross, Michael P. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    1998-09-21

    Under this CRADA, the Los Alamos National Laboratory (LANL) and High Mesa Technologies, Inc. (HMT) carried out a joint project on the development of the silent discharge plasma (SDP) technology for the treatment of hazardous air pollutants and other hazardous or toxic chemicals. The project had two major components: a technology-demonstration part and a scale-up and commercialization part. In the first part, a small-scale, mobile SDP plasma processor, which was being developed under a CRADA with the Electric Power Research Institute (EPRI) was the mobile equipment was modified for higher capacity service and employed for an innovative remediation technologies demonstration on soil-vapor extraction off-gases at the McClellan Air Force Base near Sacramento, CA. The performance of the SDP system for the variety of volatile organic compounds (VOCs) encountered at the McClellan site was sufficiently promising to the project HMT and LANL worked together to formulate a scale-up strategy and commercialization/manufacturing plan, and to design a prototype scaled-up SDP unit. HMT and LANL are now in the final stages of completing a licensing agreement for the technology and HMT is in the process of raising funds to engineer and manufacture commercial prototype SDP equipment focused on stack-gas emissions control and environmental remediation. HMT, in collaboration with another Northern New Mexico business, Coyote Aerospace, has also been successful in receiving a Phase I Small Business Innovative Research (SBIR) award from the Army Research Office to develop, design, and construct a small non-thermal plasma reactor for laboratory studies ("Non-Thermal Plasma Reactor for Control of Fugitive Emissions of Toxic Gases")

  4. A study on cognitive impairment and gray matter volume abnormalities in silent cerebral infarction patients

    International Nuclear Information System (INIS)

    Luo, Wei; Wei, Xiaofeng; Li, Mengxiong; Jiang, Xun; Li, Shanshan

    2015-01-01

    The relationship between silent cerebral infarction (SCI) and the integrity of cognitive function is unknown. We intended to investigate whether cognitive impairment is associated with gray matter volume (GMV) in the SCI patients. Sixty-two patients with SCI and 62 age- and gender-matched healthy controls (HC) were evaluated with P300 test, Montreal Cognitive Assessment (MoCA) test, Hamilton Anxiety Scale (HAMA), and Hamilton Depression Scale (HDRS). Whole brain high-resolution T1-weighted images were processed with SPM12b software and analyzed by voxel-based morphometry (VBM). Correlation analysis was performed between the GMV and the scores of MoCA Scale, P300 latency, P300 amplitude, HAMA, HDRS, age, and educational level. The brains of the SCI patients have a significant reduction in GMV in the left superior and inferior frontal gyrus, left superior temporal gyrus, right middle temporal gyrus, and bilateral hippocampus gyrus (p < 0.01, FDR correction). No significant increase of GMV was detected. The GMV of their frontal and temporal lobes is positively correlated with the score of MoCA scale and P300 amplitude (r ≥ 0.62, p < 0.01). The GMV of frontal, temporal, and hippocampus is negatively correlated with P300 latency (r ≤ -0.71, p < 0.05). No significant correlation between the GMV of abnormal brain regions and another two clinical characteristics was found. SCI patients have impaired cognitive function and reduced GMV compared to the HC subjects. The neuropathological basis of such cognitive deficits in SCI patients might be a reduced GMV. (orig.)

  5. Lysophosphatidic Acid Level and the Incidence of Silent Brain Infarction in Patients with Nonvalvular Atrial Fibrillation

    Directory of Open Access Journals (Sweden)

    Li Zhou

    2010-10-01

    Full Text Available Lysophosphatidic acid (LPA, which is proposed to play an important role in normal physiological situations such as wound healing, vascular tone, vascular integrity and reproduction, may be involved in the etiology of some diseases such as atherosclerosis, cancer, obesity or myocardial infarction. Abnormal findings, including silent brain infarction (SBI, are frequently observed by magnetic resonance imaging (MRI in patients with nonvalvular atrial fibrillation (NVAF. However, whether there is a relationship between LPA level and the prevalence of SBI has not been extensively studied. In the present study, the association between them was investigated. 235 patients with NVAF, 116 cases of SBI without NVAF and 120 cases of healthy volunteers (control group, who did not receive any antithrombotic therapy, were enrolled in this study. Plasma LPA levels in the NVAF with SBI group were significantly higher than that in the control group (p < 0.01, NVAF without SBI group (p < 0.01 and SBI without NVAF group (p < 0.01. The LPA levels are lower in the control group than in the NVAF without SBI and SBI without NVAF groups (p < 0.01, however, the latter two groups did not significantly differ from each other for LPA levels (p > 0.05 There were significant differences in the positive rate of platelet activation between each of the groups (p < 0.01. The positive rate of platelet activation was significantly higher in the NVAF with SBI group. We suggest that LPA might be a novel marker for estimation of the status of platelet activation and the risk factor for SBI onset in NVAF patients. We expected that plasma LPA levels could predict the occurrence of SBI in NVAF patients.

  6. SILENT MYOCARDIAL ISCHEMIA AND CARDIAC RHYTHM DISTURBANCES IN WOMEN WITH RHEUMATOID ARTHRITIS

    Directory of Open Access Journals (Sweden)

    D. S. Novikova

    2014-07-01

    Full Text Available Objective: to assess the rate of silent myocardial ischemia (SMI and the pattern of cardiac rhythm disturbances in women with rheumatoidarthritis (RA, their association with traditional risk factors (TRF for cardiovascular diseases (CVD, with subclinical structural and functionalchanges in the heart and vessels, with the activity and severity of rheumatoid inflammation.Subjects and methods. Two hundred and ninety-one female patients aged less than 60 years with a valid diagnosis of RA and no clinicalsigns were examined. A control group consisted of 125 women without rheumatic diseases. In addition to the clinical manifestations, activity,and severity of RA, the authors assessed major TRFs for CVD, performed Holter ECG monitoring, common carotid artery duplex scanning, transthoracic echocardiographic study, and determined the levels of serum inflammatory markers.Results. The women with RA differ from the control group in the higher incidence of SMI, supraventricular arrhythmias (SVA and highgradepremature ventricular contractions (PVC. The patients with RA and SMI are characterized in terms of age-adjustment by higher disease activity (DAS28, systemic manifestations, cumulative larger-dose glucocorticoids (GC and a higher percentage of patients receiving disease-modifying anti-rheumatic drugs as compared with those with RA and no SMI with adjustment for age. High disease activity(DAS28, level of inflammatory markers, IgM rheumatoid arthritis seropositivity, and GC therapy are SVA-associated factors in women with RA; larger left ventricular end-diastolic dimension and serositis are factors associated with high-grade PVC.Conclusion. The RA women without clinical manifestations of CVD are recorded to have high rates of SMI, SVA, and high-grade PVC, which is primarily due to the activity and severity of rheumatoid inflammation.

  7. Incidence and predictors of silent embolic cerebral infarction following diagnostic coronary angiography.

    Science.gov (United States)

    Kim, In-Cheol; Hur, Seung-Ho; Park, Nam-Hee; Jun, Dong-Hwan; Cho, Yun-Kyeong; Nam, Chang-Wook; Kim, Hyungseop; Han, Seong-Wook; Choi, Sae-Young; Kim, Yoon-Nyun; Kim, Kwon-Bae

    2011-04-14

    Coronary angiography (CAG) is an invasive diagnostic procedure, which could lead to procedure related complications. One of the well known post-procedural complications is cerebral embolic infarction with or without symptoms. Silent embolic cerebral infarction (SECI) has clinical significance because it can progress to a decline in cognitive function and increase the risk of dementia in the long term. The aim of this study was to detect the incidence and predictors of SECI after diagnostic CAG using diffusion-weighted magnetic resonance imaging (DW-MRI). A total of 197 patients with coronary artery disease who underwent DW-MRI for evaluation of intracranial vasculopathy before coronary artery bypass graft surgery were retrospectively enrolled in the present study. DW-MRI was performed within 48 h after diagnostic CAG. SECI was diagnosed as presence of focal bright high signal intensity in DW-MRI. Patients were divided into groups according to presence/absence of SECI (+ SECI vs. - SECI, respectively). The clinical and angiographic characteristics were analyzed and independent predictors were evaluated. Of the 197 patients, SECI occurred in 20 patients (10.2%) after diagnostic CAG. Age, female gender, frequency of underlying atrial fibrillation, extent of coronary disease, and fluoroscopic time during diagnostic CAG were not different between the + SECI and - SECI groups. Left ventricular ejection fraction was significantly lower in the + SECI group than in the - SECI group (45.9 ± 8.5% vs. 51.4 ± 13.1%, p=0.014) and performance rate of internal mammary artery (IMA) angiography was significantly higher in the + SECI group compared with the - SECI group (85% vs. 37.2%, pSECI (OR=14.642; 95% CI=3.201 to 66.980, p=0.001). The incidence of SECI after diagnostic CAG was not infrequent. Diagnostic CAG with IMA angiography may increase the risk of SECI. Copyright © 2009 Elsevier Ireland Ltd. All rights reserved.

  8. Insufficient platelet inhibition is related to silent embolic cerebral infarctions after coronary angiography.

    Science.gov (United States)

    Kim, Bum Joon; Lee, Seung-Whan; Park, Seong-Wook; Kang, Dong-Wha; Kim, Jong S; Kwon, Sun U

    2012-03-01

    Considering that insufficient platelet inhibition is related to thrombotic complications after coronary angiography, we hypothesized that the extent of platelet inhibition by antiplatelet agents is related to the occurrence of silent embolic cerebral infarction (SECI) after coronary angiography. Among the patients scheduled for coronary artery bypass surgery, we retrospectively analyzed the location of SECI on diffusion-weighted imaging of 272 patients, which was performed after coronary angiography, as a presurgical evaluation in Phase 1 study. In Phase 2 study, we have prospectively recruited 102 patients to compare the extent of platelet inhibition measured by the VerifyNow system among patients with and without SECI. SECI is observed in 45 patients (16.5%) in Phase 1 and 17 (16.7%) in Phase 2. The lesions were slightly more frequent in the right hemisphere. In the Phase 2 study, aspirin reaction units and P(2)Y(12) reaction units were higher in the patients with SECI than those without (aspirin reaction units: 490±72 versus 446±53, P=0.03; P(2)Y(12) reaction units: 352±65 versus 300±77, P=0.009). The incidence of SECI increased with the number of resistant antiplatelets; resistance to both antiplatelet agent (50%), resistance to 1 antiplatelet agent (22%), and no resistance (4%; P=0.023). From the result of logistic regression, higher aspirin reaction units, white blood cell count, low hemoglobin, and nonresponsiveness to antiplatelet agents were independent risk factors. Insufficient platelet inhibition after administration of antiplatelet agents is related with SECI appearing after coronary angiography.

  9. Network-Based Integration of Disparate Omic Data To Identify "Silent Players" in Cancer.

    Directory of Open Access Journals (Sweden)

    Matthew Ruffalo

    2015-12-01

    Full Text Available Development of high-throughput monitoring technologies enables interrogation of cancer samples at various levels of cellular activity. Capitalizing on these developments, various public efforts such as The Cancer Genome Atlas (TCGA generate disparate omic data for large patient cohorts. As demonstrated by recent studies, these heterogeneous data sources provide the opportunity to gain insights into the molecular changes that drive cancer pathogenesis and progression. However, these insights are limited by the vast search space and as a result low statistical power to make new discoveries. In this paper, we propose methods for integrating disparate omic data using molecular interaction networks, with a view to gaining mechanistic insights into the relationship between molecular changes at different levels of cellular activity. Namely, we hypothesize that genes that play a role in cancer development and progression may be implicated by neither frequent mutation nor differential expression, and that network-based integration of mutation and differential expression data can reveal these "silent players". For this purpose, we utilize network-propagation algorithms to simulate the information flow in the cell at a sample-specific resolution. We then use the propagated mutation and expression signals to identify genes that are not necessarily mutated or differentially expressed genes, but have an essential role in tumor development and patient outcome. We test the proposed method on breast cancer and glioblastoma multiforme data obtained from TCGA. Our results show that the proposed method can identify important proteins that are not readily revealed by molecular data, providing insights beyond what can be gleaned by analyzing different types of molecular data in isolation.

  10. A study on cognitive impairment and gray matter volume abnormalities in silent cerebral infarction patients

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Wei; Wei, Xiaofeng; Li, Mengxiong [The First Affiliated Hospital of Yangtze University, Biomedical Engineering Laboratory, Jingzhou, Hubei (China); Jiang, Xun [Renmin Hospital of Wuhan University, Biomedical Engineering Laboratory, Wuhan, Hubei (China); Li, Shanshan [JingZhou City Central Blood Bank, Jingzhou, Hubei (China)

    2015-08-15

    The relationship between silent cerebral infarction (SCI) and the integrity of cognitive function is unknown. We intended to investigate whether cognitive impairment is associated with gray matter volume (GMV) in the SCI patients. Sixty-two patients with SCI and 62 age- and gender-matched healthy controls (HC) were evaluated with P300 test, Montreal Cognitive Assessment (MoCA) test, Hamilton Anxiety Scale (HAMA), and Hamilton Depression Scale (HDRS). Whole brain high-resolution T1-weighted images were processed with SPM12b software and analyzed by voxel-based morphometry (VBM). Correlation analysis was performed between the GMV and the scores of MoCA Scale, P300 latency, P300 amplitude, HAMA, HDRS, age, and educational level. The brains of the SCI patients have a significant reduction in GMV in the left superior and inferior frontal gyrus, left superior temporal gyrus, right middle temporal gyrus, and bilateral hippocampus gyrus (p < 0.01, FDR correction). No significant increase of GMV was detected. The GMV of their frontal and temporal lobes is positively correlated with the score of MoCA scale and P300 amplitude (r ≥ 0.62, p < 0.01). The GMV of frontal, temporal, and hippocampus is negatively correlated with P300 latency (r ≤ -0.71, p < 0.05). No significant correlation between the GMV of abnormal brain regions and another two clinical characteristics was found. SCI patients have impaired cognitive function and reduced GMV compared to the HC subjects. The neuropathological basis of such cognitive deficits in SCI patients might be a reduced GMV. (orig.)

  11. President Rawlings stays silent despite OAU challenge -- an "absence of interest"?

    Science.gov (United States)

    Dodd, R

    1995-12-01

    Ghana's response to AIDS lacks high-level political commitment. This complacency is dangerous. Since 1986 about 16,000 AIDS cases in Ghana have been reported. HIV infection affects about 4% of the adult population; 2-4% of women at prenatal clinics and 6-8% of sexually transmitted disease (STD) patients are infected. Ghana's annual economic growth of 5% induces rural-urban migration and the spread of prostitution. The National Technical Committee on AIDS was formed in 1985, and the first plan of action ran from 1989 to 1993. It covered information, education, and communication, safety of blood supply, and training for health workers in AIDS care. A 1993 survey showed that 90-95% of people know that AIDS is an STD, but only 20% had ever used condoms. The National AIDS Program (NAP) experienced delay in getting its second medium-term plan finalized once the first plan expired in 1993. About 80% of NAP is financed by external donors, and similarly, a greater part of Ghana's health budget is financed externally. International financial institutions have put pressure on Ghana to boost its economic performance as a favorite model. This also means that while the government focuses on economic growth, social sectors are less well-cared for. NAP developed an AIDS impact model to try to get more government help, but without much success. The ministries of education and agriculture carry out some AIDS work, but other activities remain minimal. The minister of health has instituted an annual AIDS awareness month and exempted AIDS patients from paying hospital fees. The AIDS awareness month is each November just prior to World AIDS Day. Despite the availability of donor money, the existing infrastructure cannot absorb it. The main indicator of progress about AIDS is the increased openness about sexual issues. Religious leaders have been silently supportive of condom promotion, and its use is increasing.

  12. Lengthened Cutaneous Silent Period in Fibromyalgia Suggesting Central Sensitization as a Pathogenesis.

    Directory of Open Access Journals (Sweden)

    Seol-Hee Baek

    Full Text Available The pathogenesis of fibromyalgia (FM has not been clearly elucidated, but central sensitization, which plays an important role in the development of neuropathic pain, is considered to be the main mechanism. The cutaneous silent period (CSP, which is a spinal reflex mediated by A-delta cutaneous afferents, is useful for the evaluation of sensorimotor integration at the spinal and supraspinal levels. To understand the pathophysiology of FM, we compared CSP patterns between patients with FM and normal healthy subjects. Twenty-four patients with FM diagnosed in accordance with the 1990 American College of Rheumatology classification system and 24 age- and sex-matched healthy volunteers were recruited. The CSP was measured from the abductor pollicis brevis muscle. Demographic data, number of tender points, and visual analog scale and FM impact questionnaire scores were collected. The measured CSP and clinical parameters of the patient and control groups were compared. In addition, possible correlations between the CSP parameters and the other clinical characteristics were analyzed. Mean CSP latencies did not differ between patients (55.50 ± 10.97 ms and healthy controls (60.23 ± 11.87 ms; p = 0.158, although the mean CSP duration was significantly longer in patients (73.75 ± 15.67 ms than in controls (63.50 ± 14.05 ms; p = 0.021. CSP variables did not correlate with any clinical variables. The significantly longer CSP duration in FM patients suggests central dysregulation at the spinal and supraspinal levels, rather than peripheral small fiber dysfunction.

  13. Cortical Silent Period Reveals Differences Between Adductor Spasmodic Dysphonia and Muscle Tension Dysphonia.

    Science.gov (United States)

    Samargia, Sharyl; Schmidt, Rebekah; Kimberley, Teresa Jacobson

    2016-03-01

    The pathophysiology of adductor spasmodic dysphonia (AdSD), like other focal dystonias, is largely unknown. The purposes of this study were to determine (a) cortical excitability differences between AdSD, muscle tension dysphonia (MTD), and healthy controls; (b) distribution of potential differences in cranial or skeletal muscle; and (c) if cortical excitability measures assist in the differential diagnosis of AdSD and MTD. Ten participants with adductor spasmodic dysphonia, 8 with muscle tension dysphonia, and 10 healthy controls received single and paired pulse transcranial magnetic stimulation (TMS) to the primary motor cortex contralateral to tested muscles, first dorsal interosseus (FDI), and masseter. We tested the hypothesis that cortical excitability measures in AdSD would be significantly different from those in MTD and healthy controls. In addition, we hypothesized that there would be a correlation between cortical excitability measures and clinical voice severity in AdSD. Cortical silent period duration in masseter and FDI was significantly shorter in AdSD than MTD and healthy controls. Other measures failed to demonstrate differences. There are differences in cortical excitability between AdSD, MTD, and healthy controls. These differences in the cortical measure of both the FDI and masseter muscles in AdSD suggest widespread dysfunction of the GABAB mechanism may be a pathophysiologic feature of AdSD, similar to other forms of focal dystonia. Further exploration of the use of TMS to assist in the differential diagnosis of AdSD and MTD is warranted. © The Author(s) 2015.

  14. Importance of anticoagulation and postablation silent cerebral lesions: Subanalyses of REVOLUTION and reMARQable studies.

    Science.gov (United States)

    Grimaldi, Massimo; Swarup, Vijay; DeVille, Brian; Sussman, Jonathan; Jaïs, Pierre; Gaita, Fiorenzo; Duytschaever, Mattias; Ng, G Andre; Daoud, Emile; Lakkireddy, Dhanunjaya Dj; Horton, Rodney; Wickliffe, Andrew; Ellis, Christopher; Geller, Laszlo

    2017-12-01

    Silent cerebral lesions (SCLs) are a potential complication of left atrial radiofrequency ablation (RFA) procedures for paroxysmal atrial fibrillation (PAF). We aimed to compare the incidence of SCLs in patients treated with irrigated RFA multielectrode catheters (nMARQ ® Catheter group) and irrigated focal RFA catheters (NAVISTAR ® THERMOCOOL ® Catheter; TC group) after PAF ablation from subpopulation neurological assessment (SNA) cohorts of the REVOLUTION and reMARQable studies. Data from SNA cohorts in the prospective, nonrandomized REVOLUTION study (March 2011-September 2013) and the prospective, randomized, controlled reMARQable study (October 2013-November 2015) were included. The incidence of SCLs was assessed pre- and postablation using magnetic resonance imaging. Neurological deficits were assessed using the National Institutes of Health Stroke Scale, modified Rankin Scale, and Montreal Cognitive Assessment. A total of 37 patients from REVOLUTION and 76 patients from reMARQable were included in the SNA cohort of each study. In the REVOLUTION SNA cohort, the incidence of SCLs was 21.1% (4/19) in the nMARQ ® Catheter group and 5.9% (1/17) in the TC group. Findings from REVOLUTION helped inform the reMARQable study protocol's stringent anticoagulation regimen. SCL incidence was subsequently reduced in both groups (nMARQ ® Catheter, 7.9%; TC, 3.3%). No permanent neurological deficits were observed. Adherence to a stringent anticoagulation regimen prior to and during ablation procedures appears to be an important factor in minimizing the risk of SCL. © 2017 Wiley Periodicals, Inc.

  15. Angiographic and functional comparison of patients with silent and symptomatic treadmill ischemia early after myocardial infarction

    International Nuclear Information System (INIS)

    Ouyang, P.; Shapiro, E.P.; Chandra, N.C.; Gottlieb, S.H.; Chew, P.H.; Gottlieb, S.O.

    1987-01-01

    Sixty consecutive patients were studied who had positive responses to Naughton exercise treadmill testing (at least 1.5 mm of ST-segment shift in at least 2 leads or thallium reperfusion abnormalities) with or without symptoms of angina 11 +/- 1 days after acute myocardial infarction (AMI). All patients had undergone coronary angiography 24 +/- 4 days after infarction. Thirty-eight patients (63%) had no treadmill angina (silent ischemia, group I) and 22 patients had typical treadmill angina (symptomatic ischemia, group II). Use of beta-blocking drugs, calcium antagonists and nitrates at the time of exercise testing did not differ in the 2 groups. All 9 patients with diabetes mellitus were in the asymptomatic group (p less than 0.40) and group I had a greater proportion of inferior wall AMI (30 of 38) than group II (11 of 22, p = 0.02). Total exercise treadmill test duration (group I 422 +/- 31 seconds, group II 400 +/- 46 seconds) and rate-pressure product were not different in the 2 groups. The number of patients unable to exercise 5 minutes (12 in group I and 7 in group II), the number with diffuse electrocardiographic changes (9 in group I and 7 in group II), and the number with inadequate blood pressure response (8 in group I and 4 in group II) were also similar. At coronary arteriography the mean number of arteries with at least 70% diameter stenosis was 2.0 +/- 0.2 in group I and 2.2 +/- 0.2 in group II (difference not significant)

  16. 45. Ezetimibe and statins yields on silent holter ambulatory myocardial ischemia

    Directory of Open Access Journals (Sweden)

    W. Kadro

    2016-07-01

    Full Text Available Further cholestrol lowering may affect silent ischemia detected on holter monitoring. Cholesterol lowering is associated with a reduction in cardiovascular morbidity and mortality. Statins are the main drugs for cholesterol lowering. Ezetimibe when added to statins gives further reduction in cholesterol but its long-term effect on cardiovascular morbidity and mortality and ischemic events is not known. This study sought to determine whether further cholesterol lowering with ezitimibe will also results in a reduction of myocardial ischemia during daily life. We enrolled 50 patients with proven stable coronary artery disease (CAD and at least one episode of ST-segment depression on ambulatory ECG monitoring. All of them were receiving optimal therapy for CAD including statin therapy for cholesterol reduction. 25 patients were randomized to continue their statin therapy (Statin only group and 25 to recieve statin plus ezitimibe 10 mg/day (ezitimibe group. Serum cholesterol and LDL cholesterol levels and ambulatory monitoring were repeated after 4–6 months of therapy. The two groups were comparable with respect to baseline characteristics, number of episodes of ST-segment depression, and baseline serum cholesterol levels. The ezitimibe group had lower mean total and LDL cholesterol levels at study end and experienced a significant reduction in the number of episodes of ST-segment depression compared with the statin only group. ST-segment depression was completely resolved in 13 of 25 patients (52% in the ezitimibe group versus 3 of 25 (12% in the statin only group. The ezitimibe group exhibited a highly significant reduction in ambulatory ischemia (P < .001. By logistic regression, treatment with ezitimibe was an independent predictor of ischemia resolution. Further cholesterol lowering with ezitimibe can result in reduction or resolution of myocardial ischemia recorded as episodes of ST-segment depression in ambulatory monitoring of the ECG.

