Dynamics of transparent exopolymer particle (TEP) production and aggregation during viral infection of the coccolithophore, Emiliania huxleyi.

Science.gov (United States)

Nissimov, Jozef I; Vandzura, Rebecca; Johns, Christopher T; Natale, Frank; Haramaty, Liti; Bidle, Kay D

2018-06-19

Emiliania huxleyi produces calcium carbonate (CaCO 3 ) coccoliths and transparent exopolymer particles (TEP), sticky, acidic carbohydrates that facilitate aggregation. E. huxleyi's extensive oceanic blooms