  17. Silent gastro-esophageal reflux in children presenting with recurrent lower respiratory tract infections

    International Nuclear Information System (INIS)

    Thomas, E.J.; Bharathi Dasan, J.; Kumar, R.; Chanderashekher, N.; Tripathi, M.; Kabra, S.K.; Malhotra, A.; Kumar, A.; Menon, S.

    2002-01-01

    Introduction: Paediatric respiratory tract infections are one of the most common reasons for physician visits and hospitalisation, and are associated with significant morbidity and mortality. The socioeconomic impact of these recurrent infections is staggering. Gastroesophageal reflux (GER) has long been associated with pulmonary symptoms and diseases. Aims: The present retrospective analysis was undertaken to find out the incidence of GER in children suffering from recurrent lower respiratory tract infections without any typical gastrointestinal (GI) symptoms of GER. Materials and Methods: A total of 297 children with a mean age of 2.7 years and range 9-months to 8 years were evaluated. All studies were performed using a dose of 100-200 micro Curie (3.7-7.4MBq) of Tc99m-sulphur colloid, which was administered via a nasogastric tube into the stomach in younger children. Adequate intragastric volume was ensured by instilling water of 50-ml volume for children less than 6 months and 100-ml volume for children between 6-12 months of age. The nasogastric tube was removed with the patient held in erect position and a small volume of water was pushed to avoid any contamination. In older children the isotope was administered in a capsule and was swallowed with 150-300 ml of water. Results: Of the total 297 children, 111(37%) children had GER on scintigraphy. Conclusion: There is a high incidence of silent GER in children suffering from recurrent lower respiratory tract infections. Scintiscanning can be used as a screening modality in these children

  18. The influences of silent cerebral infarction and hypertension on brain atrophy in normal adults

    International Nuclear Information System (INIS)

    Zhefeng, Quan; Bokura, Hirokazu; Iijima, Kenichi; Oguro, Hiroaki; Yamaguchi, Shuhei

    2008-01-01

    We studied the influences of silent brain infarction (SBI) and hypertension on brain atrophy and its longitudinal progression in healthy adults. MRI scans were performed on 109 neurologically normal adults (mean age, 58.6±5.8 years), with follow-up at an average of 4.9 years later. Patient histories of hypertension, smoking habits, and alcohol consumption were examined. We evaluated brain atrophy using the brain atrophy index (BAI; the ratio of the brain area to the intracranial area) and the ventricular atrophy index (VAI; the ratio of the ventricular area to the brain area) on MRI T1-weighted images at the levels of the basal ganglia and lateral ventricle in horizontal sections. There were no differences in age, sex, dyslipidemia, body mass index (BMI), smoking habit, and alcohol consumption between the normal group and the SBI or hypertension group. The BAI was significantly lower at entry for the SBI (+) group than for the SBI (-) group at both the basal ganglia and lateral ventricle levels (basal ganglia level, p=0.02; and lateral ventricle level, p=0.05). Moreover, the VAI was significantly higher at entry for the SBI (+) group than for the SBI (-) group at the lateral ventricle level (p=0.03). Furthermore, the BAI was significantly lower at entry for the hypertensive group than for the non-hypertensive group at the basal ganglia level (p=0.007). There were no significant differences in the annual variations of the BAI and VAI between the normal group and the SBI (+) or hypertensive group. The present results suggest that the SBI and hypertension are accelerating factors for brain atrophy and ventricular dilatation. (author)

  19. The influences of silent cerebral infarction and hypertension on brain atrophy in normal adults

    Energy Technology Data Exchange (ETDEWEB)

    Zhefeng, Quan; Bokura, Hirokazu; Iijima, Kenichi; Oguro, Hiroaki; Yamaguchi, Shuhei [Shimane Univ., Faculty of Medicine, Izumo, Shimane (Japan)

    2008-03-15

    We studied the influences of silent brain infarction (SBI) and hypertension on brain atrophy and its longitudinal progression in healthy adults. MRI scans were performed on 109 neurologically normal adults (mean age, 58.6{+-}5.8 years), with follow-up at an average of 4.9 years later. Patient histories of hypertension, smoking habits, and alcohol consumption were examined. We evaluated brain atrophy using the brain atrophy index (BAI; the ratio of the brain area to the intracranial area) and the ventricular atrophy index (VAI; the ratio of the ventricular area to the brain area) on MRI T1-weighted images at the levels of the basal ganglia and lateral ventricle in horizontal sections. There were no differences in age, sex, dyslipidemia, body mass index (BMI), smoking habit, and alcohol consumption between the normal group and the SBI or hypertension group. The BAI was significantly lower at entry for the SBI (+) group than for the SBI (-) group at both the basal ganglia and lateral ventricle levels (basal ganglia level, p=0.02; and lateral ventricle level, p=0.05). Moreover, the VAI was significantly higher at entry for the SBI (+) group than for the SBI (-) group at the lateral ventricle level (p=0.03). Furthermore, the BAI was significantly lower at entry for the hypertensive group than for the non-hypertensive group at the basal ganglia level (p=0.007). There were no significant differences in the annual variations of the BAI and VAI between the normal group and the SBI (+) or hypertensive group. The present results suggest that the SBI and hypertension are accelerating factors for brain atrophy and ventricular dilatation. (author)

  20. Dicty_cDB: VSG174 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pslvemlplksnmvslhlsmkmflfavlkth*haqlllvitkri*pk*fhlmlh qvntlvtllspiktmlkspvlhvdinl*t**nkik*nknt Frame B: k*neiiisp...kcfylqfsrpismpnccw*lpkeydrndsi*csir*i hw*rcyhrskqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---k*neiiisplfrscfs

  1. Dicty_cDB: VSG471 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stitsisihtqysnssnnkq**kminplnkpvl gtrlmnsvffpniklqvirnsgktfentnkimfktdcsvgktdiktymkalydvnvdkvn tinvqgriksktk...*kminplnkpvlgtrl mnsvffpniklqvirnsgktfentnkimfktdcsvgktdiktymkalydvnvdkvntinv qgr

  2. Dicty_cDB: VSG367 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lete g... 33 2.8 AJ010151_1( AJ010151 |pid:none) Sordaria macrospora pro1 gene. 33 3.6 CP000462_2015( CP0004...62 |pid:none) Aeromonas hydrophila subsp. hyd... 27 3.7 AJ238536_1( AJ238536 |pid:none) Sordaria

  3. Dicty_cDB: VSG387 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available none) Arenicola marina ribosomal protein... 57 3e-07 BC077676_1( BC077676 |pid:no...ne) Xenopus tropicalis Finkel-Biskis-R... 57 3e-07 protein update 2009. 3.23 PSORT psg: 0.28 gvh: 0.24 alm:

  4. Dicty_cDB: VSG311 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 BD226150 |BD226150.1 Glaucoma therapeutics and diagnostics based on a novel human transcription factor. 44... clone IMAGE:2540850 5', mRNA sequence. 44 1.5 1 I26011 |I26011.1 Sequence 1 from patent US 5556754. 44 1.5

  5. Dicty_cDB: VSG433 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available G08F1 : T3 end of clone MtBC23G08 of cDNA library MtBC from arbuscular mycorrhiza...tula EST MtBC26G02F1 : T3 end of clone MtBC26G02 of cDNA library MtBC from arbuscular mycorrhiza of cultivar

  6. Dicty_cDB: VSG453 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A TATGAAAATANAAT sequence update 2001. 3.22 Translated Amino Acid sequence ltk**milkkrlttlvll*lhflfqnln*rnsq...rkiqh*kknmkix Frame C: ltk**milkkrlttlvll*lhflfqnln*rnsqsnkklylpntlqklvyri*qrslsqkn *ilp*kklkii*kiltdlaeqii*

  7. Dicty_cDB: VSG811 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATN FPQRVFAVKA*ici*milknkiy*kkekx--- Translated Amino Acid seq...LAKIGTVRKAIA RVLTVFNQTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATN FPQRVFAVKA*ici*milk

  8. Dicty_cDB: VSG228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fsppqimiiqyyh*itqhqqqepkeki iqliiiikelerlkdqylkhiqkdmnqn*rmilknlv*vmn*lnqlkriigknqqmfknk lyh*ylkveiqfshqlqvv... ---hasd*islidqrd*ifkifqk*qqqt*y*giv*iiv*fsppqimiiqyyh*itqhqq qepkekiiqliiiikelerlkdqylkhiqkdmnqn*rmilknlv*v... iqliiiikelerlkdqylkhiqkdmnqn*rmilknlv*vmn*lnqlkriigknqqmfknk lyh*ylkveiqfshqlqvvvklvltsyllykf*QLLKGNKLNYLKK

  9. Dicty_cDB: VSG577 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fQ) gene, complete cds. 613 0.0 2 X57944 |X57944.1 Human rotavirus segment 7 gp33 gene. 52 0.005 1 L04534 |L...04534.1 Rotavirus non-structural protein (NS35) gene, complete cds. 52 0.005 1 AB022770 |AB022770.1 Human rotavirus... BAC clone RP11-291E21 from 4, complete sequence. 42 0.011 5 Z21640 |Z21640.1 Bovine rotavirus (Strain RF) m

  10. Assessment on Vulnerable Youths Integration to Dar es Salaam ...

    African Journals Online (AJOL)

    Assessment on Vulnerable Youths Integration to Dar es Salaam Solid Waste ... existing municipal solid waste management crisis facing Dar es Salaam City using ... enabling environment of turning rampant solid waste collection a commercial ...

  11. El significante no es un arquetipo

    OpenAIRE

    Murillo, Manuel

    2014-01-01

    Este artículo forma parte de la investigación de maestría La hipótesis de los tres registros. Sujeto, metapsicología y formalización en psicoanálisis (Murillo, 2010, 2011a, 2011b, 2011c, 2012a, 2012b, 2013a, 2013b) y la investigación UBACyT Lógicas de producción en el campo de investigaciones en psicoanálisis (Azaretto y Ros, 2011). El objetivo de este artículo es desarrollar la referencia de Jung en el desarrollo de la hipótesis de lo simbólico, o de la teoría del simbolismo. Se concluye que...

  12. The promoter for a variant surface glycoprotein gene expression site in Trypanosoma brucei

    NARCIS (Netherlands)

    Zomerdijk, J. C.; Ouellette, M.; ten Asbroek, A. L.; Kieft, R.; Bommer, A. M.; Clayton, C. E.; Borst, P.

    1990-01-01

    The variant-specific surface glycoprotein (VSG) gene 221 of Trypanosoma brucei is transcribed as part of a 60 kb expression site (ES). We have identified the promoter controlling this multigene transcription unit by the use of 221 chromosome-enriched DNA libraries and VSG gene 221 expression site

  13. Il Fuoco or the fatal portrait : the XIXth century in the Italian silent cinema

    NARCIS (Netherlands)

    Blom, I.L.

    1992-01-01

    Dans les années dix de notre siècle, un genre nouveau de film s'installe en Italie aux côtés des grandes productions historiques : le cinéma des divas dont l'histoire-type tourne autour des drames d'un "ménage à trois". Il Fuoco (Giovanni Pastrone, 1915) serait, selon l'auteur, un film moderne qui,

  14. La violencia de pareja: Un enemigo silencioso/Partner violence: a silent enemy

    Directory of Open Access Journals (Sweden)

    Francisco Javier Batiza Álvarez

    2017-01-01

    Full Text Available La violencia en la pareja es un fenómeno silencioso que afecta de diferentes formas a quien la padece, puede ser física, psicológica, intimidatoria, sexual o económica. El problema se puede presentar en el noviazgo o en el matrimonio, empero, son los jóvenes que viven relaciones de noviazgo quienes se están convirtiendo en un grupo vulnerable, insertándose en la espiral de la violencia. Lamentablemente en muchas ocasiones parece imposible salir de un ciclo que comienza con pequeñas bromas hirientes y puede culminar con la muerte de una persona; ya no solo se debe hablar de violencia del hombre contra la mujer, también se debe comenzar a observar la violencia de la mujer contra el hombre o la violencia de parejas que están conformadas por hombre-hombre o mujer-mujer. La importancia que se le debe dar al fenómeno de la violencia de pareja debe ser mayor de la que tiene actualmente, pues si bien es cierto que se ha atacado este fenómeno, también es cierto que existe mucha cifra negra sobre el mismo y los grupos vulnerables que lo padecen cada día son más.

  15. Negotiating Colonial Korean Cinema in the Japanese Empire: From the Silent Era to the Talkies, 1923-1939

    Directory of Open Access Journals (Sweden)

    Chonghwa Chung

    2012-12-01

    Full Text Available This article examines what I call a “system of cooperation” (K. hyŏp’ŏp, J. kyōgyō, 協業 in the colonial Korean film industry from 1923, when silent films appeared, to the late 1930s, when colonial cinema was restructured within an imperial wartime system. In other words, this article examines the interworking of colonial Korean and imperial Japanese cinema from Yun Hae-dong’s “colonial modern” perspective in order to go beyond the long established lens on colonial Korean film and film historiography that merely focused on the contributions of colonial Korean filmmakers. Here the author rather focuses on the cooperation or collaboration between Japan and Korea: Japanese directors and cinematographers working in Korea, Korean filmmakers with experience in the Japanese apprenticeship system, and filmmakers working together and independently during the silent film era. During the transition from the silent to the early talkie eras, second-generation filmmakers, especially those who trained in film studios in Japan, were significant. They dreamed of the corporatization of the colonial Korean film industry and took the lead in coproductions between Japanese film companies and their colonial Korean counterparts. Korean filmmakers were not unilaterally suppressed by imperial Japan, nor did they independently operate within the Korean film industry during the colonial period. The Japanese in colonial Korea did not take the lead in forming the colonial Korean film scene, either. The core formation of colonial Korean / Korean film was a process of Korean and Japanese filmmakers in competition and negotiation with one another within a complex film sphere launched with Japanese capital and technology.

  16. The association between saliva control, silent saliva penetration, aspiration, and videofluoroscopic findings in Parkinson′s disease patients

    Directory of Open Access Journals (Sweden)

    Ali Rajaei

    2015-01-01

    Full Text Available Background: Dysphagia is a common disorder among patients with Parkinson′s disease (PD. It occurs in up to 80% of all (PD patients during the early stages of the disease and up to 95% in the advanced stages; but professionals may not hear from the patients about dysphagia symptoms until these symptoms reach an advanced stage and lead to medical complications. Materials and Methods: Thirty-three PD patients (mean age 66.09 ± 9.4 years; 24 men, nine women participated in this study at our Neurology Institute, between April 20, 2013, and October 26, 2013. They were asked two questions; one about saliva control and the other about silent saliva penetration and aspiration. Next, they underwent the videofluoroscopic swallowing study (VFSS. Results: The Pearson Correlation coefficient between the Penetration-Aspiration Scale (PAS scores and question 1 scores was 0.48 (P < 0.05, =0.25, and there was a significant correlation between the PAS scores and question 2 scores, and also question 1 scores + question 2 scores (r = 0.589, P < 0.05, =0 and r = 0589, P < 0.05, =0. Conclusions: This study showed a significant correlation between the questions about saliva control, silent saliva penetration, and aspiration, and laryngeal penetration and aspiration during VFSS. Therefore, by using these two questions, the potential silent laryngeal penetration and aspiration during meals could be detected before it led to aspiration pneumonia. Taking the benefit of these questions, as a part of the swallowing assessment of PD patients, is recommended.

  17. Measuring theory of mind across middle childhood: Reliability and validity of the Silent Films and Strange Stories tasks.

    Science.gov (United States)

    Devine, Rory T; Hughes, Claire

    2016-09-01

    Recent years have seen a growth of research on the development of children's ability to reason about others' mental states (or "theory of mind") beyond the narrow confines of the preschool period. The overall aim of this study was to investigate the psychometric properties of a task battery composed of items from Happé's Strange Stories task and Devine and Hughes' Silent Film task. A sample of 460 ethnically and socially diverse children (211 boys) between 7 and 13years of age completed the task battery at two time points separated by 1month. The Strange Stories and Silent Film tasks were strongly correlated even when verbal ability and narrative comprehension were taken into account, and all items loaded onto a single theory-of-mind latent factor. The theory-of-mind latent factor provided reliable estimates of performance across a wide range of theory-of-mind ability and showed no evidence of differential item functioning across gender, ethnicity, or socioeconomic status. The theory-of-mind latent factor also exhibited strong 1-month test-retest reliability, and this stability did not vary as a function of child characteristics. Taken together, these findings provide evidence for the validity and reliability of the Strange Stories and Silent Film task battery as a measure of individual differences in theory of mind suitable for use across middle childhood. We consider the methodological and conceptual implications of these findings for research on theory of mind beyond the preschool years. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_TRMM-PFM_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=1998-08-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  19. Negotiating Colonial Korean Cinema in the Japanese Empire: From the Silent Era to the Talkies, 1923-1939

    OpenAIRE

    Chonghwa Chung

    2012-01-01

    This article examines what I call a “system of cooperation” (K. hyŏp’ŏp, J. kyōgyō, 協業) in the colonial Korean film industry from 1923, when silent films appeared, to the late 1930s, when colonial cinema was restructured within an imperial wartime system. In other words, this article examines the interworking of colonial Korean and imperial Japanese cinema from Yun Hae-dong’s “colonial modern” perspective in order to go beyond the long established lens on colonial Korean film and film histori...

  20. The effects of whispering-to-oneself and silent reading on text memory and comprehension in children

    OpenAIRE

    Matsumi, Norio; Furumoto, Yumi; Mitsuke, Ai

    2005-01-01

    An experiment was carried out to investigate the effects of whispering-to-oneself reading on text memory and comprehension in children (6th grade). A2×2 factorial design was used in the experiment: the first independent variable was whispering-to-oneself or silent reading, the second was large- or small-working memory span which were measured by the reading span test (RST). Four aspects of the text memory and comprehension were observed as dependent variables: text memory both on the literal ...

  1. Implementation of IEC Generic Models of Type 1 Wind Turbine Generator in DIgSILENT PowerFactory

    Institute of Scientific and Technical Information of China (English)

    Haoran ZHAO; Qiuwei WU; Ioannis MARGARIS; Poul S(O)RENSEN

    2013-01-01

    The implementation method for the International Electrotechnical Commission (IEC) generic models of Type 1 wind turbine generator (WTG) in DIgSILENT PowerFactory is presented.The following items are described,i.e.model structure,model blocks and how to implement these blocks in the PowerFactory environment.Case studies under both normal and fault conditions are done with the implemented IEC generic models of Type 1 WTG,and dynamic responses are captured and analyzed.The case study results show that the IEC generic models of Type 1 WTG can correctly represent the performances of Type 1 WTG under both normal and fault conditions.

  2. Scintigraphic diagnosis of silent aspiration following double-sided lung transplantation; Szintigraphischer Nachweis einer stillen Aspiration nach beidseitiger Lungentransplantation

    Energy Technology Data Exchange (ETDEWEB)

    Toenshoff, G. [Kiel Univ. (Germany). Klinik fuer Nuklearmedizin; Stock, U. [Kiel Univ. (Germany). Klinik fuer Herz- und Gefaesschirurgie; Bohuslavizki, K.H. [Kiel Univ. (Germany). Klinik fuer Nuklearmedizin; Brenner, W. [Kiel Univ. (Germany). Klinik fuer Nuklearmedizin; Costard-Jaeckle, A. [Kiel Univ. (Germany). Klinik fuer Herz- und Gefaesschirurgie; Cremer, J. [Kiel Univ. (Germany). Klinik fuer Herz- und Gefaesschirurgie; Clausen, M. [Kiel Univ. (Germany). Klinik fuer Nuklearmedizin

    1996-08-01

    We present a case of a 25 year old patient who underwent double-sided lung transplantation and suffered from recurrent pneumonia. Silent aspiration was suspected clinically. Aspiration was proved by scintigraphy enabling to discriminate between direct oro-pulmonal aspiration and aspiration after gastro-esophageal reflux. (orig.) [Deutsch] Vorgestellt wird der Fall einer 25jaehrigen Patientin nach beidseitiger Lungentransplantation und rezidivierenden Pneumonien. Klinisch bestand der Verdacht auf eine stille Aspiration. Szintigraphisch gelang sowohl der Aspirationsnachweis als auch eine Differenzierung hinsichtlich der Genese: Direkte oro-pulmonale Aspiration versus Aspiration nach gastrooesophagealem Reflux. (orig.)

  3. Generational differences in complementary and alternative medicine (CAM) use in the context of chronic diseases and pain: baby boomers versus the silent generation.

    Science.gov (United States)

    Ho, Tiffany F; Rowland-Seymour, Anastasia; Frankel, Eitan S; Li, Susan Q; Mao, Jun J

    2014-01-01

    More people are supplementing conventional medicine with complementary and alternative medicine (CAM), but studies have not compared CAM use between baby boomers (adults born from 1946 to 1964) and the so-called silent generation (born from 1925 to 1945). This study compares CAM usage between baby boomers (n = 7734) and the silent generation (n = 4682) through secondary analyses of the 2007 National Health Interview Survey data. The analysis also compares chronic disease and pain status. Multivariate logistic regression models were developed to identify generational differences. Although the silent generation reported twice as many chronic disease (51.3% vs 26.1%; P painful conditions (56.1% vs 52.2%; P CAM within the past year (43.1% vs 35.4%; P CAM than adults from the silent generation. Chronic pain status was independently associated with greater CAM use (adjusted odds ratio, 2.26; 95% confidence interval, 2.03-2.52). Baby boomers reported significantly higher rates of CAM use than the silent generation for both chronic diseases and painful conditions. Family physicians caring for the aging population must use patient-centered communication about the risks/benefits of CAM, which is necessary to promote effective coping with chronic illnesses and pain. © Copyright 2014 by the American Board of Family Medicine.

  4. Population based prevalence of high blood pressure among adults in Addis Ababa: uncovering a silent epidemic.

    Science.gov (United States)

    Tesfaye, Fikru; Byass, Peter; Wall, Stig

    2009-08-23

    The prevention and control of high blood pressure or other cardiovascular diseases has not received due attention in many developing countries. This study aims to describe the epidemiology of high blood pressure among adults in Addis Ababa, so as to inform policy and lay the ground for surveillance interventions. Addis Ababa is the largest urban centre and national capital of Ethiopia, hosting about 25% of the urban population in the country. A probabilistic sample of adult males and females, 25-64 years of age residing in Addis Ababa city participated in structured interviews and physical measurements. We employed a population based, cross sectional survey, using the World Health Organization instrument for stepwise surveillance (STEPS) of chronic disease risk factors. Data on selected socio-demographic characteristics and lifestyle behaviours, including physical activity, as well as physical measurements such as weight, height, waist and hip circumference, and blood pressure were collected through standardized procedures. Multiple linear regression analysis was performed to estimate the coefficient of variability of blood pressure due to selected socio-demographic and behavioural characteristics, and physical measurements. A total of 3713 adults participated in the study. About 20% of males and 38% of females were overweight (body-mass-index > or = 25 kg/m2), with 10.8 (9.49, 12.11)% of the females being obese (body-mass-index > or = 30 kg/m2). Similarly, 17% of the males and 31% of the females were classified as having low level of total physical activity. The age-adjusted prevalence (95% confidence interval) of high blood pressure, defined as systolic blood pressure (SBP) > or = 140 mmHg (millimetres of mercury) or diastolic blood pressure (DBP) > or = 90 mmHg or reported use of anti-hypertensive medication, was 31.5% (29.0, 33.9) among males and 28.9% (26.8, 30.9) among females. High blood pressure is widely prevalent in Addis Ababa and may represent a silent

  5. Sounds from seeing silent motion: Who hears them, and what looks loudest?

    Science.gov (United States)

    Fassnidge, Christopher J; Freeman, Elliot D

    2018-03-09

    Some people hear what they see: car indicator lights, flashing neon shop signs, and people's movements as they walk may all trigger an auditory sensation, which we call the visual-evoked auditory response (vEAR or 'visual ear'). We have conducted the first large-scale online survey (N > 4000) of this little-known phenomenon. We analysed the prevalence of vEAR, what induces it, and what other traits are associated with it. We assessed prevalence by asking whether respondents had previously experienced vEAR. Participants then rated silent videos for vividness of evoked auditory sensations, and answered additional trait questions. Prevalence appeared higher relative to other typical synaesthesias. Prior awareness and video ratings were associated with greater frequency of other synaesthesias, including flashes evoked by sounds, and musical imagery. Higher-rated videos often depicted meaningful events that predicted sounds (e.g., collisions). However, even videos containing abstract flickering or moving patterns could also elicit higher ratings, despite having no predictable association with sounds. Such videos had higher levels of raw 'motion energy' (ME), which we quantified using a simple computational model of motion processing in early visual cortex. Critically, only respondents reporting prior awareness of vEAR tended to show a positive correlation between video ratings and ME. This specific sensitivity to ME suggests that in vEAR, signals from visual motion processing may affect audition relatively directly without requiring higher-level interpretative processes. Our other findings challenge the popular assumption that individuals with synaesthesia are rare and have ideosyncratic patterns of brain hyper-connectivity. Instead, our findings of apparently high prevalence and broad associations with other synaesthesias and traits are jointly consistent with a common dependence on normal variations in physiological mechanisms of disinhibition or excitability of

  6. Resveratrol Protects Against Pulmonary Arterial Hypertension in Rats via Activation of Silent Information Regulator 1

    Directory of Open Access Journals (Sweden)

    Lei Yu

    2017-05-01

    Full Text Available Background/Objectives: The polyphenol resveratrol (Rev has been found to exhibit various beneficial effects including prevention of pulmonary arterial hypertension (PAH. The present study was designed to investigate the action and potential mechanism of Rev on PAH, focusing on the role of SIRT1 (Silent Information Regulator 1 in apoptosis of pulmonary artery smooth muscle cells (PASMCs. Methods: PAH rats were established by exposure to hypoxia for 21 days. Rev and SRT1720 (a selective SIRT1 activator were used to reverse PAH by gavaging rats. PASMCs were confronted with hypoxia for 24 h or 48 h and were then treated with Rev or SRT1720 in vitro. Western blot was performed to detect the protein expression of SIRT1. CCK-8 and scratch wound experiments were carried out to verify cell proliferation. In addition, the TUNEL positive assay and flow cytometry assay were used to measure PASMC apoptosis. Mitochondrial permeability transition (mPT was identified by confocal microscopy. Right ventricular systolic pressure (RVSP was determined with a Gould pressure transducer, and right ventricular hypertrophy (RVH was determined by weighing the cardiac muscle. Results: We demonstrated that Rev could reverse the remodelling of the pulmonary vasculature, thus contributing to alleviating the severity of PAH. Down-regulation of SIRT1 was observed in PAH, but administration of Rev had no obvious effect on the protein expression of SIRT1. In addition, Rev could induce mitochondrial swelling and nuclear pyknosis, leading to small, dense, and dysmorphic mitochondria in rats exposed to hypoxia alone. Rev treatment inhibited PASMC proliferation in a dose-dependent manner in vitro. Incubation with SRT1720, a specific activator of SIRT1, significantly retarded PASMC proliferation and promoted PASMC apoptosis in vitro. The mechanism could be associated with inducing mPT damage in PASMCs. Rev and SRT1720 treatment mitigated RVSP and reduced RVH. Conclusion: Rev produced

  7. Contribution of silent mutations to thermal adaptation of RNA bacteriophage Qβ.

    Science.gov (United States)

    Kashiwagi, Akiko; Sugawara, Ryu; Sano Tsushima, Fumie; Kumagai, Tomofumi; Yomo, Tetsuya

    2014-10-01

    Changes in protein function and other biological properties, such as RNA structure, are crucial for adaptation of organisms to novel or inhibitory environments. To investigate how mutations that do not alter amino acid sequence may be positively selected, we performed a thermal adaptation experiment using the single-stranded RNA bacteriophage Qβ in which the culture temperature was increased from 37.2°C to 41.2°C and finally to an inhibitory temperature of 43.6°C in a stepwise manner in three independent lines. Whole-genome analysis revealed 31 mutations, including 14 mutations that did not result in amino acid sequence alterations, in this thermal adaptation. Eight of the 31 mutations were observed in all three lines. Reconstruction and fitness analyses of Qβ strains containing only mutations observed in all three lines indicated that five mutations that did not result in amino acid sequence changes but increased the amplification ratio appeared in the course of adaptation to growth at 41.2°C. Moreover, these mutations provided a suitable genetic background for subsequent mutations, altering the fitness contribution from deleterious to beneficial. These results clearly showed that mutations that do not alter the amino acid sequence play important roles in adaptation of this single-stranded RNA virus to elevated temperature. Recent studies using whole-genome analysis technology suggested the importance of mutations that do not alter the amino acid sequence for adaptation of organisms to novel environmental conditions. It is necessary to investigate how these mutations may be positively selected and to determine to what degree such mutations that do not alter amino acid sequences contribute to adaptive evolution. Here, we report the roles of these silent mutations in thermal adaptation of RNA bacteriophage Qβ based on experimental evolution during which Qβ showed adaptation to growth at an inhibitory temperature. Intriguingly, four synonymous mutations and

  8. Silent changes of tuberculosis in Iran (2005-2015: A joinpoint regression analysis

    Directory of Open Access Journals (Sweden)

    Abolfazl Marvi

    2017-01-01

    Full Text Available Introduction and Aim: Tuberculosis (TB poses a severe risk to public health through the world but excessively distresses low-income nations. The aim of this study is to analyze silent changes of TB in Iran (2005–2015: A joinpoint regression analysis. Materials and Methods: This is a trend study conducted on all patients (n = 70 that register in control disease center of Joibar (one of coastal cities and tourism destination in Northern Iran which was recognized as an independent town since 1998 during 2005–2015. The characteristics of patients imported to the SPSS 19 and variation in incidence rate of different forms of pulmonary TB (PTB (PTB+ or PTB– and extra-PTB (EPTB/year was analyzed. Variation in incidence rate of TB for male and female groups and different age groups (0–14, 15–24, 25–34, 35–44, 45–54, 55–64, and above 65 years was analyzed, variation in trend of this diseases for different groups was compared in intended years, and also, variation in incidence rate of TB was analyzed by Joinpoint Regression Software. Results: The total number of TB was 70 cases during 2005–2015. The mean age of patients was 42.31 ± 21.26 years and median age was 40 years. About 71.4% of patients were PTB (55.7% for with PTB+ and 15.7% with PTB– and rest of them (28.4% were EPTB. In regard to classification of cases, 97.1% of them were new cases, 1.45% of them were relapsed cases, and 1.45% of them imported cases. In addition, history of hospitalization due to TB was observed in 44.3%. Conclusion: Despite recent developments of governmental health-care system in Iran and proper access to it and considering this fact that identification of TB cases with passive surveillance is possible. Hence, developing certain programs for sensitization of the covered population is essential.

  9. ¿Es posible objetivar el dolor?

    Directory of Open Access Journals (Sweden)

    DR. S. Mario Campero

    2014-07-01

    Full Text Available El dolor es una experiencia cognitiva como resultado de la activación de nociceptores o descritas en esos términos. El estímulo nociceptivo desencadena la activación de redes neuronales que procesan la información en forma paralela y distribuida, con un componente discriminativo en el tálamo y corteza primaria contra lateral y otro afectivo en la corteza del cíngulo anterior y prefrontal dorsolateral. El dolor como experiencia psíquica solo puede ser objetivado en sus aspectos de activación de las áreas de la así llamada matriz de dolor, mediante la técnica de resonancia magnética funcional. Con el registro de la actividad de nociceptores en sujetos despiertos y en pacientes con dolor neuropático mediante microneurografía se puede relacionar la actividad anormal en estos receptores con la sensación evocada.

  10. Linfossarcoma em cães

    Directory of Open Access Journals (Sweden)

    Fighera Rafael Almeida

    2002-01-01

    Full Text Available O linfossarcoma é uma neoplasia linfóide que se origina em órgão sólido e que, em cães, não tem ainda uma etiologia determinada. O diagnóstico dessa neoplasia pode ser feito tanto por citologia como por histopatologia, embora, muitas vezes, sua diferenciação de leucemia linfóide seja difícil. Vários sinais clínicos são associados com o linfossarcoma canino, a maioria deles relacionada ao órgão na qual o tumor se localiza. Uma manifestação comum é a linfadenopatia generalizada que deve ser diferenciada de outras enfermidades que causam aumento de volume dos linfonodos. Algumas síndromes paraneoplásicas complicam casos de linfossarcoma e, muitas vezes, são responsáveis pela morte do animal. Neste trabalho, são revisados os aspectos clínicos, laboratoriais, as alterações de necropsia e histopatologia do linfossarcoma canino.

  11. La convivencia no es tan obvia

    Directory of Open Access Journals (Sweden)

    Alicia García-Dalmás

    2015-08-01

    Full Text Available La promoción de una mejor convivencia a través de la generación o mejora de espacios públicos, básicamente plazas y parques, sigue siendo una de las principales propuestas con las que las políticas públicas, por lo menos en Uruguay, buscan dar respuesta a lo que identifican como “problemas sociales acuciantes”: la violencia, la inseguridad. El presente artículo toma como base una propuesta, la Estrategia por la Vida y la Convivencia, impulsada por el gobierno nacional que, entre otros aspectos, plantea que “el pacto de convivencia es un pacto de obviedad”. Desde la comunicación propone aproximaciones y preguntas que buscan desnaturalizar lo obvio, profundizar en cómo se construyen vínculos y sentidos en relación a los territorios y la cotidianidad de quienes los habitan.

  12. El Pseudo-Hiepes es Bernardo Polo

    Directory of Open Access Journals (Sweden)

    Jordan, William B.

    2009-12-01

    Full Text Available Nearly fifteen years ago, the author proposed the name Pseudo-Hiepes to refer to a then anonymous painter whom certain Italian art historians had called the Master of the Lombard Fruit Bowl. At the time, he argued for an Aragonese origin in the later part of the century. A signed work has finally been discovered and is published here. The artist was indeed from Zaragoza, and his name is Bernardo Polo.

    Hace unos quince años, el autor propuso el apodo Pseudo-Hiepes para identificar al pintor anónimo a quien algunos entendidos italianos habían bautizado como Maestro del Frutero lombardo. En aquel entonces, argumentó que debía tratarse de un artista aragonés, de la segunda mitad de siglo. Por fin ha aparecido una obra firmada que se presenta aquí. Efectivamente, el artista era zaragozano y su nombre es Bernardo Polo.

  13. La ciudad es un libro abierto

    Directory of Open Access Journals (Sweden)

    Fernando Carrión M.

    2015-01-01

    Full Text Available A nivel urbano se producen cambios en la relación comunicación y ciudad que se expresan en las nuevas formas de articulación interurbana, población-ciudad, gobierno local-sociedad y redes sociales. El autor señala las características que hacen de la ciudad un medio de comunicación y enfatiza en la necesidad de que los municipios trabajen por el fortalecimiento de la articulación social de mediación de lo público. Compara al libro y la ciudad como textos abiertos. Señala que las ciudades tienen una nomenclatura que obliga a ser leídas. La estructura simbólica de la ciudad está compuesta por un conjunto de signos que facilitan el establecimiento de contactos entre la sociedad y el espacio que la contiene, así como la apertura de ámbitos de relación entre la cultura y la naturaleza. La ciudad es un foro de comunicación e información, porque en ella confluye la mayor densidad de medios de comunicación y usuarios; abarca la mayor concentración de lugares de socialización; posee el mayor cúmulo de información concentrada y tiene acumuladas la mayor cantidad de manifestaciones simbólicas.

  14. CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES4_TRMM-PFM_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=1998-08-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  15. La violencia de pareja: Un enemigo silencioso/Partner violence: a silent enemy

    OpenAIRE

    Francisco Javier Batiza Álvarez

    2017-01-01

    La violencia en la pareja es un fenómeno silencioso que afecta de diferentes formas a quien la padece, puede ser física, psicológica, intimidatoria, sexual o económica. El problema se puede presentar en el noviazgo o en el matrimonio, empero, son los jóvenes que viven relaciones de noviazgo quienes se están convirtiendo en un grupo vulnerable, insertándose en la espiral de la violencia. Lamentablemente en muchas ocasiones parece imposible salir de un ciclo que comienza con pequeñas bromas hi...

  16. CERES ERBE-like Instantaneous TOA Estimates (ES-8) in HDF (CER_ES8_TRMM-PFM_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ES-8 archival data product contains a 24-hour, single-satellite, instantaneous view of scanner fluxes at the top-of-atmosphere (TOA) reduced from spacecraft altitude unfiltered radiances using Earth Radiation Budget Experiment (ERBE) scanner Inversion algorithms and the ERBE shortwave (SW) and longwave (LW) Angular Distribution Models (ADMs). The ES-8 also includes the total (TOT), SW, LW, and window (WN) channel radiometric data; SW, LW, and WN unfiltered radiance values; and the ERBE scene identification for each measurement. These data are organized according to the CERES 3.3-second scan into 6.6-second records. As long as there is one valid scanner measurement within a record, the ES-8 record will be generated. The following CERES ES8 data sets are currently available: CER_ES8_TRMM-PFM_Edition1 CER_ES8_TRMM-PFM_Edition2 CER_ES8_TRMM-PFM_Transient-Ops2 CER_ES8_Terra-FM1_Edition1 CER_ES8_Terra-FM2_Edition1 CER_ES8_Terra-FM1_Edition2 CER_ES8_Terra-FM2_Edition2 CER_ES8_Aqua-FM3_Edition1 CER_ES8_Aqua-FM4_Edition1 CER_ES8_Aqua-FM3_Edition2 CER_ES8_Aqua-FM4_Edition2 CER_ES8_Aqua-FM3_Edition1-CV CER_ES8_Aqua-FM4_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV CER_ES8_Terra-FM1_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1997-12-27; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Temporal_Resolution=1 day; Temporal_Resolution_Range=Daily - < Weekly].

  17. The Incidence and the Risk Factors of Silent Embolic Cerebral Infarction After Coronary Angiography and Percutaneous Coronary Interventions.

    Science.gov (United States)

    Deveci, Onur Sinan; Celik, Aziz Inan; Ikikardes, Firat; Ozmen, Caglar; Caglıyan, Caglar Emre; Deniz, Ali; Bicakci, Kenan; Bicakci, Sebnem; Evlice, Ahmet; Demir, Turgay; Kanadasi, Mehmet; Demir, Mesut; Demirtas, Mustafa

    2016-05-01

    Silent embolic cerebral infarction (SECI) is a major complication of coronary angiography (CAG) and percutaneous coronary intervention (PCI). Patients with stable coronary artery disease (CAD) who underwent CAG with or without PCI were recruited. Cerebral diffusion-weighted magnetic resonance imaging was performed for SECI within 24 hours. Clinical and angiographic characteristics were compared between patients with and without SECI. Silent embolic cerebral infarction occurred in 12 (12%) of the 101 patients. Age, total cholesterol, SYNTAX score (SS), and coronary artery bypass history were greater in the SECI(+) group (65 ± 10 vs 58 ± 11 years,P= .037; 223 ± 85 vs 173 ± 80 mg/dL,P= .048; 30.1 ± 2 vs 15 ± 3,PSECI was more common in the PCI group (8/24 vs 4/77,P= .01). On subanalysis, the SS was significantly higher in the SECI(+) patients in both the CAG and the PCI groups (29.3 ± 1.9 vs 15 ± 3,PSECI after CAG and PCI increases with the complexity of CAD (represented by the SS). The SS is a predictor of the risk of SECI, a complication that should be considered more often after CAG. © The Author(s) 2015.

  18. IMMUNE REGULATING ES-PRODUCTS IN PARASITIC NEMATODES

    DEFF Research Database (Denmark)

    Bahlool, Qusay Zuhair Mohammad; Buchmann, Kurt; Kania, Per Walter

    work elucidates the effect of ES substances on the fish immune system by measuring immune gene expression in spleen and liver of rainbow trout (Oncorhynchus mykiss) injected intraperitoneally with ES products isolated from A. simplex third stage larvae. The overall gene expression profile of exposed...... fish showed a generalized down-regulation of the immune genes tested, suggesting a role of ES proteins in minimizing the immune reaction of rainbow trout against invading nematodes. We also tested the enzymatic activity of the ES proteins and found that lipase, esterase lipase, valine and cysteine...... arylamidases, naphthol-AS-BI-phosphohydrolase and a-galactosidase activities were present in the ES solution. This type of hydrolytic enzyme activity may play a role in nematode penetration of host tissue. Based on the notion that A. simplex ES-proteins may have an immune-depressive effect, it could also...

  19. Fibromyalgia, mood disorders, and intense creative energy: A1AT polymorphisms are not always silent.

    Science.gov (United States)

    Schmechel, Donald E; Edwards, Christopher L

    2012-12-01

    Persons with single copies of common alpha-1-antitrypsin polymorphisms such as S and Z are often considered "silent carriers". Published evidence however supports a complex behavioral phenotype or trait - intense creative energy ("ICE")-associated with A1AT polymorphisms. We now confirm that phenotype and present an association of fibromyalgia syndrome (FMS) and A1AT in a consecutive series of neurological patients. This is a retrospective case control series of 3176 consecutive patients presenting to Duke University Memory Clinic (747 patients) and to regional community-based Caldwell Hospital Neurology and Memory center (2429 patients). Work-up included medical history and examination, psychological evaluation, and genetic analysis. Chronic widespread pain (CWP) or FMS were diagnosed according to clinical guidelines, mostly as secondary diagnoses. Neurological patients carrying A1AT polymorphisms were common (ca 16% prevalence) and carriers had significantly higher use of inhaler and anxiolytic medications. Patients with ICE phenotype had a significantly higher proportion of A1AT polymorphisms (42%) compared to non-ICE patients (13%). Presence of CWP or FMS was common (14-22%) with average age at presentation of 56 years old and mostly female gender (82%). Patients with CWP/FMS had again significantly higher proportion of A1AT polymorphisms (38%) compared to other neurological patients (13%). Patients with anxiety disorders, bipolar I or bipolar II disorders or PTSD also had increased proportion of A1AT polymorphisms and significant overlap with ICE and FMS phenotype. Significant reductions in CWP/FMS prevalence are seen in apolipoprotein E4 carriers and methylene tetrahydrofolate reductase (MTHFR) mutation homozygotes. Since ICE phenotype is reported as a lifelong behavioral attribute, the presumption is that A1AT carriers have fundamental differences in brain development and inflammatory response. In support of this concept is finding those persons reporting a

  20. iDESWEB: Usabilidad: qué es

    OpenAIRE

    Luján Mora, Sergio

    2012-01-01

    Qué es la usabilidad, definiciones en ISO 9241 (usuario, objetivo, contexto) e ISO/IEC 9126 (funcionalidad, fiabilidad, usabilidad, eficiencia, mantenibilidad, portabilidad), definición de Jakob Nielsen: "La usabilidad es un atributo de calidad que mide lo fácil que son de usar los interfaces de usuario", componentes de la usabilidad: facilidad de aprendizaje, eficiencia, memorabilidad, errores, satisfacción. Sitio web del curso: http://idesweb.es/

  1. Penetapan Strategi Bisnis pada PT. Pabrik Es Siantar, Pematangsiantar

    OpenAIRE

    Pakpahan, Vovi Novita

    2015-01-01

    This research aims to identify the types of strategies used dan analyze the internal environment PT. Pabrik Es Siantar related strenghts and weaknesses and the external environment related opportunities and threats to determine the right strategy and the way it is applied in PT. Pabrik Es Siantar in the face of competition. The type of strategy adopted PT. Pabrik Es Siantar classified as a defensive strategy. The input stage of business strategy include matrix EFE,IFE and CPM. The total ...

  2. Earth System Documentation (ES-DOC) Preparation for CMIP6

    Science.gov (United States)

    Denvil, S.; Murphy, S.; Greenslade, M. A.; Lawrence, B.; Guilyardi, E.; Pascoe, C.; Treshanksy, A.; Elkington, M.; Hibling, E.; Hassell, D.

    2015-12-01

    During the course of 2015 the Earth System Documentation (ES-DOC) project began its preparations for CMIP6 (Coupled Model Inter-comparison Project 6) by further extending the ES-DOC tooling ecosystem in support of Earth System Model (ESM) documentation creation, search, viewing & comparison. The ES-DOC online questionnaire, the ES-DOC desktop notebook, and the ES-DOC python toolkit will serve as multiple complementary pathways to generating CMIP6 documentation. It is envisaged that institutes will leverage these tools at different points of the CMIP6 lifecycle. Institutes will be particularly interested to know that the documentation burden will be either streamlined or completely automated.As all the tools are tightly integrated with the ES-DOC web-service, institutes can be confident that the latency between documentation creation & publishing will be reduced to a minimum. Published documents will be viewable with the online ES-DOC Viewer (accessible via citable URL's). Model inter-comparison scenarios will be supported using the ES-DOC online Comparator tool. The Comparator is being extended to:• Support comparison of both Model descriptions & Simulation runs;• Greatly streamline the effort involved in compiling official tables.The entire ES-DOC ecosystem is open source and built upon open standards such as the Common Information Model (CIM) (versions 1 and 2).

  3. Regional cerebral blood flow and periventricular hyperintensity in silent cerebral infarction. Comparison with multi-infarct dementia

    International Nuclear Information System (INIS)

    Koshi, Yasuhiko; Kitamura, Shin; Nagazumi, Atushi; Tsuganesawa, Toshikazu; Terashi, Akiro

    1996-01-01

    In order to investigate relationship between regional cerebral blood flow (rCBF) and the white matter lesions on MRI in silent cerebral infarction, we quantitatively measured rCBF by 123 I-IMP autoradiography method (IMP ARG method) and single photon emission tomography (SPECT) in 36 patients with silent cerebral infarction (SCI group), 22 patients with multi-infarct dementia (MID group), and 16 control subjects without periventricular hyperintensity (PVH) and lacunar infarction on MRI (CL group). Regions of interest (ROIs) on rCBF images were set in the frontal (F), temporal (T), parietal (P), occipital (O) cortex, and the cerebral white matter (W). The severity of PVH on MRI T 2 -weighted image was divided into four grades (grade 0-3). Though the frequency of hypertension was significantly higher in SCI group and MID group compared with CL group, no significant difference was seen in the mean age among these three groups. rCBF in the white matter and cerebral cortices except the occipital cortex in SCI group was significantly low compared with CL group (rCBF SCI /rCBF CL : W 0.87, F 0.87, T 0.87, P 0.88, O 0.92). rCBF in the white matter and cerebral cortices, especially in the white matter and frontal cortex, in MID group was significantly low compared with SCI group (rCBF MID /rCBF CL : W 0.69, F 0.71, T 0.74, P 0.75, O 0.81). The mean grade of PVH in MID group was significantly higher than that in SCI group (SCI 1.1 vs MID 2.5). The severity of PVH was significantly correlated with each rCBF in the white matter and cerebral cortices, especially in the white matter and frontal cortex. Our findings suggest that the quantitative measurement of rCBF by IMP ARG method is useful for the follow-up study in the patients with silent cerebral infarction as well as the evaluation of the severity of PVH on MRI. (author)

  4. The Relations among Oral and Silent Reading Fluency and Comprehension in Middle School: Implications for Identification and Instruction of Students with Reading Difficulties

    Science.gov (United States)

    Denton, Carolyn A.; Barth, Amy E.; Fletcher, Jack M.; Wexler, Jade; Vaughn, Sharon; Cirino, Paul T.; Romain, Melissa; Francis, David J.

    2011-01-01

    The purpose of this study was to investigate the relations among oral and silent reading fluency and reading comprehension for students in Grades 6 to 8 (n = 1,421) and the use of fluency scores to identify middle school students who are at risk for failure on a high-stakes reading test. Results indicated moderate positive relations between…

  5. Non invasive evaluation of the coronary atherosclerosis illness in patients with silent ischemia: utility of the SPECT of myocardial perfusion. Electric, angiographic and image correlation

    International Nuclear Information System (INIS)

    Puente B, A.; Roffe G, F.; Aceves C, J.; Gomez A, E.

    2005-01-01

    The objective of the work was to determine the utility of the SPECT (Single Photon Emission Computerized Tomography) of myocardial perfusion for the ischemia detection in asymptomatic patients with Coronary Atherosclerosis Illness. It was concluded that the SPECT of myocardial perfusion has a high sensitivity (97%) for the silent ischemia diagnosis

  6. Major-element geochemistry of the Silent Canyon--Black Mountain peralkaline volcanic centers, northwestern Nevada Test Site: applications to an assessment of renewed volcanism

    International Nuclear Information System (INIS)

    Crowe, B.M.; Sargent, K.A.

    1979-01-01

    The Silent Canyon and Black Mountain volcanic centers are located in the northern part of the Nevada Test Site. The Silent Canyon volcanic center is a buried cauldron complex of Miocene age (13 to 15 m.y.). Black Mountain volcanic center is an elliptical-shaped cauldron complex of late Miocene age. The lavas and tuffs of the two centers comprise a subalkaline-peralkaline association. Rock types range from quartz normative subalkaline trachyte and rhyolite to peralkaline commendite. The Gold Flat Member of the Thirsty Canyon Tuff (Black Mountain) is a pantellerite. The major-element geochemistry of the Black Mountain--Silent Canyon volcanic centers differ in the total range and distribution of SiO 2 , contents, the degree of peralkalinity (molecular Na 2 O + K 2 O > Al 2 O 3 ) and in the values of total iron and alumina through the range of rock types. These differences indicate that the suites were unrelated and evolved from differing magma bodies. The Black Mountain volcanic cycle represents a renewed phase of volcanism following cessation of the Timber Mountain--Silent Canyon volcanic cycles. Consequently, there is a small but numerically incalculable probability of recurrence of Black Mountain-type volcanism within the Nevada Test Site region. This represents a potential risk with respect to deep geologic storage of high-level radioactive waste at the Nevada Test Site

  7. Neuroimaging of language processes: fMRI of silent and overt lexical processing and the promise of multiple process imaging in single brain studies

    International Nuclear Information System (INIS)

    Borowsky, R.; Owen, W.J.; Wile, T.L.; Friesen, C.K.; Martin, J.L.; Sarty, G.E.

    2005-01-01

    To implement and evaluate a multiple-process functional magnetic resonance imaging (fMRI) paradigm designed to effectively and efficiently activate several language-related regions for use with neurosurgical patients. Both overt and covert response conditions were examined. The fMRI experiments compared the traditional silent word-generation condition versus an overt one as they engage frontal language regions (Experiment 1) and silent versus overt semantic association conditions as they engage multiple language processing regions (Experiment 2). In Experiment 1 the overt condition yielded greater magnitude of activation, but not volume of activation, in the left inferior frontal and insular cortices than did the silent condition for most, but not all, participants. Experiment 2 demonstrated that the activation of multiple established language processing regions (ie, orthographic, phonological and semantic) can be achieved in a significant number of participants, particularly under overt semantic association conditions and that such activation varies in predictable ways. The traditional silent response condition cannot be considered as equivalent to the overt response condition during word generation or semantic association. The multiple-process imaging method introduced here was sensitive to processing robust orthographic, phonological, and semantic regions, particularly under the overt response condition. (author)

  8. The "Silent Dog" Method: Analyzing the Impact of Self-Generated Rules when Teaching Different Computer Chains to Boys with Autism

    Science.gov (United States)

    Arntzen, Erik; Halstadtro, Lill-Beathe; Halstadtro, Monica

    2009-01-01

    The purpose of the study was to extend the literature on verbal self-regulation by using the "silent dog" method to evaluate the role of verbal regulation over nonverbal behavior in 2 individuals with autism. Participants were required to talk-aloud while performing functional computer tasks.Then the effects of distracters with increasing demands…

  9. Low-Boom and Low-Drag Optimization of the Twin Engine Version of Silent Supersonic Business Jet

    Science.gov (United States)

    Sato, Koma; Kumano, Takayasu; Yonezawa, Masahito; Yamashita, Hiroshi; Jeong, Shinkyu; Obayashi, Shigeru

    Multi-Objective Optimization has been applied to a design problem of the twin engine concept for Silent Supersonic Business Jet (SSBJ). This problem aims to find main wing, body, tail wing and engine nacelle configurations, which can minimize both sonic boom and drag in a supersonic cruising flight. The multi-objective genetic algorithm (MOGA) coupled with the Kriging model has been used to globally and effectively search for optimal design candidates in the multi-objective problem. The drag and the sonic boom have been evaluated by the computational fluid dynamics (CFD) simulation and the waveform parameter method. As a result, the present optimization has successfully obtained low-boom and low-drag design candidates, which are better than the baseline design by more than 40% regarding each performance. Moreover, the structure of design space has been visualized by the self-organizing map (SOM).

  10. The Impact of Silent and Freeze-Frame Viewing Techniques of Video Materials on the Intermediate EFL Learners’ Listening Comprehension

    Directory of Open Access Journals (Sweden)

    Sara Shahani

    2015-05-01

    Full Text Available The use of modern technologies has been widely prevalent among language learners, and video, in particular, as a valuable learning tool provides learners with comprehensible input. The present study investigated the effect of silent and freeze-frame viewing techniques of video materials on the intermediate English as a foreign language (EFL learners’ listening comprehension. To this end, 45 intermediate EFL learners participated in this quasi-experimental study. The results of one-way ANOVA revealed that there was a statistically significant difference between the experimental groups (using two types of viewing techniques and the control group. While the difference between the two experimental groups was not statistically significant, the experimental groups outperformed the control group significantly.

  11. Phase-locking and chaos in a silent Hodgkin-Huxley neuron exposed to sinusoidal electric field

    International Nuclear Information System (INIS)

    Che Yanqiu; Wang Jiang; Si Wenjie; Fei Xiangyang

    2009-01-01

    Neuronal firing patterns are related to the information processing in neural system. This paper investigates the response characteristics of a silent Hodgkin-Huxley neuron to the stimulation of externally-applied sinusoidal electric field. The neuron exhibits both p:q phase-locked (i.e. a periodic oscillation defined as p action potentials generated by q cycle stimulations) and chaotic behaviors, depending on the values of stimulus frequencies and amplitudes. In one-parameter space, a rich bifurcation structure including period-adding without chaos and phase-locking alternated with chaos suggests frequency discrimination of the neuronal firing patterns. Furthermore, by mapping out Arnold tongues, we partition the amplitude-frequency parameter space in terms of the qualitative behaviors of the neuron. Thus the neuron's information (firing patterns) encodes the stimulus information (amplitude and frequency), and vice versa

  12. Before and after Silent Spring: from chemical pesticides to biological control and integrated pest management--Britain, 1945-1980.

    Science.gov (United States)

    Gay, Hannah

    2012-07-01

    The use of chemical pesticides increased considerably after World War II, and ecological damage was noticeable by the late 1940s. This paper outlines some ecological problems experienced during the post-war period in the UK, and in parts of what is now Malaysia. Also discussed is the government's response. Although Rachel Carson's book, Silent Spring (1962), was important in bringing the problems to a wider public, she was not alone in sounding the alarm. Pressure from the public and from British scientists led, among other things, to the founding of the Natural Environment Research Council in 1965. By the 1970s, environmentalism was an important movement, and funding for ecological and environmental research was forthcoming even during the economic recession. Some of the recipients were ecologists working at Imperial College London. Moved by the political climate, and by the evidence of ecological damage, they carried out research on the biological control of insect pests.

  13. A control strategy for grid-side converter of DFIG under unbalanced condition based on Dig SILENT/Power Factory

    Science.gov (United States)

    Han, Pingping; Zhang, Haitian; Chen, Lingqi; Zhang, Xiaoan

    2018-01-01

    The models of doubly fed induction generator (DFIG) and its grid-side converter (GSC) are established under unbalanced grid condition based on DIgSILENT/PowerFactory. According to the mathematical model, the vector equations of positive and negative sequence voltage and current are deduced in the positive sequence synchronous rotating reference frame d-q-0 when the characteristics of the simulation software are considered adequately. Moreover, the reference value of current component of GSC in the positive sequence frame d-q-0 under unbalanced condition can be obtained to improve the traditional control of GSC when the national issue of unbalanced current limits is combined. The simulated results indicate that the control strategy can restrain negative sequence current and the two times frequency power wave of GSC’s ac side effectively. The voltage of DC bus can be maintained a constant to ensure the uninterrupted operation of DFIG under unbalanced grid condition eventually.

  14. Effects of DBS, premotor rTMS, and levodopa on motor function and silent period in advanced Parkinson's disease

    DEFF Research Database (Denmark)

    Bäumer, Tobias; Hidding, Ute; Hamel, Wolfgang

    2009-01-01

    Deep brain stimulation (DBS) of the subthalamic nucleus (STN) is a widely used and highly effective treatment for patients with advanced Parkinson's disease (PD). Repetitive TMS (rTMS) applied to motor cortical areas has also been shown to improve symptoms in PD and modulate motor cortical...... excitability. Here, we compared clinical and neurophysiological effects of STN stimulation with those of 1 Hz rTMS given to the dorsal premotor cortex (PMd) and those following intake of levodopa in a group of PD patients with advanced disease. Ten PD patients were studied on 2 consecutive days before...... and after surgery. Clinical effects were determined using the UPDRS motor score. Motor thresholds, motor-evoked potential (MEP) amplitudes during slight voluntary contraction, and the cortical silent periods (SP) were measured using TMS. Before surgery effects of levodopa and 1 Hz PMd rTMS and after surgery...

  15. Defect induced activation of Raman silent modes in rf co-sputtered Mn doped ZnO thin films

    Energy Technology Data Exchange (ETDEWEB)

    Yadav, Harish Kumar [Department of Physics and Astrophysics, University of Delhi, Delhi-110007 (India); Sreenivas, K [Department of Physics and Astrophysics, University of Delhi, Delhi-110007 (India); Katiyar, R S [Department of Physics, University of Puerto Rico, San Juan, PR 00931-3343 (Puerto Rico); Gupta, Vinay [Department of Physics and Astrophysics, University of Delhi, Delhi-110007 (India)

    2007-10-07

    We study the influence of Mn doping on the vibrational properties of rf sputtered ZnO thin films. Raman spectra of the Mn doped ZnO samples reveal two additional vibrational modes, in addition to the host phonon modes, at 252 and 524 cm{sup -1}. The intensity of the additional modes increases continuously with Mn concentration in ZnO and can be used as an indication of Mn incorporation in ZnO. The modes are assigned to the activation of ZnO silent modes due to relaxation of Raman selection rules produced by the breakdown of the translational symmetry of the crystal lattice with the incorporation of Mn at the Zn site. Furthermore, the A{sub 1} (LO) mode is observed with very high intensity in the Raman spectra of undoped ZnO thin film and is attributed to the built-in electric field at the grain boundaries.

  16. Defect induced activation of Raman silent modes in rf co-sputtered Mn doped ZnO thin films

    International Nuclear Information System (INIS)

    Yadav, Harish Kumar; Sreenivas, K; Katiyar, R S; Gupta, Vinay

    2007-01-01

    We study the influence of Mn doping on the vibrational properties of rf sputtered ZnO thin films. Raman spectra of the Mn doped ZnO samples reveal two additional vibrational modes, in addition to the host phonon modes, at 252 and 524 cm -1 . The intensity of the additional modes increases continuously with Mn concentration in ZnO and can be used as an indication of Mn incorporation in ZnO. The modes are assigned to the activation of ZnO silent modes due to relaxation of Raman selection rules produced by the breakdown of the translational symmetry of the crystal lattice with the incorporation of Mn at the Zn site. Furthermore, the A 1 (LO) mode is observed with very high intensity in the Raman spectra of undoped ZnO thin film and is attributed to the built-in electric field at the grain boundaries

  17. Epistaxis as the First Manifestation of Silent Renal Cell Carcinoma: A Case Report with Relevant Literature Review

    International Nuclear Information System (INIS)

    Lee, Seung Min; Kim, You Me; Kim, Bong Man

    2016-01-01

    The paranasal sinuses are known to be a rare location for metastasis. Renal cell carcinoma (RCC) is the most frequent primary tumor to metastasize to the sinonasal region, followed by lung and breast cancer. In particular, clear cell type RCC, which represents approximately 85% of RCCs, is characterized by early metastasis, and it sometimes spreads to unusual sites (1, 2). Metastatic tumors in the paranasal sinuses are distributed in the maxillary, sphenoid, ethmoid, and frontal sinuses, in order of decreasing frequency. Symptoms are usually nonspecific, but epistaxis is the most common sign, due to the hypervascularity of the primary tumor. The prognosis is uncertain, but the 5-year survival rate fluctuates between 15% and 30%. The purpose of this case report is to document a rare case of silent RCC that first presented as epistaxis due to nasal cavity and ethmoid sinus metastasis

  18. Occurrence of silent cerebral infarction in pre-senile, senile subjects with depressive states; MRI findings and its distribution

    Energy Technology Data Exchange (ETDEWEB)

    Fujikawa, Tokumi; Yamawaki, Shigeto (Hiroshima Univ. (Japan). School of Medicine); Touhouda, Yoshikuni

    1993-02-01

    We examined the relationship between pre-senile, senile depressive states and silent cerebral infarction (SCI) using magnetic resonance imaging (MRI). The diagnostic criteria of major depression according to DSM-3-R was used to diagnose. Patients in whom stroke had occurred or who had local neurologic symptoms were not included. About half of the patients with depressive states of pre-senile onset and most of the patients with those of senile onset had SCI, were considered to be organic-depressive states complicated with SCI. Because patients with depressive states with SCI are at high risk of occurrence of stroke, we designated this condition 'pre-stroke depression', and classified it with endogenous depression. At this time, it is important to begin therapy for cerebrovascular disease. (author).

  19. Binocular neurons in parastriate cortex: interocular 'matching' of receptive field properties, eye dominance and strength of silent suppression.

    Directory of Open Access Journals (Sweden)

    Phillip A Romo

    Full Text Available Spike-responses of single binocular neurons were recorded from a distinct part of primary visual cortex, the parastriate cortex (cytoarchitectonic area 18 of anaesthetized and immobilized domestic cats. Functional identification of neurons was based on the ratios of phase-variant (F1 component to the mean firing rate (F0 of their spike-responses to optimized (orientation, direction, spatial and temporal frequencies and size sine-wave-luminance-modulated drifting grating patches presented separately via each eye. In over 95% of neurons, the interocular differences in the phase-sensitivities (differences in F1/F0 spike-response ratios were small (≤ 0.3 and in over 80% of neurons, the interocular differences in preferred orientations were ≤ 10°. The interocular correlations of the direction selectivity indices and optimal spatial frequencies, like those of the phase sensitivies and optimal orientations, were also strong (coefficients of correlation r ≥ 0.7005. By contrast, the interocular correlations of the optimal temporal frequencies, the diameters of summation areas of the excitatory responses and suppression indices were weak (coefficients of correlation r ≤ 0.4585. In cells with high eye dominance indices (HEDI cells, the mean magnitudes of suppressions evoked by stimulation of silent, extra-classical receptive fields via the non-dominant eyes, were significantly greater than those when the stimuli were presented via the dominant eyes. We argue that the well documented 'eye-origin specific' segregation of the lateral geniculate inputs underpinning distinct eye dominance columns in primary visual cortices of mammals with frontally positioned eyes (distinct eye dominance columns, combined with significant interocular differences in the strength of silent suppressive fields, putatively contribute to binocular stereoscopic vision.

  20. Low fetal hemoglobin percentage is associated with silent brain lesions in adults with homozygous sickle cell disease.

    Science.gov (United States)

    Calvet, David; Tuilier, Titien; Mélé, Nicolas; Turc, Guillaume; Habibi, Anoosha; Abdallah, Nassim Ait; Majhadi, Loubna; Hemery, François; Edjlali, Myriam; Galacteros, Frédéric; Bartolucci, Pablo

    2017-12-12

    Silent white matter changes (WMCs) on brain imaging are common in individuals with sickle cell disease (SCD) and are associated with cognitive deficits in children. We investigated the factors predictive of WMCs in adults with homozygous SCD and no history of neurological conditions. Patients were recruited from a cohort of adults with homozygous SCD followed up at an adult sickle cell referral center for which steady-state measurements of biological parameters and magnetic resonance imaging scans of the brain were available. WMCs were rated by consensus, on a validated age-related WMC scale. The prevalence of WMCs was 49% (95% confidence interval [CI], 39%-60%) in the 83 patients without vasculopathy included. In univariable analysis, the patients who had WMCs were more likely to be older ( P = .003) and to have hypertension ( P = .02), a lower mean corpuscular volume ( P = .005), a lower corpuscular hemoglobin concentration ( P = .008), and a lower fetal hemoglobin percentage (%HbF) ( P = .003). In multivariable analysis, only a lower %HbF remained associated with the presence of WMCs (odds ratio [OR] per 1% increase in %HbF, 0.84; 95% CI, 0.72-0.97; P = .021). %HbF was also associated with WMC burden ( P for trend = .007). Multivariable ordinal logistic regression showed an inverse relationship between WMC burden (age-related WMC score divided into 4 strata) and HbF level (OR for 1% increase in %HbF, 0.89; 95% CI, 0.79-0.99; P = .039). Our study suggests that HbF may protect against silent WMCs, decreasing the likelihood of WMCs being present and their severity. It may therefore be beneficial to increase HbF levels in patients with WMCs.

  1. Pitting type of pretibial edema in a patient with silent thyroiditis successfully treated by angiotensin ii receptor blockade.

    Science.gov (United States)

    Kazama, Itsuro; Mori, Yoko; Baba, Asuka; Nakajima, Toshiyuki

    2014-01-01

    Female, 56 FINAL DIAGNOSIS: Thyroiditis - silent Symptoms: Palpitations • pretibial pitting edema • short of breath • sweating - Clinical Procedure: - Specialty: Endocrinology and Metabolic. Unknown etiology. Hyper- or hypothyroidism sometimes causes pretibial myxedema characterized by non-pitting infiltration of a proteinaceous ground substance. However, in those patients, the "pitting" type of pretibial edema as a result of increased sodium and fluid retention or vascular hyper-permeability rarely occurs, except in cases complicated by heart failures due to severe cardiomyopathy or pulmonary hypertension. A 56-year-old woman developed bilateral pretibial pitting edema, followed by occasional sweating, palpitations, and shortness of breath, which persisted for more than 2 months. The diagnosis of hyperthyroidism due to silent thyroiditis was supported by elevated levels of free thyroxine (T4) and triiodothyronine (T3), with a marked decrease in thyroid-stimulating hormone (TSH), and the negative results for TSH receptor antibodies with typical findings of destructive thyrotoxicosis. Despite her "pitting" type of pretibial edema, a chest radio-graph demonstrated the absence of cardiomyopathy or congestive heart failure. Oral administration of angiotensin II receptor blocker (ARB) was initiated for her systolic hypertension, with a relatively higher elevation of plasma renin activity compared to that of the aldosterone level. Although the symptoms characteristic to hyperthyroidism, such as increased sweating, palpitations and shortness of breath, slowly improved with a spontaneous resolution of the disease, ARB quickly resolved the pretibial pitting edema shortly after the administration.. In this case, increased activity of the renin-angiotensin-aldosterone system stimulated by thyroid hormone was likely responsible for the patient's pitting type of edema. The pharmacological blockade of the renin-angiotensin-aldosterone system was thought to be effective for

  2. Exact scattering solutions in an energy sudden (ES) representation

    International Nuclear Information System (INIS)

    Chang, B.; Eno, L.; Rabitz, H.

    1983-01-01

    In this paper, we lay down the theoretical foundations for computing exact scattering wave functions in a reference frame which moves in unison with the system internal coordinates. In this frame the (internal) coordinates appear to be fixed and its adoption leads very naturally (in zeroth order) to the energy sudden (ES) approximation [and the related infinite order sudden (IOS) method]. For this reason we call the new representation for describing the exact dynamics of a many channel scattering problem, the ES representation. Exact scattering solutions are derived in both time dependent and time independent frameworks for the representation and many interesting results in these frames are established. It is shown, e.g., that in a time dependent frame the usual Schroedinger propagator factorizes into internal Hamiltonian, ES, and energy correcting propagators. We also show that in a time independent frame the full Green's functions can be similarly factorized. Another important feature of the new representation is that it forms a firm foundation for seeking corrections to the ES approximation. Thus, for example, the singularity which arises in conventional perturbative expansions of the full Green's functions (with the ES Green's function as the zeroth order solution) is avoided in the ES representation. Finally, a number of both time independent and time dependent ES correction schemes are suggested

  3. ANALISIS KADAR SIKLAMAT PADA ES KRIM DI KOTA BANJARBARU

    Directory of Open Access Journals (Sweden)

    Nurlailah Nurlailah

    2017-07-01

    Full Text Available Pemanis merupakan salah satu komponen yang sering ditambahkan dalam bahan makanan. Pemanis buatan yang banyak beredar di masyarakat adalah siklamat. Konsumsi siklamat yang melebihi dosis akan mengakibatkan kanker kandung kemih. Selain itu akan menyebabkan tumor paru, hati, dan limfa. Tujuan penelitian ini adalah untuk mengetahui adanya siklamat dalam es krim yang melebihi ambang batas yang dipersyaratkan. Jenis penelitian ini adalah survey deskriptif. Sampel penelitian adalah es krim produksi rumah tangga dari seluruh pedagang es krim di Banjarbaru utara yaitu dengan jumlah 11 pedagang es krim. Variabel dalam penelitian ini adalah kadar siklamat yang terdapat dalam es krim. Hasil penelitian menunjukkan dari 11 sampel es krim yang diperiksa, 9 sampel mengandung siklamat dengan kadar tertinggi 7,37 g/kg sebagai asam siklamat. Kesimpulan penelitian ini adalah es krim yang mengandung siklamat ditemukan sebanyak 82% (9 sampel, sedangkan 18% (2 sampel lainnya negatif, dari 9 sampel yang positif mengandung siklamat, 89% tidak memenuhi syarat PERMENKES Nomor 208 tahun 1985 yaitu melebihi 2 gr/kg sebagai asam siklamat. Perlu dilakukan pemeriksaan yang lebih spesifik untuk analisis kadar siklamat dengan metode lain seperti Kromatografi Cair Kinerja Tinggi (KCKT

  4. Diccionarios monolingües de ELE vs. diccionarios normativos

    Directory of Open Access Journals (Sweden)

    Villarrubia Zúñiga, Marisol

    2013-11-01

    Full Text Available En el artículo analizamos diferentes lemas en el Diccionario Salamanca y los comparamos con los de varios diccionarios normativos del español, como por ejemplo, el DRAE. Nuestro propósito es ver cómo están construidos para evidenciar, cuál de estos es más útil para un estudiante que está aprendiendo el español como segunda lengua y por qué lo es.

  5. "Aarøes Strejfkorps - en dansk specialenhed i 1864"

    DEFF Research Database (Denmark)

    Papousek, Simon

    2014-01-01

    Boganmeldelse af genudgivelse af to artikler tidligere bragt i Militært Tidsskrift i slutningen af 1800-tallet, omhandlende oprettelsen, operationerne og historien om den danske specialenhed "Aarøes Strejfkorps" under Anden Slesvgiske Krig...

  6. ¿Qué es Indoor airPLUS?

    Science.gov (United States)

    El Programa Interior de airPLUS es una asociación entre EPA, los constructores, raters, las utilidades, y organizaciones sanitarias e interiores ambientales de mejorar aire interior en nuevas casas casas verdes.

  7. Patient Satisfaction At The Muhimbili National Hospital In Dar Es ...

    African Journals Online (AJOL)

    Patient Satisfaction At The Muhimbili National Hospital In Dar Es Salaam, Tanzania. ... staffpatient relationship ethos, in which the patient is a viewed as a customer. Keywords: patient satisfaction, reform, Muhimbili National Hospital, referral ...

  8. Alderisio_Meri_vs_ES_MS_vs_MSD

    Data.gov (United States)

    U.S. Environmental Protection Agency — Stain Comparison Meri vs. ES. This dataset is associated with the following publication: Alderiswio, K., L. Villegas, M. Ware, L. McDonald, L. Xiao, and E. Villegas....

  9. La costumbre no es fuente del Derecho Procesal

    OpenAIRE

    Gascón Inchausti, Fernando

    1999-01-01

    Comentario a la Sentencia del Tribunal Supremo de 28 de abril de 1998. Se analiza el valor jurídico que cabe atribuir a ciertos usos forenses, dado que la costumbre no es fuente del Derecho Procesal.

  10. Home Performance with Energy Star (HPwES) Program Report

    Energy Technology Data Exchange (ETDEWEB)

    none,

    2013-01-01

    This report summarizes the Department’s review of comments received on the HPwES v2 proposal and presents a multi-year action plan to both address Department goals and incorporate industry feedback.

  11. Final Technical Report: Electronic Structure Workshop (ES13)

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Shiwei [College of William and Mary, Williamsburg, VA (United States)

    2015-02-26

    The 25th Annual Workshop on Recent Developments in Electronic Structure Methods (ES2013) was successfully held at the College of William & Mary in Williamsburg VA on June 11-14, 2013. The workshop website is at http://es13.wm.edu/ , which contains updated information on the workshop and a permanent archive of the scientific contents. DOE's continued support has been instrumental to the success of the workshop.

  12. El Buen Ordeño es muy Importante

    Directory of Open Access Journals (Sweden)

    Blackman Charles

    1947-06-01

    Full Text Available El ordeño es uno de los mayores trabajos de las fincas lecheras y es también uno de los más importantes. La forma en que se ordeña las vacas determina en gran parte la calidad de la leche e influye además sobre la cantidad de leche producida. Las vacas lecheras deben ser ordeñadas dos veces al día, a intervalos iguales.

  13. 'El 'vos' es el dialecto que inventamos nosotros, la forma correcta es el 'tú''

    Directory of Open Access Journals (Sweden)

    Ane Christiansen

    2014-06-01

    Full Text Available Nicaragua es un país con un nivel de escolarización relativamente bajo y el contexto material y social en las escuelas hace que la enseñanza de la lengua materna esté dominada por métodos de memorización y ejercicios de gramática del tipo “rellenar espacios”. Las formas de tratamiento escritas que se utilizan en contextos pedagógicos son únicamente el tú y el usted, a pesar de ser Nicaragua una zona voseante. El presente artículo pretenderá mostrar, a través de referencias a estudios sobre las formas de tratamiento en Nicaragua, análisis del uso de los tratamientos en la escritura, ejemplos de entrevistas de actitudes lingüísticas y de análisis de documentos pedagógicos, que hay una discrepancia entre la norma escrita y la norma hablada en cuanto a las formas de tratamiento tú y vos en Nicaragua. Esta discrepancia se puede explicar con las creencias en torno a las diferentes formas de tratamiento, pero también al revés: el uso contradictorio de parte de las autoridades educativas influirá en las creencias del pueblo en general acerca de las formas de tratamiento y así crece un clima de inseguridad de la corrección de su propia habla. En última instancia tal contradicción puede ser un obstáculo para la enseñanza de la lengua materna y el prestigio lingüístico del habla local.

  14. NINJ2 SNP may affect the onset age of first-ever ischemic stroke without increasing silent cerebrovascular lesions

    Directory of Open Access Journals (Sweden)

    Kim Dong-Eog

    2012-03-01

    Full Text Available Abstract Background To investigate if single nucleotide polymorphisms on chromosome 12p13 and within 11 kb of the gene NINJ2 would be associated with earlier-onset (vs. late-onset first-ever ischemic stroke and increase silent cerebrovascular lesions prior to the manifestation of the stroke. Methods We prospectively enrolled 164 patients (67.6 ± 12.9 years, 92 men admitted with first-ever ischemic strokes. All patients underwent genotyping of rs11833579 and rs12425791 as well as systemic investigations including magnetic resonance (MR imaging and other vascular workup. Stroke-related MR lesions were registered on a brain-template-set using a custom-built software package 'Image_QNA': high-signal-intensity ischemic lesions on diffusion, T2-weighted, or fluid attenuation inversion recovery (FLAIR MR images, and low signal intensity hemorrhagic lesions on gradient-echo MR images. Results The rs11833579 A/A or G/A genotype was independently associated with the first-ever ischemic stroke before the age 59 vs. 59 or over, after adjusting for cardiovascular risk factors and prior medication of antiplatelet or anticoagulant drugs, increasing the risk by about 2.5 fold. In the quantitative MR lesion maps from age-sex matched subgroups (n = 124 or 126, there was no difference between the patients with the rs11833579 A/A or G/A genotype and those with the G/G genotype. Unexpectedly, the extent of leukoaraiosis on FLAIR-MR images tended to be smaller in the corona radiata and centrum semiovale of the patients with the rs12425791 A/A or G/A genotype than in those with the G/G genotype (P = 0.052. Neither the rs11833579 nor the rs12425791 genotype significantly affected initial stroke severity; however the latter was associated with relatively low modified Rankin scale scores at 1 year after stroke. Conclusions The rs11833579 A/A or G/A genotype may bring forward the onset age of first-ever ischemic stroke without increasing silent cerebrovascular lesions

  15. Substances bioactives élaborées par des cyanobactéries isolées de ...

    African Journals Online (AJOL)

    Les substances extracellulaires produites par les cyanobactéries étudiées ont aussi une activité antibactérienne vis-à-vis de M. luteus, Bacillus subtilis, Serratia marcescens, B. cereus, Escherichia coli 0128B12 et Staphylococcus aureus. Le biotest souris a permis de montrer que certaines cyanobactéries étudiées ...

  16. PENGGUNAAN RUMPUT LAUT SEBAGAI STABILIZER ES KRIM SUSU SARI KEDELAI

    Directory of Open Access Journals (Sweden)

    Aviani Violisa

    2013-07-01

    Full Text Available The used of seaweed as stabilizing agent on the soymilk-based ice cream. The purpose of this study is to investigate the chemical, physical and organoleptic characteristics of soymilk-based ice cream, in which seaweed is used as a stabilizing agent. The results of this study showed that soymilk-based ice cream with seaweed at the concen­tration of 0.5% have the highest fat and protein contents, viscosity, and the longest melt-down rate. Ice cream with the concentration of 0.4% had the highest solid level, while the concentration of 0.3% produced the highest overrun of ice cream. For the hedonic-quality parameter, ice cream with the concentration of 0.5% had the highest of aroma score and soft texture, while at the concentra­tion of 0.3% had the highest sweet flavor. For the hedonic parameter, ice cream with the con­cen­tra­tion of 0.4% had the highest aroma and sweet flavor preference. Tujuan penelitian ini adalah mengetahui sifat kimia, fisik, dan organoleptik es krim susu sari kedelai dengan rumput laut sebagai stabilizer. Hasil penelitian me­nunjukkan bahwa es krim susu sari kedelai dengan stabilizer rumput laut konsentrasi 0,5% memiliki kadar lemak tertinggi, kadar protein tertinggi, viskositas tertinggi, dan waktu meleleh paling lama. Es krim padatan tertinggi diperoleh dari stabilizer kon­sentrasi 0,4%. Overrun tertinggi terdapat pada es krim dengan stabilizer konsentrasi 0,3%. Hasil uji mutu hedonik, es krim dengan stabilizer konsentrasi 0,5% menghasil­kan aroma tertinggi dan tekstur paling lembut, sedangkan es krim dengan stabilizer 0,3% menghasilkan rasa termanis. Hasil uji hedonik, es krim dengan stabilizer kon­sen­trasi 0,4% memiliki nilai kesukaan aroma tertinggi dan kesukaan rasa tertinggi.

  17. The role of ion irradiation in activating silent Raman modes via tuning in plasmonic behaviour and surface disorder of Au/ZnO/Pt NFG system

    Science.gov (United States)

    Singh, Udai B.; Gautam, Subodh K.; Kumar, Sunil; Ojha, Sunil; Ghosh, Santanu; Singh, Fouran

    2017-09-01

    The perceptible progression of Raman modes of zinc oxide (ZnO) is studied in nanostructures film gap (Au (10 nm)/ZnO (70 nm)/Pt (50 nm)) system with 1.2 MeV Xe ion irradiation. Unattainable silent Raman modes of ZnO turn out to be strongly visible after ion irradiation. The creation of ion-beam-induced lattice disorder, defects, and impurities in a ZnO layer leads to breakdown the translational crystal symmetry that results in the origin of silent modes. The formation of hot-spots in the ZnO layer of the NFG system also supports the enhancement of the intensity of Raman modes. Overall results are attributed to combined effects of lattice disorder, defects, and impurities along with plasmonic effect and explained in the framework of elastic-thermal-spike formation.

  18. A silent allele in the locus D5S818 contained within the PowerPlex®21 PCR Amplification Kit.

    Science.gov (United States)

    Chen, Ling; Tai, Yunchun; Qiu, Pingming; Du, Weian; Liu, Chao

    2015-11-01

    Three paternity tests cases were found with a single locus mismatch at the locus D5S818 with PowerPlex®21 PCR Amplification Kit (Promega). Forward and reverse primers were redesigned to type the samples again and to evaluate if there were alleles dropped out. The results showed the existence of a silent allele 12 in all the three families, due to a point mutation that changed cytosine to adenine at 90 nucleotides upstream from the 5' end of the AGAT repeat sequences in all the six individuals. A single locus mismatch due to a silent allele may occur in any locus using any kit. Therefore, we recommend using multiple kits to confirm the results in paternity testing cases with mismatches, especially when there is a single locus mismatch with homozygote involved. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  19. Activation of the Silent Secondary Metabolite Production by Introducing Neomycin-Resistance in a Marine-Derived Penicillium purpurogenum G59

    Directory of Open Access Journals (Sweden)

    Chang-Jing Wu

    2015-04-01

    Full Text Available Introduction of neomycin-resistance into a marine-derived, wild-type Penicillium purpurogenum G59 resulted in activation of silent biosynthetic pathways for the secondary metabolite production. Upon treatment of G59 spores with neomycin and dimethyl sulfoxide (DMSO, a total of 56 mutants were obtained by single colony isolation. The acquired resistance of mutants to neomycin was testified by the resistance test. In contrast to the G59 strain, the EtOAc extracts of 28 mutants inhibited the human cancer K562 cells, indicating that the 28 mutants have acquired the capability to produce bioactive metabolites. HPLC-photodiode array detector (PDAD-UV and HPLC-electron spray ionization (ESI-MS analyses further indicated that diverse secondary metabolites have been newly produced in the bioactive mutant extracts. Followed isolation and characterization demonstrated that five bioactive secondary metabolites, curvularin (1, citrinin (2, penicitrinone A (3, erythro-23-O-methylneocyclocitrinol (4 and 22E-7α-methoxy-5α, 6α-epoxyergosta-8(14,22-dien-3β-ol (5, were newly produced by a mutant, 4-30, compared to the G59 strain. All 1–5 were also not yet found in the secondary metabolites of other wild type P. purpurogenum strains. Compounds 1–5 inhibited human cancer K562, HL-60, HeLa and BGC-823 cells to varying extents. Both present bioassays and chemical investigations demonstrated that the introduction of neomycin-resistance into the marine-derived fungal G59 strain could activate silent secondary metabolite production. The present work not only extended the previous DMSO-mediated method for introducing drug-resistance in fungi both in DMSO concentrations and antibiotics, but also additionally exemplified effectiveness of this method for activating silent fungal secondary metabolites. This method could be applied to other fungal isolates to elicit their metabolic potentials to investigate secondary metabolites from silent biosynthetic pathways.

  20. “The One Who Chases You Away Does Not Tell You Go”: Silent Refusals and Complex Power Relations in Research Consent Processes in Coastal Kenya

    Science.gov (United States)

    Kamuya, Dorcas M.; Theobald, Sally J.; Marsh, Vicki; Parker, Michael; Geissler, Wenzel P.; Molyneux, Sassy C.

    2015-01-01

    Consent processes have attracted significant research attention over the last decade, including in the global south. Although relevant studies suggest consent is a complex negotiated process involving multiple actors, most guidelines assume consent is a one-off encounter with a clear ‘yes’ or ‘no’ decision. In this paper we explore the concept of ‘silent refusals’, a situation where it is not clear whether potential participants want to join studies or those in studies want to withdraw from research, as they were not actively saying no. We draw on participant observation, in-depth interviews and group discussions conducted with a range of stakeholders in two large community based studies conducted by the KEMRI Wellcome Trust programme in coastal Kenya. We identified three broad inter-related rationales for silent refusals: 1) a strategy to avoid conflicts and safeguard relations within households, - for young women in particular—to appear to conform to the wishes of elders; 2) an approach to maintain friendly, appreciative and reciprocal relationships with fieldworkers, and the broader research programme; and 3) an effort to retain study benefits, either for individuals, whole households or wider communities. That refusals and underlying rationales were silent posed multiple dilemmas for fieldworkers, who are increasingly recognised to play a key interface role between researchers and communities in many settings. Silent refusals reflect and reinforce complex power relations embedded in decisions about research participation, with important implications for consent processes and broader research ethics practice. Fieldworkers need support to reflect upon and respond to the ethically charged environment they work in. PMID:25978465

  1. Co-simulation with DIgSILENT PowerFactory and Matlab: Optimal integration of plug-in electric vehicles in distribution networks

    DEFF Research Database (Denmark)

    García-Villalobos, J.; Zamora, I.; Marinelli, Mattia

    2017-01-01

    Smart grid concept is gaining more and more importance in electric power systems. In near term, electric grids will be more intelligent, interconnected and decentralised. Dealing with a significant number of distributed resources in a smart way, frequently requires the use of optimal control tech...... mean square (RMS) simulations on DIgSILENT PowerFactory. As an example, the implementation of a smart charging control for plug-in electric vehicles in electric distribution networks is explained....

  2. Non invasive evaluation of the coronary atherosclerosis illness in patients with silent ischemia: utility of the SPECT of myocardial perfusion. Electric, angiographic and image correlation; Valoracion no invasiva de la enfermedad ateroesclerosa coronaria en pacientes con isquemia silente: utilidad del SPECT de perfusion miocardica. Correlacion electrica, angiografica y de imagen

    Energy Technology Data Exchange (ETDEWEB)

    Puente B, A.; Roffe G, F.; Aceves C, J.; Gomez A, E. [Hospital Centro Medico Nacional 20 de Noviembre, ISSSTE, Mexico D.F. (Mexico)

    2005-07-01

    The objective of the work was to determine the utility of the SPECT (Single Photon Emission Computerized Tomography) of myocardial perfusion for the ischemia detection in asymptomatic patients with Coronary Atherosclerosis Illness. It was concluded that the SPECT of myocardial perfusion has a high sensitivity (97%) for the silent ischemia diagnosis.

  3. Prognostic importance of silent myocardial ischemia detected by intravenous dipyridamole thallium myocardial imaging in asymptomatic patients with coronary artery disease

    International Nuclear Information System (INIS)

    Younis, L.T.; Byers, S.; Shaw, L.; Barth, G.; Goodgold, H.; Chaitman, B.R.

    1989-01-01

    One hundred seven asymptomatic patients who underwent intravenous dipyridamole thallium imaging were evaluated to determine prognostic indicators of subsequent cardiac events over an average follow-up period of 14 +/- 10 months. Univariate analysis of 18 clinical, scintigraphic and angiographic variables revealed that a reversible thallium defect, a combined fixed and reversible thallium defect, number of segmental thallium defects and extent of coronary artery disease were significant predictors of subsequent cardiac events. Of the 13 patients who died or had a nonfatal infarction, 12 had a reversible thallium defect. Stepwise logistic regression analysis selected a reversible thallium defect as the only significant predictor of cardiac events. When death or myocardial infarction was the outcome variable, a combined fixed and reversible thallium defect was the only predictor of outcome. In patients without previous myocardial infarction, the cardiac event rate was significantly greater in those with an abnormal versus normal thallium scan (55% versus 12%, p less than 0.001). Thus, intravenous dipyridamole thallium scintigraphy is a useful noninvasive test to risk stratify asymptomatic patients with coronary artery disease. A reversible thallium defect most likely indicates silent myocardial ischemia in a sizable fraction of patients in this clinical subset and is associated with an unfavorable prognosis

  4. Boleros and Flamenco Dancing in the Early Silent Films. Narratives and Archetypes of Spanishness in the Early Twentieth Century

    Directory of Open Access Journals (Sweden)

    Cristina Cruces-Roldán

    2017-02-01

    Full Text Available The article locates and catalogues a corpus of 37 early cinema recordings (1894-1910 containing Spanish bolero and flamenco dances. These silent movies were recorded at universal exhibitions, or as a result of theatrical dramatizations, parodies and fiction stories, and are now in the archives of the Library of Congress, Gaumont-Pathé, Pathé and Frères Lumière collections and the Huntley Films Archive. An analysis of the contents of these archives demonstrate the potential of pioneering filmography as a documentary source for the construction and reproduction of national clichés. We consider two coexisting narratives in these early records: testimonial to dance as artistic expression and the identity discourse of «Spanishness» through the bodily disposition and environmental elements of the frames. The representation of the Hispanic archetype shows that early cinema was a continuist route of transmission of the aesthetic, psychological and moral images of the «espagnolade» for which ethnicity and gender operated as substrata that became clichés in a peripheral and fascinating Spanish culture.

  5. De novo amplification within a silent human cholinesterase gene in a family subjected to prolonged exposure to organophosphorus insecticides

    International Nuclear Information System (INIS)

    Prody, C.A.; Dreyfus, P.; Soreq, H.; Zamir, R.; Zakut, H.

    1989-01-01

    A 100-fold DNA amplification in the CHE gene, coding for serum butyrylcholinesterase (BtChoEase), was found in a farmer expressing silent CHE phenotype. Individuals homozygous for this gene display a defective serum BtChoEase and are particularly vulnerable to poisoning by agricultural organophosphorus insecticides, to which all members of this family had long been exposed. DNA blot hybridization with regional BtChoEase cDNA probes suggested that the amplification was most intense in regions encoding central sequences within BtChoEase cDNA, whereas distal sequences were amplified to a much lower extent. This is in agreement with the onion skin model, based on amplification of genes in cultured cells and primary tumors. The amplification was absent in the grandparents but present at the same extent in one of their sons and in a grandson, with similar DNA blot hybridization patterns. In situ hybridization experiments localized the amplified sequences to the long arm of chromosome 3, close to the site where the authors previously mapped the CHE gene. Altogether, these observations suggest that the initial amplification event occurred early in embryogenesis, spermatogenesis, or oogenesis, where the CHE gene is intensely active and where cholinergic functioning was indicated to be physiologically necessary. These findings demonstrate a de novo amplification in apparently healthy individuals within an autosomal gene producing a target protein to an inhibitor

  6. Prevalence of silent myocardial ischaemia during exercise stress testing. Its relation to effort tolerance and myocardial perfusion abnormalities.

    Science.gov (United States)

    Fragasso, G; Sciammarella, M G; Rossetti, E E; Xuereb, R G; Xuereb, M; Bonetti, F; Carandente, O M; Margonato, A; Chierchia, S L

    1992-07-01

    The number of underperfused myocardial segments, the extent of coronary artery disease and the severity of impairment of coronary flow reserve were compared in 147 consecutive patients exhibiting painful or painless ischaemic ST segment depression on exercise testing. Of 147 patients, only 61 (41%) experienced angina (group 1) whilst 86 (59%) did not (group 2). In the two groups coronary disease was comparable for both extent and distribution, and neither the location of transient perfusion defects nor their relation to areas of old myocardial necrosis appeared to influence the presence or absence of chest pain. However, exercise duration, exercise time and rate-pressure product at the beginning of ischaemia were lower in group 1. Furthermore, a greater proportion of asymptomatic patients had only one ischaemic segment on 99mTc-MIBI perfusion scintigraphy. We conclude that: (1) in patients with effort angina and coronary disease, the incidence of electrocardiographic silent ischaemic events induced by exercise is similar to that observed in studies based on continuous ECG monitoring. (2) Exertional angina is more frequently associated with greater ischaemic areas and with more severe degrees of impairment of residual coronary flow reserve. (3) The presence of an old myocardial infarction does not appear to influence the incidence of ischaemic cardiac pain.

  7. White Matter Damage Relates to Oxygen Saturation in Children With Sickle Cell Anemia Without Silent Cerebral Infarcts.

    Science.gov (United States)

    Kawadler, Jamie M; Kirkham, Fenella J; Clayden, Jonathan D; Hollocks, Matthew J; Seymour, Emma L; Edey, Rosanna; Telfer, Paul; Robins, Andrew; Wilkey, Olu; Barker, Simon; Cox, Tim C S; Clark, Chris A

    2015-07-01

    Sickle cell anemia is associated with compromised oxygen-carrying capability of hemoglobin and a high incidence of overt and silent stroke. However, in children with no evidence of cerebral infarction, there are changes in brain morphometry relative to healthy controls, which may be related to chronic anemia and oxygen desaturation. A whole-brain tract-based spatial statistics analysis was carried out in 25 children with sickle cell anemia with no evidence of abnormality on T2-weighted magnetic resonance imaging (13 male, age range: 8-18 years) and 14 age- and race-matched controls (7 male, age range: 10-19 years) to determine the extent of white matter injury. The hypotheses that white matter damage is related to daytime peripheral oxygen saturation and steady-state hemoglobin were tested. Fractional anisotropy was found to be significantly lower in patients in the subcortical white matter (corticospinal tract and cerebellum), whereas mean diffusivity and radial diffusivity were higher in patients in widespread areas. There was a significant negative relationship between radial diffusivity and oxygen saturation (Plevel negative relationship between radial diffusivity and hemoglobin (Pcell anemia, and provides for the first time direct evidence of a relationship between brain microstructure and markers of disease severity (eg, peripheral oxygen saturation and steady-state hemoglobin). This study suggests that diffusion tensor imaging metrics may serve as a biomarker for future trials of reducing hypoxic exposure. © 2015 American Heart Association, Inc.

  8. Theoretical Study of Methods for Improving the Energy Efficiency of NOx Removal from Diesel Exhaust Gases by Silent Discharge

    Science.gov (United States)

    Shoyama, Taiji; Yoshioka, Yoshio

    To improve the NO removal performance in silent discharge process, we investigated the influence of the physical parameters such as current density, channel radius and pulse duration of the one micro discharge under the constant reduced electric field strength. And influence of the micro discharges occurrence locations were also discussed. In order to analyze the NO removal process, we assumed that the pulse micro discharges occur repeatedly at the same location in static gas and that the chemical reactions induced by micro discharge forms many radicals, which react with pollutants and by-products. The conclusions we obtained are that lower current density, smaller discharge radius and shorter discharge duration improve NO removal efficiency. These results also mean that the lower discharge energy of the one micro discharge and the larger number of parallel micro discharges increase the NO removal performance. Therefore, to make the area of one micro discharge small is a desirable way to improve the NO removal performance. So we think that the glow like discharge might be more effective than the streamer like discharge mode. Next, using the two-dimensional model, which considered the influence of gas flow, we obtained a conclusion that the repeated micro discharges at different positions are very effective to increase the De-NOx performance. The reason is that the reaction of NO2+O→NO+O2 and ozone dissociation reactions are suppressed by the movement of the location of micro discharges.

  9. The Preference of Keeping the Intermediary /y/(ی in Prepositional Construction and Its Attachment to the Silent» h«.

    Directory of Open Access Journals (Sweden)

    Mohammad Irani

    2010-06-01

    Full Text Available Abstract   One of the problems of Persian writing is the question of writing and including the noun or adjective "Prepositional" construction sign in words the written form of which end in a silent » h « which is in fact a short vowel equivalent to /e/ (kasra ـِـ .The difference between the two ways of writing the intermediary consonant /y/( ی at the end of the word with a last silent » h « , completely as « ی » or with the sign « ء» on the silent » h « is rooted in the controversy between the traditional and modern approaches of writing.   The present study is about to study into the following subjects: an analysis and criticism of both the above approaches, a survey of the history of the intermediary /y/( ی , recognizing its phonetic significance and its role in making and adding new syllables, and finally a conclusion about the more convenient way to write it. It is possible that the outcome of the present study will provide us with a unique form of writing of the case in different texts like books, articles, newspapers, journals and electronic texts.

  10. EL CONCURSO DE ACREEDORES ES COSA DE HOMBRES

    OpenAIRE

    Navarro-Sánchez, Roberto Carlos

    2015-01-01

    En los últimos años es incuestionable el incremento en el número de empresas creadas o dirigidas por mujeres en España, cifra que actualmente está en el entorno del 23- 35% del global de empresas (Guzmán, Rodríguez, 2008). Este dato es muy significativo, si bien aún es muy bajo en comparación con otros países, sobre todo si tenemos en cuenta que las mujeres lo tienen mucho más difícil a la hora de montar sus empresas debido a las barreras de género existentes, provocadas por los roles asig...

  11. ES-RBE Event sequence reliability Benchmark exercise

    International Nuclear Information System (INIS)

    Poucet, A.E.J.

    1991-01-01

    The event Sequence Reliability Benchmark Exercise (ES-RBE) can be considered as a logical extension of the other three Reliability Benchmark Exercices : the RBE on Systems Analysis, the RBE on Common Cause Failures and the RBE on Human Factors. The latter, constituting Activity No. 1, was concluded by the end of 1987. The ES-RBE covered the techniques that are currently used for analysing and quantifying sequences of events starting from an initiating event to various plant damage states, including analysis of various system failures and/or successes, human intervention failure and/or success and dependencies between systems. By this way, one of the scopes of the ES-RBE was to integrate the experiences gained in the previous exercises

  12. ¿Es posible la transformación docente?

    Directory of Open Access Journals (Sweden)

    Agustín de la Herrán Gascón

    2016-05-01

    Full Text Available Se presenta un ensayo en torno a dos cuestiones fundamentales: si es posible la transformación docente y si tiene sentido una formación orientada más allá del conocimiento y la efectividad. Se construyó tras una acción formativa (Herrán, 2015b que tuvo lugar el 20 de junio de 2015 en la Universidad Nacional Autónoma de México (UNAM, con directivos de escuelas y facultades de Informática y Computación. En aquella ocasión, la ponencia tenía por título: “¿Es posible la transformación docente? Más allá de la necesidad de efectividad en la gestión y de la apropiación del conocimiento”. El objetivo del ensayo es ahondar aún más en la formación pedagógica del profesorado universitario como un reto no sólo irresuelto, sino insuficiente y mal planteado, y generar controversia científica en este sentido. La metodología es dialéctica, hermenéutica, dialógica y destructiva de convicciones y certezas, obviamente con una última finalidad constructiva. Se recurre a una experiencia didáctica como hilo conductor explicativo. Las conclusiones apuntan a dos cuestiones: que la transformación docente sólo es posible o superficialmente o en la profundidad de la formación, que incluye planos y constructos inéditos o excluidos de la formación ordinaria del profesor universitario, y que si la formación no trasciende el conocimiento y la efectividad, no es tal.

  13. Zfp206 regulates ES cell gene expression and differentiation.

    Science.gov (United States)

    Zhang, Wen; Walker, Emily; Tamplin, Owen J; Rossant, Janet; Stanford, William L; Hughes, Timothy R

    2006-01-01

    Understanding transcriptional regulation in early developmental stages is fundamental to understanding mammalian development and embryonic stem (ES) cell properties. Expression surveys suggest that the putative SCAN-Zinc finger transcription factor Zfp206 is expressed specifically in ES cells [Zhang,W., Morris,Q.D., Chang,R., Shai,O., Bakowski,M.A., Mitsakakis,N., Mohammad,N., Robinson,M.D., Zirngibl,R., Somogyi,E. et al., (2004) J. Biol., 3, 21; Brandenberger,R., Wei,H., Zhang,S., Lei,S., Murage,J., Fisk,G.J., Li,Y., Xu,C., Fang,R., Guegler,K. et al., (2004) Nat. Biotechnol., 22, 707-716]. Here, we confirm this observation, and we show that ZFP206 expression decreases rapidly upon differentiation of cultured mouse ES cells, and during development of mouse embryos. We find that there are at least six isoforms of the ZFP206 transcript, the longest being predominant. Overexpression and depletion experiments show that Zfp206 promotes formation of undifferentiated ES cell clones, and positively regulates abundance of a very small set of transcripts whose expression is also specific to ES cells and the two- to four-cell stages of preimplantation embryos. This set includes members of the Zscan4, Thoc4, Tcstv1 and eIF-1A gene families, none of which have been functionally characterized in vivo but whose members include apparent transcription factors, RNA-binding proteins and translation factors. Together, these data indicate that Zfp206 is a regulator of ES cell differentiation that controls a set of genes expressed very early in development, most of which themselves appear to be regulators.

  14. Adolescent Girls with illegally Induced Abortion in Dar es Salaam

    DEFF Research Database (Denmark)

    Rasch, V; Silberschmidt, Margrethe; Mchumvu, Y

    2000-01-01

    that gave them the right to seek family planning services and in practice these services are not being provided. There is a need for youth-friendly family planning services and to make abortion safe and legal, in order to reduce unwanted pregnancies and abortion-related complications and deaths among......This article reports on a study of induced abortion among adolescent girls in Dar es Salaam, Tanzania, who were admitted to a district hospital in Dar es Salaam because of an illegally induced abortion in 1997. In the quantitative part of the study, 197 teenage girls (aged 14-19) were asked...

  15. High transfer cross sections from reactions with 254Es

    International Nuclear Information System (INIS)

    Schaedel, M.; Bruechle, W.; Bruegger, M.; Gaeggeler, H.; Moody, J.; Schardt, D.; Suemmerer, K.; Hulet, E.K.; Dougan, A.D.; Dougan, R.J.; Landrum, J.H.; Lougheed, R.W.; Wild, J.F.; O'Kelly, G.D.

    1985-08-01

    We report radiochemically determined cross sections for the heaviest known actinides produced in transfer reactions of 101 MeV 16 O, 98 MeV 18 O and 127 MeV 22 Ne with 254 Es as a target. A comparison with data for similar transfers from 248 Cm targets is made. Transfer cross sections are extrapolated for the production of unknown, neutron-rich isotopes of elements 101 through 105, and the unique potential of 254 Es as a target to make these exotic nuclei accessible is demonstrated. (orig.)

  16. La equidad no es mera declamación

    OpenAIRE

    Villamayor, Claudia

    2009-01-01

    Es de preocupación para las mujeres que participan de movimientos sociales y que trabajan en una lucha por sus derechos, que la futura Ley de comunicación audiovisual contemple en su redacción un enfoque de género. Impunemente, es muy común observar actitudes editoriales donde reina la homofobia, la xenofobia o la discriminación por discapacidades, por condiciones etáreas o por condición de credos. Una Ley de Servicios de Comunicación Audiovisual tiene que contemplar que los medios ...

  17. Specification Section 01065S ES&H for Service Contracts

    Energy Technology Data Exchange (ETDEWEB)

    Kirsch, Greg C. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)

    2014-07-01

    Section Includes: Requirements and guidelines in performance of work concerning protection of environment and property, and the safety and health of Contractors, Sandia National Laboratories (SNL) and Department of Energy (DOE) employees, visitors to SNL, and members of the public. This Section is applicable only to Service Contracts that do not involve construction or construction-like activities. Construction and construction-like activities are covered by Section 01065, Environment, Safety and Health (ES&H) for Construction Contracts. The entire ES&H program shall focus on safe-by-design intent, understanding the technical basis for the work, identifying and controlling energy sources, unacceptable consequences, risk assessments, and positive verification.

  18. Correlating lesion size and location to deficits after ischemic stroke: the influence of accounting for altered peri-necrotic tissue and incidental silent infarcts

    Directory of Open Access Journals (Sweden)

    Black Sandra E

    2010-01-01

    Full Text Available Abstract Background Investigators frequently quantify and evaluate the location and size of stroke lesions to help uncover cerebral anatomical correlates of deficits observed after first-ever stroke. However, it is common to discover silent infarcts such as lacunes in patients identified clinically as 'first-ever' stroke, and it is unclear if including these incidental findings may impact lesion-based investigations of brain-behaviour relationships. There is also debate concerning how to best define the boundaries of necrotic stroke lesions that blend in an ill-defined way into surrounding tissue, as it is unclear whether including this altered peri-necrotic tissue region may influence studies of brain-behaviour relationships. Therefore, for patients with clinically overt stroke, we examined whether including altered peri-necrotic tissue and incidental silent strokes influenced either lesion volume correlations with a measure of sensorimotor impairment or the anatomical localization of this impairment established using subtraction lesion analysis. Methods Chronic stroke lesions of 41 patients were manually traced from digital T1-MRI to sequentially include the: necrotic lesion core, altered peri-necrotic tissue, silent lesions in the same hemisphere as the index lesion, and silent lesions in the opposite hemisphere. Lesion volumes for each region were examined for correlation with motor impairment scores, and subtraction analysis was used to highlight anatomical lesion loci associated with this deficit. Results For subtraction lesion analysis, including peri-necrotic tissue resulted in a larger region of more frequent damage being seen in the basal ganglia. For correlational analysis, only the volume of the lesion core was significantly associated with motor impairment scores (r = -0.35, p = 0.025. In a sub-analysis of patients with small subcortical index lesions, adding silent lesions in the opposite hemisphere to the volume of the index

  19. Feeding Dar es Salaam: a symbiotic food system perspective

    NARCIS (Netherlands)

    Wegerif, Marc C.A.

    2017-01-01

    This thesis is a sociological analysis of the agri-food system that feeds most of the over four and a half million residents of the fast-growing city of Dar es Salaam in Tanzania. It is based on qualitative research that has generated a picture of the food system that supplies the important foods

  20. vARIATIONS MENSUELLES DURANT TROIS ANNÉES DU ...

    African Journals Online (AJOL)

    , Université .... ont reçu une alimentation à base de pâturage de. Panicum maximum avec ... Variations mensuelles durant trois années du nombre de spermatozoïdes par éjaculat et des paramètres de spermocytogramme du sperme de bélier ...

  1. Coastal Marine Pollution in Dar es Salaam (Tanzania) relative to ...

    African Journals Online (AJOL)

    Pollution surveys were undertaken during 2007 and 2008 in the coastal marine environment of Dar es Salaam and the remote Ras Dege Creek. The objective was to determine the levels of microbial contamination, heavy metals and persistent organic pollutants and compare these with the recommended environmental ...

  2. Invitation à soumettre des idées

    International Development Research Centre (IDRC) Digital Library (Canada)

    fdieudonne

    et de politiques en vue de favoriser des systèmes alimentaires plus sains et de prévenir les maladies non ... ultra-transformées, qui sont pauvres sur le plan nutritionnel. ... aux prix, et restrictions en matière de marketing visant à augmenter la ...

  3. Side relvaliigi rollist kaitseväes / Villem Sedrik

    Index Scriptorium Estoniae

    Sedrik, Villem

    2007-01-01

    Autor annab ülevaate siderelvaliigi arengust kaitseväes ning rõhutab lahinguolukorras erinevate võitlevate partnerite infosüsteemide koostöö ja infovahetuse tähtsust tänapäeval. Vt. ka Sõdur nr. 2 lk. 12-15. Vahur Parve. Kiirpilk sidepidamise ajalukku

  4. ES-cell derived hematopoietic cells induce transplantation tolerance.

    Directory of Open Access Journals (Sweden)

    Sabrina Bonde

    Full Text Available BACKGROUND: Bone marrow cells induce stable mixed chimerism under appropriate conditioning of the host, mediating the induction of transplantation tolerance. However, their strong immunogenicity precludes routine use in clinical transplantation due to the need for harsh preconditioning and the requirement for toxic immunosuppression to prevent rejection and graft-versus-host disease. Alternatively, embryonic stem (ES cells have emerged as a potential source of less immunogenic hematopoietic progenitor cells (HPCs. Up till now, however, it has been difficult to generate stable hematopoietic cells from ES cells. METHODOLOGY/PRINCIPAL FINDINGS: Here, we derived CD45(+ HPCs from HOXB4-transduced ES cells and showed that they poorly express MHC antigens. This property allowed their long-term engraftment in sublethally irradiated recipients across MHC barriers without the need for immunosuppressive agents. Although donor cells declined in peripheral blood over 2 months, low level chimerism was maintained in the bone marrow of these mice over 100 days. More importantly, chimeric animals were protected from rejection of donor-type cardiac allografts. CONCLUSIONS: Our data show, for the first time, the efficacy of ES-derived CD45(+ HPCs to engraft in allogenic recipients without the use of immunosuppressive agents, there by protecting cardiac allografts from rejection.

  5. Aloe; Beyond use as cosmetics | Pili | Dar Es Salaam Medical ...

    African Journals Online (AJOL)

    Dar Es Salaam Medical Students' Journal. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 15, No 1 (2008) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Aloe; Beyond use as cosmetics. K Pili. Abstract.

  6. Dar es Salaam City and Challenges in Solid Waste Management ...

    African Journals Online (AJOL)

    The focus of this paper is on challenges facing solid waste management in. Manzese and Sinza wards, in Dar es Salaam city. In this paper different ways of generating, disposing waste and the associated problems are surveyed. About 102 people were interviewed. Different methods were employed in data collection which ...

  7. Engineering geological mapping of Dar es Salaam city, Tanzania ...

    African Journals Online (AJOL)

    Two basic maps were prepared, namely, geomorphological and geological map depicts the spatial extent of the Neogene geological formations. Three distinct sandstone terraces could be distinguished in Dar es Salaam region at 0-15 m and 30 – 40 m above sea level. The terraces comprised sandstones fringed by coral ...

  8. Electrical stimulation (ES) in the management of sexual pain disorders.

    Science.gov (United States)

    Nappi, Rossella E; Ferdeghini, Francesea; Abbiati, Ileana; Vercesi, Claudia; Farina, Claudio; Polatti, Franco

    2003-01-01

    We performed an open study to investigate the use of electrical stimulation (ES) on the vestibular area and vaginal introitus in women with sexual pain disorders. We recruited 29 women (age range 20-45 years) from among the patients at our Reproductive Psychobiology Unit to participate in the present study. They each experienced vestibular pain, inducing dyspareunia and vaginism. We performed ES with an ECL43400 apparatus (Elite, EssediEsse srl, Milan, Italy) once a week for 10 weeks. To evaluate the muscular activity of the perineal floor and sexual function, we employed the same apparatus with a vaginal probe for recording myoelectrical activity (muV), we employed a VAS scale for evaluating pain, and we administered the Female Sexual Function Index (FSFI; Rosen et al., 2000) before and after the study protocol. We analyzed data by parametric and nonparametric comparisons and correlations, as appropriate. Our major findings were as follows: (a) the contractile ability of pelvic floor muscles (p vaginism went back to coital activity; (d) FSFI pain score and the current intensity tolerated, both before (R = .59; p < 0.006) and at the end (R = .53; p < 0.02) of the stimulation protocol, positively correlated. ES may be effective in the management of sexual pain disorders. Further controlled studies are necessary to standardize stimulation protocols according to the severity of pain and to better clarify the long-term clinical effects of ES.

  9. ¿Es la asistencia sexual un derecho?

    Directory of Open Access Journals (Sweden)

    Rafael De Asís Roig

    2017-12-01

    Full Text Available En este trabajo voy a reflexionar sobre la cuestión de la asistencia sexual y su posible configuración como derecho. La contestación a la pregunta sobre si la asistencia sexual es un derecho puede variar dependiendo del marco en el que nos desenvolvamos. Así, podemos estar hablando desde un marco estrictamente jurídico, desde un marco ético, o desde un marco a caballo entre ambos como es el de los derechos humanos. A partir de aquí, la pregunta sobre si la asistencia sexual es un derecho dependerá de la pregunta sobre qué es la asistencia sexual. La justificación de la asistencia sexual en relación con personas que no pueden realizar actividad sexual sobre su propio cuerpo puede encontrar una justificación ética de la mano de la teoría de las necesidades o de la mano de las Actividades Básicas de la Vida Diaria, e igualmente puede formar parte de los derechos sexuales o del derecho a elegir una forma de vida.

  10. Heavy Metals and Organic Pollutants in Sediments of Dar es ...

    African Journals Online (AJOL)

    The Florida criteria (MacDonald 1993) for assessment of pollution of tropical marine sediments was adopted in oredr to evaluate the extent of pollution in Dar es Salaam harbour sediments. The Florida criteria is one of the established references for sediment quality assessment. Heavy metals that had concentrations above ...

  11. Knowledge, Attitude and Practice of Commercial Drivers in Dar es ...

    African Journals Online (AJOL)

    Purpose: The objective of this study was, first, to assess the knowledge, attitude and practice of commercial drivers in Dar es Salaam with regard to medicines that impair driving, and second, to evaluate the adequacy of antihistamine label information. Methods: Drivers were interviewed using a questionnaire after obtaining ...

  12. Community violence in Dar es Salaam, Tanzania: A mixed methods ...

    African Journals Online (AJOL)

    Most homicide deaths in Dar es Salaam, Tanzania (DSM) are a result of violence arising from within the community. This type of violence is commonly called, by perpetrators and victims, “mob justice”. Unilateral non-state collective violence can take four forms: lynching, vigilantism, rioting, and terrorism. The purpose of this ...

  13. Accessibility, Congestion and Travel Delays in Dar es Salaam

    DEFF Research Database (Denmark)

    Melbye, Dea Christine; Møller-Jensen, Lasse; Andreasen, Manja Hoppe

    2015-01-01

    on to present a review of research into travel speed levels and congestion in Dar es Salaam. A set of city-wide maps of accessibility and delay levels are constructed based on available speed data and road network data obtained from the OpenStreetMap project and the findings are discussed with respect...

  14. OpenGL ES 3.0 cookbook

    CERN Document Server

    Singh, Parminder

    2015-01-01

    If you are new to OpenGL ES or have some experience in 3D graphics, then this book will be extremely helpful in raising your expertise level from a novice to professional. The book implements more than 90 recipes to solve everyday challenges, helping you transition from a beginner to a professional.

  15. [Silent myocardial ischemia and exercise-induced arrhythmia detected by the exercise test in the total health promotion plan (THP)].

    Science.gov (United States)

    Iwane, M; Shibe, Y; Itoh, K; Kinoshita, F; Kanagawa, Y; Kobayashi, M; Mugitani, K; Ohta, M; Ohata, H; Yoshikawa, A; Ikuta, Z; Nakamura, Y; Mohara, O

    2001-03-01

    We investigated the prevalence and characteristics of ischemic heart disease especially silent myocardial ischemia (SMI) and arrhythmia in need of careful observation in the exercise stress tests in the Total Health Promotion Plan (THP), which was conducted between 1994-96 for the purpose of measuring cardiopulmonary function. All workers (n = 4,918, 4,426 males) aged 18-60 yr old in an occupational field were studied. Exercise tests with an ergometer were performed by the LOPS protocol, in which the maximal workload was set up as a presumed 70-80% maximal oxygen intake, or STEP (original multistage protocol). ECG changes were evaluated with a CC5 lead. Two hundred and fifteen people refused the study because of a common cold, lumbago and so on. Of 4,703 subjects, 17 with abnormal rest ECG and 19 with probable anginal pain were excluded from the exercise tests. Of 4,667 who underwent the exercise test, 37 (0.79%) had ischemic ECG change, and 155 (3.32%) had striking arrhythmia. These 228 subjects then did a treadmill exercise test with Bruce protocol. Twenty-two (0.47% of 4,703) showed positive ECG change, 9 (0.19%) of 22 had abnormal findings on a 201Tl scan. 8 (0.17%) were diagnosed as SMI (Cohn I), in which the prevalence of hypertension, hyperlipidemia, diabetes mellitus, smoker and positive familial history of ischemic heart disease was greater than that of all subjects. In a 15-30 month follow up, none has developed cardiac accidents. Exercise-induced arrhythmia was detected in 11 (0.23%) subjects. Four were non-sustained ventricular tachycardia without any organic disease, 4 were ventricular arrhythmia based on cardiomyopathy detected by echocardiography, 2 were atrial fibrillation and another was WPW syndrome. It is therefore likely that the ergometer exercise test in THP was effective in preventing sudden death caused by ischemic heart disease or striking arrhythmia.

  16. AUTOPSY-BASED STUDY OF SILENT LIVER DISEASES IN MEDICOLEGAL CASES IN A TERTIARY CARE CENTRE OF EASTERN ODISHA

    Directory of Open Access Journals (Sweden)

    Bidyut Prava Das

    2017-05-01

    Full Text Available BACKGROUND An autopsy is a medical procedure that consists of a thorough examination of corpse to determine the cause of death and to evaluate any diseases that maybe present. Most of the chronic liver diseases even in advanced stages may cause no signs and symptoms and may go undiagnosed or are found coincidently during general health checkup, investigation being done for some other disease, surgery or autopsy. The underlying cause of chronic liver diseases vary in different geographic areas and are based on various factors such as socioeconomic status, lifestyle, diet, local and other endemic diseases. Hence, we have conducted this study to unearth the silent liver diseases in medicolegal cases. MATERIALS AND METHODS The study was carried out in Department of Pathology and Forensic Medicine and Toxicology of SCB Medical College, Cuttack, during 2012 to 2015. All medicolegal cases received for autopsy are included in the study. Routine HE stain and special stain like reticulin, Masson trichrome stain was used wherever necessary and results were analysed. RESULTS Autopsy was done in 139 cases. Portal inflammation and fibrosis was found in 35 (25.18% cases. Sinusoidal dilatation and congestion in 29 cases (20.86%, cirrhosis and bridging fibrosis was found in 16 cases (11.5%, steatohepatitis in 27 cases (19.42%, cholestasis in 3 cases (2.16%, hepatitis 1 case (0.72% and hepatocellular carcinoma in 1 case (0.72%. The others include autolytic changes and normal liver. CONCLUSION Autopsy and histopathological study of liver is the best method to determine the clinically latent liver diseases.

  17. Variation of poorly ventilated lung units (silent spaces) measured by electrical impedance tomography to dynamically assess recruitment.

    Science.gov (United States)

    Spadaro, Savino; Mauri, Tommaso; Böhm, Stephan H; Scaramuzzo, Gaetano; Turrini, Cecilia; Waldmann, Andreas D; Ragazzi, Riccardo; Pesenti, Antonio; Volta, Carlo Alberto

    2018-01-31

    Assessing alveolar recruitment at different positive end-expiratory pressure (PEEP) levels is a major clinical and research interest because protective ventilation implies opening the lung without inducing overdistention. The pressure-volume (P-V) curve is a validated method of assessing recruitment but reflects global characteristics, and changes at the regional level may remain undetected. The aim of the present study was to compare, in intubated patients with acute hypoxemic respiratory failure (AHRF) and acute respiratory distress syndrome (ARDS), lung recruitment measured by P-V curve analysis, with dynamic changes in poorly ventilated units of the dorsal lung (dependent silent spaces [DSSs]) assessed by electrical impedance tomography (EIT). We hypothesized that DSSs might represent a dynamic bedside measure of recruitment. We carried out a prospective interventional study of 14 patients with AHRF and ARDS admitted to the intensive care unit undergoing mechanical ventilation. Each patient underwent an incremental/decremental PEEP trial that included five consecutive phases: PEEP 5 and 10 cmH 2 O, recruitment maneuver + PEEP 15 cmH 2 O, then PEEP 10 and 5 cmH 2 O again. We measured, at the end of each phase, recruitment from previous PEEP using the P-V curve method, and changes in DSS were continuously monitored by EIT. PEEP changes induced alveolar recruitment as assessed by the P-V curve method and changes in the amount of DSS (p Recruited volume measured by the P-V curves significantly correlated with the change in DSS (r s  = 0.734, p recruitment measured using the P-V curve technique. EIT might provide useful information to titrate personalized PEEP. ClinicalTrials.gov, NCT02907840 . Registered on 20 September 2016.

  18. Altered myocardial perfusion during dobutamine stress testing in silent versus symptomatic myocardial ischaemia assessed by quantitative MIBI SPET imaging

    International Nuclear Information System (INIS)

    Elhendy, A.; Geleijnse, M.L.; Roelandt, J.R.T.C.; Cornel, J.H.; Domburg, R.T van; Reijs, A.E.M.; Nierop, P.R.; Fioretti, P.M.

    1996-01-01

    The aim of the study was to compare the extent and severity of reversible underperfusion in silent versus painful myocardial ischaemia during the dobutamine stress test. A consecutive series of 85 patients with significant coronary artery disease and reversible perfusion defects on technetium-99m methoxyisobutylisonitrile single-photon emission tomography performed at rest and during high-dose dobutamine stress (up to 40 μg kg -1 min -1 ) were studied. The left ventricle was divided into six segments. An ischaemic perfusion score was derived quantitatively by subtracting the rest from the stress defect score. Patients with multivessel disease had a higher ischaemic score (610±762 vs 310±411, P<0.05) and a higher number of reversible perfusion defects (2.1±1.2 vs 1.1±0.8, P<0.01) than patients with single-vessel disease. Typical angina occurred in 37 patients (44%) during the test. There was no significant difference between patients with and patients without angina with respecft to age, gender, peak rate-pressure product, prevalence of previous myocardial infarction, diabetes mellitus, multivessel disease or number of stenotic coronary arteries. Stress, rest and ischaemic scores as well as the number and distribution of reversible defects were not different in patients with and patients without angina. Patients with angina more frequently had a history of typical angina before the test (43% vs 17%, P<0.01) and ST-segment depression during the test (54% vs 25%, P<0.01). It is concluded that in patients with coronary artery disease and ischaemia detected by dobutamine scintigraphy, the extent and severity of coronary artery disease and myocardial perfusion abnormalities are similar with or without angina during stess testing. (orig.)

  19. Sildenafil protects against bile duct ligation induced hepatic fibrosis in rats: Potential role for silent information regulator 1 (SIRT1).

    Science.gov (United States)

    Abd El Motteleb, Dalia M; Ibrahim, Islam A A E-H; Elshazly, Shimaa M

    2017-11-15

    Hepatic fibrosis is a potential health problem that may end with life-threatening cirrhosis and primary liver cancer. Recent studies point out to the protective effects of silent information regulator1 (SIRT1), against different models of organs fibrosis. This work aimed to investigate the possible protective effect of sildenafil (SIRT1 activator) against hepatic fibrosis induced by bile duct ligation (BDL). Firstly, three different doses of sildenafil (5, 10, 20mg/kg/day) were investigated; to detect the most protective one against BDL induced liver dysfunction and hepatic fibrosis. The most protective dose is then used; to study its effect on BDL induced SIRT1 downregulation, imbalance of oxidant/antioxidant status, increased inflammatory cytokines and fibrosis. Sildenafil (20mg/kg/day) was the most protective one, it caused upregulation of SIRT1, reduction of hepatic malondialdehyde (MDA) content, increase in expression of nuclear factor erythroid 2-related factor 2 (Nrf2), hemeoxygenease (HO)-1, reduced glutathione (GSH) content and superoxide dismutase (SOD) activity. Hepatic content of tumor necrosis factor-α (TNF-α) and nuclear factor κB (NFκB) expression & content displayed significant reductions with sildenafil treatment, Furthermore, sildenafil caused marked reductions of transforming growth factor (TGF)-β content, expression of plasminogen activator inhibitor-1 (PAI-1), matrix metalloproteinase-9 (MMP-9), tissue inhibitor of metalloproteinase-1 (TIMP-1), α-smooth muscle actin (α-SMA), fibronectin, collagen I (α1) and hydroxyproline content. However, sildenafil protective effects were significantly reduced by co-administration of EX527 (SIRT1 inhibitor). Our work showed, for the first time that, sildenafil has promising protective effects against BDL induced liver dysfunction and hepatic fibrosis. These effects may be, in part, mediated by up regulation of SIRT1. Copyright © 2017. Published by Elsevier Inc.

  20. Neuronal SIRT1 (Silent Information Regulator 2 Homologue 1) Regulates Glycolysis and Mediates Resveratrol-Induced Ischemic Tolerance.

    Science.gov (United States)

    Koronowski, Kevin B; Khoury, Nathalie; Saul, Isabel; Loris, Zachary B; Cohan, Charles H; Stradecki-Cohan, Holly M; Dave, Kunjan R; Young, Juan I; Perez-Pinzon, Miguel A

    2017-11-01

    Resveratrol, at least in part via SIRT1 (silent information regulator 2 homologue 1) activation, protects against cerebral ischemia when administered 2 days before injury. However, it remains unclear if SIRT1 activation must occur, and in which brain cell types, for the induction of neuroprotection. We hypothesized that neuronal SIRT1 is essential for resveratrol-induced ischemic tolerance and sought to characterize the metabolic pathways regulated by neuronal Sirt1 at the cellular level in the brain. We assessed infarct size and functional outcome after transient 60 minute middle cerebral artery occlusion in control and inducible, neuronal-specific SIRT1 knockout mice. Nontargeted primary metabolomics analysis identified putative SIRT1-regulated pathways in brain. Glycolytic function was evaluated in acute brain slices from adult mice and primary neuronal-enriched cultures under ischemic penumbra-like conditions. Resveratrol-induced neuroprotection from stroke was lost in neuronal Sirt1 knockout mice. Metabolomics analysis revealed alterations in glucose metabolism on deletion of neuronal Sirt1 , accompanied by transcriptional changes in glucose metabolism machinery. Furthermore, glycolytic ATP production was impaired in acute brain slices from neuronal Sirt1 knockout mice. Conversely, resveratrol increased glycolytic rate in a SIRT1-dependent manner and under ischemic penumbra-like conditions in vitro. Our data demonstrate that resveratrol requires neuronal SIRT1 to elicit ischemic tolerance and identify a novel role for SIRT1 in the regulation of glycolytic function in brain. Identification of robust neuroprotective mechanisms that underlie ischemia tolerance and the metabolic adaptations mediated by SIRT1 in brain are crucial for the translation of therapies in cerebral ischemia and other neurological disorders. © 2017 American Heart Association, Inc.

  1. Interferon β protects against avascular osteonecrosis through interleukin 6 inhibition and silent information regulator transcript-1 upregulation.

    Science.gov (United States)

    Kim, Kyoung Min; Wagle, Sajeev; Moon, Young Jae; Wang, Sung Il; Park, Byung-Hyun; Jang, Kyu Yun; Kim, Jung Ryul

    2018-01-09

    Synovitis of the affected joint is a common in avascular osteonecrosis (AVN). Increased levels of pro-inflammatory cytokine interleukin-6 (IL-6) have been reported in AVN, but the mechanism of this increase remains unclear. Silent information regulator transcript-1 (SIRT1), an NAD-dependent deacetylase, inhibits the release of inflammatory cytokines. Interferon β (IFN-β) has clear anti-inflammatory properties. We sought to investigate the effects of IFN-β treatment on AVN and to evaluate the specific signal pathway relating to IL-6 and SIRT1 affected during AVN. Using a dissection microscope, AVN was surgically induced in the distal femurs of mice. Exogenous IFN-β was administered to the model mice. The effects of exogenous IFN-β on AVN model mice were assessed using hematoxylin eosin and safranin-O staining, and bone resorption activity was measured using tartrate-resistant acid phosphatase (TRAP) and CD68 staining. Western blots, real-time RT-PCR, and immunohistochemical staining were performed to evaluate the production of SIRT1 and IL-6 in tissues. The RAW 264.7 cell line and bone marrow derived osteoclasts treated with exogenous IFN-β. Histological findings indicated well preserved trabecular bone and decreased osteoclast bone resorption activity in IFN-β treated mice compared with mice in the AVN group. Treatment with IFN-β increased SIRT1 expression and inhibited secretion of IL-6 in this AVN mouse model. IFN-β decreased IL-6 secretion by activating SIRT1 in the RAW 264.7 cell and bone marrow derived osteoclasts. Our work suggests that IFN-β could be used to treat AVN and that both SIRT1 and IL-6 are useful targets for treating patients with AVN.

  2. Many Neighbors are not Silent. fMRI Evidence for Global Lexical Activity in Visual Word Recognition.

    Directory of Open Access Journals (Sweden)

    Mario eBraun

    2015-07-01

    Full Text Available Many neurocognitive studies investigated the neural correlates of visual word recognition, some of which manipulated the orthographic neighborhood density of words and nonwords believed to influence the activation of orthographically similar representations in a hypothetical mental lexicon. Previous neuroimaging research failed to find evidence for such global lexical activity associated with neighborhood density. Rather, effects were interpreted to reflect semantic or domain general processing. The present fMRI study revealed effects of lexicality, orthographic neighborhood density and a lexicality by orthographic neighborhood density interaction in a silent reading task. For the first time we found greater activity for words and nonwords with a high number of neighbors. We propose that this activity in the dorsomedial prefrontal cortex reflects activation of orthographically similar codes in verbal working memory thus providing evidence for global lexical activity as the basis of the neighborhood density effect. The interaction of lexicality by neighborhood density in the ventromedial prefrontal cortex showed lower activity in response to words with a high number compared to nonwords with a high number of neighbors. In the light of these results the facilitatory effect for words and inhibitory effect for nonwords with many neighbors observed in previous studies can be understood as being due to the operation of a fast-guess mechanism for words and a temporal deadline mechanism for nonwords as predicted by models of visual word recognition. Furthermore, we propose that the lexicality effect with higher activity for words compared to nonwords in inferior parietal and middle temporal cortex reflects the operation of an identification mechanism and based on local lexico-semantic activity.

  3. Chronic and acute anemia and extracranial internal carotid stenosis are risk factors for silent cerebral infarcts in sickle cell anemia.

    Science.gov (United States)

    Bernaudin, Françoise; Verlhac, Suzanne; Arnaud, Cécile; Kamdem, Annie; Vasile, Manuela; Kasbi, Florence; Hau, Isabelle; Madhi, Fouad; Fourmaux, Christine; Biscardi, Sandra; Epaud, Ralph; Pondarré, Corinne

    2015-03-05

    Early transcranial Doppler (TCD) screening of the Créteil sickle cell anemia (SCA)-newborn cohort, and rapid initiation of transfusion programs, resulted in successful prevention of overt strokes, but a high cumulative risk of silent cerebral infarcts (SCI) remained, suggesting that TCD screening does not identify all patients with SCA at risk for SCI. We hypothesized that episodes of hypoperfusion/hypoxia, as observed during acute chest syndromes or acute anemic events (AAE), and extracranial internal carotid artery (eICA) stenoses, detectable via submandibular Doppler sonography and cervical magnetic resonance angiography (MRA), could also be risk factors for SCI. This study includes 189 stroke-free patients with SCA from the Créteil newborn cohort (1992-2010) followed longitudinally by magnetic resonance imaging/MRA, including cervical MRA at the last assessment. All patients with abnormal TCD and/or intracranial stenoses were placed on a transfusion program. Mean follow-up was 9.9 years (range, 2.2-19.9 years; 1844 patient-years). Annual rates of clinical events were calculated. The cumulative risk for SCI was 39.1% (95% confidence interval [CI], 23.5%-54.7%) by age 18 years, with no plateau. We confirm that baseline hemoglobin level lower than 7 g/dL before age 3 years is a highly significant predictive risk factor for SCI (hazard ratio, 2.97; 95% CI, 1.43-6.17; P = .004). Furthermore, we show that AAE rate (odds ratio, 2.64 per unit increase; 95% CI, 1.09-6.38; P = .031) and isolated eICA stenosis (odds ratio, 3.19; 95% CI, 1.18-8.70; P = .023) are significant and independent risk factors for SCI. © 2015 by The American Society of Hematology.

  4. [Cross-cultural adaptation to the European Portuguese of the questionnaire "Patient Knowledge about their Medications" (CPM-ES-ES)].

    Science.gov (United States)

    Salmerón Rubio, Joaquín; Iglésias-Ferreira, Paula; García Delgado, Pilar; Mateus-Santos, Henrique; Martínez-Martínez, Fernando

    2013-12-01

    The scope of this work is to conduct the cross-cultural adaptation from Spanish to European Portuguese of a questionnaire to measure the degree of "Patient Knowledge about their Medications" (CPM-ES-ES). A method based on six steps was applied: 1. Translation into Portuguese, 2. Elaboration of the first consensus version in Portuguese; 3.Back-translation into Spanish; 4. Elaboration of the second consensus version (cultural equivalency); 5. Conducting the pre-test; 6. Evaluation of the overall results. A cross-culturally adapted questionnaire in European Portuguese that measures the degree of "Patient Knowledge about their Medications" is proposed. The pre-test confirmation obtained 100% agreement with the corrected version of the second consensus version after pre-testing. The methodology selected made it possible to cross-culturally adapt the Spanish version of the CPM-ES-ES questionnaire to the Portuguese version. Further studies should demonstrate the equivalence of the psychometric properties of the cross-cultural translation into Portuguese with the original version.

  5. ¿El beber café es salud?

    Directory of Open Access Journals (Sweden)

    María Del Rosario Alvarez-Ramirez

    2005-12-01

    Full Text Available El café es una bebida universal responsable de levantar a muchos cada mañana. El uso continuo de bebidas con cafeína también produce efectos a largo plazo. Los cuales aumentan su riesgo a 120% si bebe diariamente 6 o más tazas de café. La cafeína también puede causar úlceras en el estómago, producir alergias, insomnios, irritabilidad, palpitaciones, fiebre y otros síntomas como: aumentar los niveles de noradrenalina (neurotransmisor que produce un estado de alerta. Por las mismas razones que el café aumenta el estado de alerta y estimula el rendimiento mental, una taza de café es una forma ideal de comenzar el día.

  6. Les crises soudanaises des années 80

    OpenAIRE

    Ahmed, Medani M.; al-Shazali, Salah al-Din; al-Shazali, Salah al-Din; al-Shazali, Salah al-Din; al-Shazali, Salah al-Din; Al-Tom, Abdulahi Osman; Babiker, Mustafa; Babiker, Mustafa; Blin, Louis; Conte, Édouard; Elmekki, Abdelgalil M.; Gore, Paul W.; Hamid, Mohammed Beshir; Ireton, François; Jacquemond, Richard

    2008-01-01

    Ce dossier est constitué, dans sa quasi-totalité, de contributions de chercheurs et universitaires soudanais proposant une analyse de certains des problèmes cruciaux que leur pays a connus depuis le début des années 80. Les articles qui le composent correspondent aux communications qui devaient initialement être présentées lors d’un colloque portant sur le même thème, prévu à Paris pour décembre 1991 et qui n'a pu avoir lieu du fait de l’impossibilité où se trouvaient certains de ses particip...

  7. An adaptive ES with a ranking based constraint handling strategy

    Directory of Open Access Journals (Sweden)

    Kusakci Ali Osman

    2014-01-01

    Full Text Available To solve a constrained optimization problem, equality constraints can be used to eliminate a problem variable. If it is not feasible, the relations imposed implicitly by the constraints can still be exploited. Most conventional constraint handling methods in Evolutionary Algorithms (EAs do not consider the correlations between problem variables imposed by the constraints. This paper relies on the idea that a proper search operator, which captures mentioned implicit correlations, can improve performance of evolutionary constrained optimization algorithms. To realize this, an Evolution Strategy (ES along with a simplified Covariance Matrix Adaptation (CMA based mutation operator is used with a ranking based constraint-handling method. The proposed algorithm is tested on 13 benchmark problems as well as on a real life design problem. The outperformance of the algorithm is significant when compared with conventional ES-based methods.

  8. Cloning of ES cells and mice by nuclear transfer.

    Science.gov (United States)

    Wakayama, Sayaka; Kishigami, Satoshi; Wakayama, Teruhiko

    2009-01-01

    We have been able to develop a stable nuclear transfer (NT) method in the mouse, in which donor nuclei are directly injected into the oocyte using a piezo-actuated micromanipulator. Although the piezo unit is a complex tool, once mastered it is of great help not only in NT experiments, but also in almost all other forms of micromanipulation. Using this technique, embryonic stem (ntES) cell lines established from somatic cell nuclei can be generated relatively easily from a variety of mouse genotypes and cell types. Such ntES cells can be used not only for experimental models of human therapeutic cloning but also as a means of preserving mouse genomes instead of preserving germ cells. Here, we describe our most recent protocols for mouse cloning.

  9. Coherent structures in the Es layer and neutral middle atmosphere

    Science.gov (United States)

    Mošna, Zbyšek; Knížová, Petra Koucká; Potužníková, Kateřina

    2015-12-01

    The present paper shows results from the summer campaign performed during geomagnetically quiet period from June 1 to August 31, 2009. Within time-series of stratospheric and mesospheric temperatures at pressure levels 10-0.1 hPa, mesospheric winds measured in Collm, Germany, and the sporadic E-layer parameters foEs and hEs measured at the Pruhonice station we detected specific coherent wave-bursts in planetary wave domain. Permanent wave-like activity is observed in all analyzed data sets. However, the number of wave-like structures persistent in large range of height from the stratosphere to lower ionosphere is limited. The only coherent modes that are detected on consequent levels of the atmosphere are those corresponding to eigenmodes of planetary waves.

  10. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Aqua-FM3_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  11. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CERES:CER_ES9_PFM+FM1_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  12. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Terra-FM2_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  13. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF ( CER_ES9_Aqua-FM3_Edition1-CV)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2006-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  14. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_PFM+FM1_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  15. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_FM1+FM4_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  16. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Aqua-FM4_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  17. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_PFM+FM2_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  18. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF ( CER_ES9_Terra-FM1_Edition1-CV)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2006-09-30] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  19. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Aqua-FM4_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  20. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF ( CER_ES9_Aqua-FM4_Edition1-CV)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  1. CERES ERBE-like Monthly Regional Averages (ES-9) in HDF (CER_ES9_Terra-FM1_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Regional Averages (ES-9) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-9 is also produced for combinations of scanner instruments. All instantaneous shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-8 product for a month are sorted by 2.5-degree spatial regions, by day number, and by the local hour of observation. The mean of the instantaneous fluxes for a given region-day-hour bin is determined and recorded on the ES-9 along with other flux statistics and scene information. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The ES-9 also contains hourly average fluxes for the month and an overall monthly average for each region. These average fluxes are given for both clear-sky and total-sky scenes. The following CERES ES9 data sets are currently available: CER_ES9_FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition1 CER_ES9_PFM+FM1+FM2_Edition2 CER_ES9_PFM+FM1_Edition1 CER_ES9_PFM+FM2_Edition1 CER_ES9_PFM+FM1_Edition2 CER_ES9_PFM+FM2_Edition2 CER_ES9_TRMM-PFM_Edition1 CER_ES9_TRMM-PFM_Edition2 CER_ES9_Terra-FM1_Edition1 CER_ES9_Terra-FM2_Edition1 CER_ES9_FM1+FM2_Edition2 CER_ES9_Terra-FM1_Edition2 CER_ES9_Terra-FM2_Edition2 CER_ES9_Aqua-FM3_Edition1 CER_ES9_Aqua-FM4_Edition1 CER_ES9_FM1+FM2+FM3+FM4_Edition1 CER_ES9_Aqua-FM3_Edition2 CER_ES9_Aqua-FM4_Edition2 CER_ES9_FM1+FM3_Edition2 CER_ES9_FM1+FM4_Edition2 CER_ES9_Aqua-FM3_Edition1-CV CER_ES9_Aqua-FM4_Edition1-CV CER_ES9_Terra-FM1_Edition1-CV CER_ES9_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost

  2. Les mosquées ibadites du Maghreb

    Directory of Open Access Journals (Sweden)

    Virginie Prevost

    2012-07-01

    Full Text Available Les mosquées ibadites du Mzab, de Djerba et du djebel Nafûsa partagent plusieurs caractéristiques communes, la plus importante étant la multiplication des mihrabs et des lieux de prière extérieurs à la salle. Les mosquées mozabites se distinguent plus particulièrement par leur haut minaret de type saharien et par leur respect absolu de deux particularités ibadites, l’absence de minbar et le refus de toute forme de décoration. Quant au djebel Nafûsa et à Djerba, ils présentent des mosquées assez semblables, très modestes et parfois souterraines, dont le minaret, s’il existe, adopte des styles très diversifiés. Certaines salles de prière portent le traditionnel décor géométrique berbère. Les mosquées djerbiennes, dont l’architecture est intrinsèquement liée à l’insularité, sont spécialement intéressantes par leur intégration au système défensif de l’île, par la diversité des décors ajoutés tardivement et surtout par la fréquence du minaret-escalier qui a été conservé au travers des siècles.

  3. Coherent structures in the Es layer and neutral middle atmosphere

    Czech Academy of Sciences Publication Activity Database

    Mošna, Zbyšek; Koucká Knížová, Petra; Potužníková, Kateřina

    136 B, December (2015), s. 155-162 ISSN 1364-6826 R&D Projects: GA ČR(CZ) GA15-24688S; GA ČR(CZ) GAP209/12/2440 Institutional support: RVO:68378289 Keywords : critical frequency foEs * mesospheric temperature * mesospheric winds * planetary waves * Rossby mode * sporadic layer * stratospheric temperature Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 1.463, year: 2015 http://www.sciencedirect.com/science/article/pii/S1364682615001273

  4. What is effective is fair Lo eficaz es justo

    Directory of Open Access Journals (Sweden)

    Le Mouël Jacques

    1997-06-01

    Full Text Available In this text, which comes from Chapter 3 of his book, Jacques Le Mouel completes the philosophical reflection about the entrepreneurial myth of effectiveness founded in the sophism: "What is effective is true. What is true is faie. Therefore, what is effective is fair". The fact that management is elevated to the category of paradigm for the economic model of Western society and the collapse of the economies of the East has led to neglect that, now, we ourselves are the modelo His analysis of the supposed neutrality of science and of the differences between ethics and morality, in the framework of the firm and its relations with society, lead him to conclude that it is not true that what is effective is fair, and that the firm cannot serve as a model for contemporary society, since the end does not justify the means.En este texto, que corresponde al capitulo 3 de su libro, Jaques Le Mouël completa la reflexión filosófica sobre el mito empresarial de la eficacia funadado en el sofisma: "Lo eficaz es verdadero. Lo verdadero es justo. Luego, lo eficaz es justo". El hecho de elevar la administración a la categoría de paradigma del modelo económico de la sociedad occidental y el hundimiento de las economías del Este han llevado a ignorar que, ahora, el modelo somos nosotros mismos. Su análisis de la pretendida neutralidad de la ciencia y las diferencias entre ética y moral, en el marco de la empresa y en sus relaciones con la sociedad, lo lleva a concluir que no es cierto que lo eficaz sea justo y que la empresa no puede servir de modelo a la sociedad contemporánea, pues el fin no justifica los medios.

  5. POLITIQUES ÉCLAIRÉES Des politiques judicieuses favorisent le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La valeur des travaux de recherche que le CRDI subventionne depuis 1970 réside dans les améliorations apportées aux conditions de vie. Ces travaux entraînent des changements dans les lois et les attitudes; par example, ils permettent aux pauvres de se faire entendre, augmentent les ressources financières et rendent ...

  6. Conception de bases de données avec UML

    CERN Document Server

    Roy, Gilles

    2007-01-01

    De l'analyse à la conception, cet ouvrage accorde une importance prédominante au modèle conceptuel de données et propose des règles, des techniques, des astuces et des mises en garde qui doivent guider le modélisateur dans la réalisation d'un bon modèle conceptuel.

  7. A Browning process : The case of Dar es Salaam city

    OpenAIRE

    Mng'ong'o, Othmar Simtali

    2005-01-01

    The study is about how green spaces and structures of Dar es Salaam city, quantitatively and qualitatively, are browning out. It also tries to explore the different reasons behind the browning tendency, and what it means to the function of the city and to the daily form of life of the inhabitants. Finally there is a discussion about how to counteract the tendency by involving the inhabitants in planning procedures following the communicative approach to planning. The main investigations have ...

  8. [History of the Journées Dermatologiques de Paris].

    Science.gov (United States)

    Tilles, G

    2013-12-01

    Founded in 1801 at the Hôpital Saint-Louis, Paris, under Jean-Louis Alibert, the French School of Dermatology was initially structured around the French Society of Dermatology (1889) and the organization of two world congresses (Paris 1889, 1900). After World War I, the creation of dermatological societies in the provinces infused French dermatology with new energy. In 1922, the first congress of the French-speaking dermatologists further contributed to the public profile of dermatologists in France. The "Journées de Mars" were initiated in 1961 at the Hôpital Saint-Louis, and in 1975 they went on to become the "Journées dermatologiques de Paris". Pr. Jean Civatte played a key role in their creation and in their organization for 30 years. After 1979, since actual patients could no longer be presented, the organizers of the congress had to change the content of the meeting from clinical presentations to post-graduate teaching and clinical research. From its origins in the form of meetings of French dermatologists in an intimate setting at the Hôpital Saint-Louis, the "Journées dermatologiques de Paris" grew within the ensuing decades into a major scientific event of the French-speaking dermatological community, bringing together more than 4000 participants in December each year. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  9. Analizadores Multilingües en FreeLing

    Directory of Open Access Journals (Sweden)

    Lluís Padró

    2012-01-01

    Full Text Available FreeLing es una librería de código abierto para el procesamiento multilíngüe automático, que proporciona una amplia gama de servicios de análisis lingüístico para diversos idiomas. FreeLing ofrece a los desarrolladores de aplicaciones de Procesamiento del Lenguaje Natural funciones de análisis y anotación lingüística de textos, con la consiguiente reducción del coste de construcción de dichas aplicaciones. FreeLing es personalizable y ampliable, y está fuertemente orientado a aplicaciones del mundo real en términos de velocidad y robustez. Los desarrolladores pueden utilizar los recursos lingüísticos por defecto (diccionarios, lexicones, gramáticas, etc, ampliarlos, adaptarlos a dominios particulares, o –dado que la librería es de código abierto– desarrollar otros nuevos para idiomas específicos o necesidades especiales de las aplicaciones. Este artículo presenta los principales cambios y mejoras incluidos en la versión 3.0 de FreeLing, y resume algunos proyectos industriales relevantes en los que se ha utilizado.

  10. Solar Energy Grid Integration Systems -- Energy Storage (SEGIS-ES).

    Energy Technology Data Exchange (ETDEWEB)

    Hanley, Charles J.; Ton, Dan T. (U.S. Department of Energy, Washington, D.C.); Boyes, John D.; Peek, Georgianne Huff

    2008-07-01

    This paper describes the concept for augmenting the SEGIS Program (an industry-led effort to greatly enhance the utility of distributed PV systems) with energy storage in residential and small commercial applications (SEGIS-ES). The goal of SEGIS-ES is to develop electrical energy storage components and systems specifically designed and optimized for grid-tied PV applications. This report describes the scope of the proposed SEGIS-ES Program and why it will be necessary to integrate energy storage with PV systems as PV-generated energy becomes more prevalent on the nation's utility grid. It also discusses the applications for which energy storage is most suited and for which it will provide the greatest economic and operational benefits to customers and utilities. Included is a detailed summary of the various storage technologies available, comparisons of their relative costs and development status, and a summary of key R&D needs for PV-storage systems. The report concludes with highlights of areas where further PV-specific R&D is needed and offers recommendations about how to proceed with their development.

  11. Prevalence of symptomatic and silent stress-induced perfusion defects in diabetic patients with suspected coronary artery disease referred for myocardial perfusion scintigraphy

    International Nuclear Information System (INIS)

    Prior, John O.; Calcagni, Maria-Lucia; Bischof Delaloye, Angelika; Monbaron, David; Ruiz, Juan; Koehli, Melanie

    2005-01-01

    Silent myocardial ischaemia - as evaluated by stress-induced perfusion defects on myocardial perfusion scintigraphy (MPS) in patients without a history of chest pain - is frequent in diabetes and is associated with increased rates of cardiovascular events. Its prevalence has been determined in asymptomatic diabetic patients, but remains largely unknown in diabetic patients with suspected coronary artery disease (CAD) in the clinical setting. In this study we therefore sought (a) to determine the prevalence of symptomatic and silent perfusion defects in diabetic patients with suspected CAD and (b) to characterise the eventual predictors of abnormal perfusion. The patient population comprised 133 consecutive diabetic patients with suspected CAD who had been referred for MPS. Studies were performed with exercise (41%) or pharmacological stress testing (1-day protocol, 99m Tc-sestamibi, 201 Tl or both). We used semi-quantitative analysis (20-segment polar maps) to derive the summed stress score (SSS) and the summed difference score (SDS). Abnormal MPS (SSS≥4) was observed in 49 (37%) patients (SSS=4.9±8.4, SDS=2.4±4.7), reversible perfusion defects (SDS≥2) in 40 (30%) patients [SSS=13.3±10.9; SDS=8.0±5.6; 20% moderate to severe (SDS>4), 7% multivessel] and fixed defects in 21 (16%) patients. Results were comparable between patients with and patients without a history of chest pain. Of 75 patients without a history of chest pain, 23 (31%, 95% CI=21-42%) presented reversible defects (SSS=13.9±11.3; SDS=7.4±1.2), indicative of silent ischaemia. Reversible defects were associated with inducible ST segment depression during MPS stress (odds ratio (OR)=3.2, p<0.01). Fixed defects were associated with erectile dysfunction in males (OR=3.7, p=0.02) and lower aspirin use (OR=0.25, p=0.02). Silent stress-induced perfusion defects occurred in 31% of the patients, a rate similar to that in patients with a history of chest pain. MPS could identify these patients with a

  12. Prevalence of symptomatic and silent stress-induced perfusion defects in diabetic patients with suspected coronary artery disease referred for myocardial perfusion scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Prior, John O.; Calcagni, Maria-Lucia; Bischof Delaloye, Angelika [Centre Hospitalier Universitaire Vaudois (CHUV University Hospital), Division of Nuclear Medicine, Lausanne (Switzerland); Monbaron, David; Ruiz, Juan [Centre Hospitalier Universitaire Vaudois (CHUV University Hospital), Division of Endocrinology, Diabetology and Metabolism, Lausanne (Switzerland); Koehli, Melanie [Centre Hospitalier Universitaire Vaudois (CHUV University Hospital), Division of Nuclear Medicine, Lausanne (Switzerland); Centre Hospitalier Universitaire Vaudois (CHUV University Hospital), Division of Endocrinology, Diabetology and Metabolism, Lausanne (Switzerland)

    2005-01-01

    Silent myocardial ischaemia - as evaluated by stress-induced perfusion defects on myocardial perfusion scintigraphy (MPS) in patients without a history of chest pain - is frequent in diabetes and is associated with increased rates of cardiovascular events. Its prevalence has been determined in asymptomatic diabetic patients, but remains largely unknown in diabetic patients with suspected coronary artery disease (CAD) in the clinical setting. In this study we therefore sought (a) to determine the prevalence of symptomatic and silent perfusion defects in diabetic patients with suspected CAD and (b) to characterise the eventual predictors of abnormal perfusion. The patient population comprised 133 consecutive diabetic patients with suspected CAD who had been referred for MPS. Studies were performed with exercise (41%) or pharmacological stress testing (1-day protocol, {sup 99m}Tc-sestamibi, {sup 201}Tl or both). We used semi-quantitative analysis (20-segment polar maps) to derive the summed stress score (SSS) and the summed difference score (SDS). Abnormal MPS (SSS{>=}4) was observed in 49 (37%) patients (SSS=4.9{+-}8.4, SDS=2.4{+-}4.7), reversible perfusion defects (SDS{>=}2) in 40 (30%) patients [SSS=13.3{+-}10.9; SDS=8.0{+-}5.6; 20% moderate to severe (SDS>4), 7% multivessel] and fixed defects in 21 (16%) patients. Results were comparable between patients with and patients without a history of chest pain. Of 75 patients without a history of chest pain, 23 (31%, 95% CI=21-42%) presented reversible defects (SSS=13.9{+-}11.3; SDS=7.4{+-}1.2), indicative of silent ischaemia. Reversible defects were associated with inducible ST segment depression during MPS stress (odds ratio (OR)=3.2, p<0.01). Fixed defects were associated with erectile dysfunction in males (OR=3.7, p=0.02) and lower aspirin use (OR=0.25, p=0.02). Silent stress-induced perfusion defects occurred in 31% of the patients, a rate similar to that in patients with a history of chest pain. MPS could identify

  13. Saccharomyces cerevisiae Linker Histone Hho1p Functionally Interacts with Core Histone H4 and Negatively Regulates the Establishment of Transcriptionally Silent Chromatin*

    OpenAIRE

    Yu, Qun; Kuzmiak, Holly; Zou, Yanfei; Olsen, Lars; Defossez, Pierre-Antoine; Bi, Xin

    2009-01-01

    Saccharomyces cerevisiae linker histone Hho1p is not essential for cell viability, and very little is known about its function in vivo. We show that deletion of HHO1 (hho1Δ) suppresses the defect in transcriptional silencing caused by a mutation in the globular domain of histone H4. hho1Δ also suppresses the reduction in HML silencing by the deletion of SIR1 that is involved in the establishment of silent chromatin at HML. We further show that hho1Δ suppresses chan...

  14. Análisis de la operación del sistema nacional interconectado del ecuador utilizando programación en DIgSILENT-DPL

    OpenAIRE

    Canchiña Santana, José Miguel; Hinojosa, Víctor Hugo

    2009-01-01

    La planificación, diseño y el análisis de la operación de sistemas de potencia requieren estudios a fin de evaluar el desempeño del sistema existente, confiabilidad, seguridad y economía. Los estudios identifican y alertan potenciales deficiencias en el sistema factibles de corregir o prevenir. En el presente trabajo se presenta el estudio de las funcionalidades disponibles en el programa DIgSILENT Power Factory, y la implementación y automatización del proceso “Analizar la Operación en Condi...

  15. Association between silent embolic cerebral infarction and continuous increase of P2Y12 reaction units after neurovascular stenting.

    Science.gov (United States)

    Kim, Bum Joon; Kwon, Joo Y; Jung, Jin-Man; Lee, Deok Hee; Kang, Dong-Wha; Kim, Jong S; Kwon, Sun U

    2014-10-01

    Endovascular procedures are one of the important treatment options for steno-occlusive arteries in ischemic stroke patients. However, embolic complications after such procedures are always a concern. The authors investigated the association between serial change of residual platelet reactivity and silent embolic cerebral infarction (SECI) after endovascular treatment. Ischemic stroke patients undergoing stenting of intra- or extracranial arteries were recruited prospectively. Residual platelet reactivity, represented by aspirin reaction units (ARUs) and P2Y12 reaction units (PRUs), was measured serially (6 hours before, immediately after, and 24 hours after the procedure). A loading dosage of aspirin (500 mg) and/or clopidogrel (300 mg) was given 24 hours before the procedure to patients naïve to antiplatelet agents, whereas the usual dosage (aspirin 100 mg and clopidogrel 75 mg) was continued for patients who had previously been taking these agents for more than a week. Diffusion-weighted MRI was performed before and 24 hours after the procedure to detect new SECIs. Clinical characteristics, baseline ARU and PRU values, and the change in ARU and PRU values after stenting were compared between patients with and without SECIs. Among 69 consecutive patients who underwent neurovascular stent insertion, 41 patients (59.4%) had poststenting SECIs. The lesion was located only at the vascular territory of the stented vessel in 21 patients (51.2%), outside the stented vessel territory in 8 patients (19.5%), and both inside and outside in 12 patients (29.3%). The occurrence of SECIs was not associated with the baseline ARU or PRU value, but was associated with PRU increase after stenting (36 ± 73 vs -12 ± 59, p = 0.007), deployment of a longer stent (31.1 ± 16.5 mm vs 21.8 ± 9.9 mm, p = 0.01), and stent insertion in extracranial arteries (78.1% vs 45.2%, p = 0.008). Stent length (OR 1.066, p = 0.01) and PRU change (OR 1.009, p = 0.04) were independently associated with

  16. Silent information regulator 1 (SIRT1) ameliorates liver fibrosis via promoting activated stellate cell apoptosis and reversion

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Yuting, E-mail: wuyuting1302@sina.com; Liu, Xuejiao; Zhou, Qun; Huang, Cheng; Meng, Xiaoming; Xu, Fengyun; Li, Jun, E-mail: lj@ahmu.edu.cn

    2015-12-01

    SIRT1 (silent information regulator 1), a conserved NAD +-dependent histone deacetylase, is closely related with various biological processes. Moreover, the important role of SIRT1 in alcoholic liver disease, nonalcoholic fatty liver and HCC had been widely reported. Recently, a novel role of SIRT1 was uncovered in organ fibrosis diseases. Here, we investigated the inhibitory effect of SIRT1 in liver fibrogenesis. SIRT1 protein was dramatically decreased in CCl4-treated mice livers. Stimulation of LX-2 cells with TGF-β1 also resulted in a significant suppression of SIRT1 protein. Nevertheless, TGF-β1-induced LX-2 cell activation was inhibited by SIRT1 plasmid, and this was accompanied by up-regulation of cell apoptosis-related proteins. Overexpression of SIRT1 also attenuated TGF-β1-induced expression of myofibroblast markers α-SMA and COL1a. However, the important characteristic of the recovery of liver fibrosis is not only the apoptosis of activated stellate cells but also the reversal of the myofibroblast-like phenotype to a quiescent-like phenotype. Restoration of SIRT1 protein was observed in the in vivo spontaneously liver fibrosis reversion model and in vitro MDI (isobutylmethylxanthine, dexamethasone, and insulin)-induced reversed stellate cells, and forced expression of SIRT1 also promoted the reversal of activated stellate cells. Furthermore, lncRNA MALAT1 (metastasis-associated lung adenocarcinoma transcript 1) was increased in liver fibrosis. RNAi-mediated suppression of MALAT1 resulted in a decrease of myofibroblast markers and restoration of SIRT1 protein. These observations suggested that SIRT1 contributed to apoptosis and reversion of activated LX-2 cells and SIRT1 might be regulated by MALAT1 in liver fibrosis. Therefore, SIRT1 could be considered as a valuable therapeutic target for translational studies of liver fibrosis. - Highlights: • This is the first report of SIRT1 expression and function in liver fibrogenesis and reversion.

  17. Karakteristik Es Krim Bengkuang Dengan Menggunakan Beberapa Jenis Susu

    Directory of Open Access Journals (Sweden)

    Failisnur Failisnur

    2013-06-01

    Full Text Available Ice cream is a frozen dairy solid product with the addition of other materials that are made through the process of freezing and agitation. The principle of its making to form a cavity of air in the mixture of ice cream ingredients to produce a volume that made the development of the ice cream into a lighter, less dense and has a soft texture. The purposed of the research to see influence the use of a variety of milk to the physical properties, chemical properties and organoleptic to the bengkoang ice cream produced. Research carried out by treatment type of milk used that were fullcream milk, sweetened condensed milk, soy milk powder, green bean powder, and soy milk liquid. The ice cream produced was tested the physics of overrun and melting speed, chemical analysis of protein content, fat and organoleptic of taste and texture. Research results showed that the best treatment was the use of soy milk powder where the value of overrun 37.2%, melting speed 10.1 minutes, protein content 6.9%, fat 13.08%, and organoleptic of  taste and texture was preferred.ABSTRAKEs krim merupakan produk olahan susu beku berbentuk padat dengan penambahan  bahan lain yang dibuat melalui proses pembekuan dan agitasi.  Prinsip pembuatan es krim adalah membentuk suatu rongga udara pada campuran bahan-bahan es krim sehingga dihasilkan pengembangan volume yang membuat es krim menjadi lebih ringan, tidak terlalu padat dan mempunyai tekstur yang lembut. Tujuan penelitian adalah untuk melihat pengaruh dari penggunaan beberapa jenis susu terhadap sifat fisik, kimia dan organoleptik es krim bengkuang yang dihasilkan.  Penelitian dilakukan dengan perlakuan  penggunaan susu fullcream, susu kental manis, susu kedelai bubuk, kacang hijau bubuk, dan susu kedelai cair.  Es krim yang dihasilkan dilakukan uji fisika overrun dan kecepatan meleleh, analisis kimia kadar protein, lemak dan uji organoleptik rasa dan tekstur. Hasil penelitan menunjukkan bahwa penggunaan susu kedelai

  18. Making silent bones speak

    DEFF Research Database (Denmark)

    Ivanovaite, Livija; Jensen, Mathias Paul Bjørnevad; Philippsen, Bente

    2017-01-01

    , Obšrūtai and Kamšai were subjected to the AMS dating, tandem mass spectrometry for animal species identification as well as technological and use-wear analysis. The results revealed that all four bone points could be dated to the Boreal period and imply early-to-middle Mesolithic dates. Harpoons from...... of the present research, the paper shortly describes other scientific methods which could be applied to orphaned bone and antler tools including biomolecular and stable isotope analysis. Digital recording methods can be useful for bone artefact recording. This is relevant today, as the demand for good quality...

  19. With Silent Lips

    DEFF Research Database (Denmark)

    Isar, Nicoletta

    2010-01-01

    gennem stilhed af disse paradoksale hellige tekster, som jeg håber at gøre hørbare min komplimenter og de bedste ønsker til min ven, prof. Stefan Smjadovsky Cet article est dédié à une amitié académique durable, inspirante et inspirée, en même temps, par un amour commun pour cette entité vivante...

  20. Tiny, silent killers

    Digital Repository Service at National Institute of Oceanography (India)

    Bhat, S.R.

    contaminated fish and shellfish before they reach market. But it is not so everywhere and therefore toxic blooms are taking a heavy toll. Fish and shellfish losses total tens of millions of dollars every year. While the wild fish can swim away from blooms... for monitoring toxin level in shellfish and accordingly closes or allows its harvest from shellfish beds. Marketable shellfish are generally considered to be safe, but in spite of these precautions, there are known illnesses. One dramatic example is from 1990...

  1. Cooperation or Silent Rivalry?

    DEFF Research Database (Denmark)

    Zank, Wolfgang

    2010-01-01

    a gravitational pull which goes beyond economic problems. Furthermore, the EU has gradually built up a coherent policy on many fields. The EU has become the “reform anchor” and most important cooperation partner for Egypt. The progress towards increasing Egypt’s “Stake in the Internal Market” places cooperation......For decades the US has had a hegemonic position in the Middle East. A key country in this respect has been Egypt. However, in recent decades the EU has made itself increasingly felt in the region. Due to enlargements the EU came geographically much closer, and the Internal Market has generated...... to see the US and EU as rivals. Their roles are rather complementary. The article explores developments in a long-term perspective. Internal and structural developments have had a heavy impact, but at important junctions ideas and strategies for gaining political legitimacy were powerful factors too...

  2. Neoplasmas da tireoide em cães: 26 casos

    Directory of Open Access Journals (Sweden)

    Camila Tochetto

    Full Text Available RESUMO: Foram revisados os protocolos de biópsias e necropsias do Laboratório de Patologia Veterinária da Universidade Federal de Santa Maria (LPV/UFSM entre 2004 e 2014, e todos os casos de tumores que acometeram a glândula tireoide foram selecionados. A partir disso, foram anotados sexo, idade e raça dos cães afetados. Também foi avaliado o significado clínico dos tumores, presença de aumento de volume cervical, lobos afetados, tamanho dos tumores, presença e localização de metástases e padrão histológico dos neoplasmas. Nos 11 anos que compreenderam este estudo, foram diagnosticados 26 tumores de glândula tireoide (quatro eram provenientes de exames de biópsias e 22 de necropsias, 53,9% dos cães eram fêmeas e 46,1% eram machos; 65,4% eram cães com raça definida. Desses, Boxers foram os mais afetados (15,4% dos casos. Dos 23 protocolos em que a idade foi informada, 60,9% dos cães eram idosos e 39,1% eram adultos. A avaliação dos protocolos permitiu constatar que 38,5% dos animais haviam apresentado aumento de volume cervical no momento do exame clínico. Dos cães necropsiados 13,6% morreram ou foram submetidos à eutanásia em decorrência de complicações causadas por metástases dos tumores de tireoide. Dessa forma, em 86,4% dos cães, os neoplasmas foram considerados achados incidentais de necropsia. Nos quatro casos provenientes de material de biópsia, o desfecho não foi conhecido. Em nenhum cão os tumores causaram síndrome clínica devido à hipo ou hiperfunção da tireoide. Em 24 protocolos havia informação sobre os lobos afetados e 75% dos cães tiveram acometimento unilateral da glândula. Os diagnósticos histológicos dos tumores permitiram constatar que 16 (61,5% neoplasmas eram carcinomas de células foliculares (nesses casos, o padrão folicular-compacto foi o mais frequente [43,75%], seis (23,1% eram adenomas de células foliculares, dois (7,7% eram carcinossarcomas e dois (7,7% eram tumores de c

  3. Lo que es dentro es fuera. Arteterapia con una niña en Régimen de Acogimiento Residencial

    OpenAIRE

    Rosario Macías, Marta del

    2014-01-01

    La investigación que se presenta a continuación “Lo que es dentro es fuera”, muestra un estudio con caso de corte cualitativo, abordado tras una intervención arteterapéutica adaptada a una niña de edad preescolar que se encuentra en Régimen de Acogimiento Residencial. Este texto pretende aportar una visión holística de la experiencia que nace a raíz de una conducta disruptiva, y de cómo a través de las sesiones de arteterapia y la influencia de su espacio simbólico enmarcado en unos límite...

  4. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM4_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  5. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Terra-FM1_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  6. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM4_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  7. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_PFM+FM2_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  8. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM3_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  9. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_PFM+FM1_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2000-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  10. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_FM1+FM2_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2003-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  11. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_FM1+FM4_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  12. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Terra-FM1_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  13. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_FM1+FM3_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  14. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Terra-FM2_Edition1-CV)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2006-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  15. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_FM1+FM2_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2002-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  16. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Terra-FM2_Edition1)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-10-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  17. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM4_Edition1-CV)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-03-29] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  18. CERES ERBE-like Monthly Geographical Averages (ES-4) in HDF (CER_ES4_Aqua-FM3_Edition2)

    Science.gov (United States)

    Wielicki, Bruce A. (Principal Investigator)

    The ERBE-like Monthly Geographical Averages (ES-4) product contains a month of space and time averaged Clouds and the Earth's Radiant Energy System (CERES) data for a single scanner instrument. The ES-4 is also produced for combinations of scanner instruments. For each observed 2.5-degree spatial region, the daily average, the hourly average over the month, and the overall monthly average of shortwave and longwave fluxes at the Top-of-the-Atmosphere (TOA) from the CERES ES-9 product are spatially nested up from 2.5-degree regions to 5- and 10-degree regions, to 2.5-, 5-, and 10-degree zonal averages, and to global monthly averages. For each nested area, the albedo and net flux are given. For each region, the daily average flux is estimated from an algorithm that uses the available hourly data, scene identification data, and diurnal models. This algorithm is 'like' the algorithm used for the Earth Radiation Budget Experiment (ERBE). The following CERES ES4 data sets are currently available: CER_ES4_FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition1 CER_ES4_PFM+FM1+FM2_Edition2 CER_ES4_PFM+FM1_Edition1 CER_ES4_PFM+FM2_Edition1 CER_ES4_TRMM-PFM_Edition1 CER_ES4_TRMM-PFM_Edition2 CER_ES4_Terra-FM1_Edition1 CER_ES4_Terra-FM2_Edition1 CER_ES4_FM1+FM2_Edition2 CER_ES4_Terra-FM1_Edition2 CER_ES4_Terra-FM2_Edition2 CER_ES4_Aqua-FM3_Edition1 CER_ES4_Aqua-FM4_Edition1 CER_ES4_FM1+FM2+FM3+FM4_Edition1 CER_ES4_Aqua-FM3_Edition2 CER_ES4_Aqua-FM4_Edition2 CER_ES4_FM1+FM3_Edition2 CER_ES4_FM1+FM4_Edition2 CER_ES4_PFM+FM1_Edition2 CER_ES4_PFM+FM2_Edition2 CER_ES4_Aqua-FM3_Edition1-CV CER_ES4_Aqua-FM4_Edition1-CV CER_ES4_Terra-FM1_Edition1-CV CER_ES4_Terra-FM2_Edition1-CV. [Location=GLOBAL] [Temporal_Coverage: Start_Date=1998-01-01; Stop_Date=2005-12-31] [Spatial_Coverage: Southernmost_Latitude=-90; Northernmost_Latitude=90; Westernmost_Longitude=-180; Easternmost_Longitude=180] [Data_Resolution: Latitude_Resolution=2.5 degree; Longitude_Resolution=2.5 degree; Horizontal

  19. ¿Qué es la CIE y por qué es importante en la psicología?

    Directory of Open Access Journals (Sweden)

    Geoffrey M. Reed

    2012-01-01

    Full Text Available La Clasificación Internacional de las Enfermedades (CIE de la Organización Mundial de Salud (OMS es muy poco conocida en el ámbito de la psicología en España, y existe la falsa percepción de que su importancia es escasa en el campo de la salud mental. El propósito de este artículo es familiarizar a los psicólogos y otros profesionales en salud mental con el sistema de clasificación CIE, algo especialmente relevante al encontrarse actualmente en proceso de revisión. La OMS está haciendo un gran esfuerzo para crear una clasificación de trastornos mentales global, multicultural y multidisciplinar, centrándose en mejorar su utilidad clínica. Además, en la actual revisión de la CIE, la OMS ha adoptado el español como segunda lengua de trabajo, lo que da una gran oportunidad a los profesionales de la salud mental de España y otros países hispanohablantes de implicarse activamente en el desarrollo de la próxima versión de la clasificación. Es importante que los psicólogos de países hispanohablantes conozcan la CIE y entiendan los grandes beneficios que pueden aportarles su conocimiento y utilización para integrarse plenamente como profesión sanitaria oficial, así como para equipararse en la práctica de la psicología al resto de Europa y de todo el mundo en términos de diagnóstico y clasificación de los trastornos mentales.

  20. Approches de l'utilisation des eaux usées urbaines dans l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    8 févr. 2011 ... Ils proposent une classification des différents types d'eaux usées (directes, indirectes, traitées, non traitées, dirigées et non dirigées), soulignent combien il est nécessaire d'utiliser une approche fondée sur les moyens de subsistance et ciblée sur les agriculteurs, insistent sur des directives pragmatiques ...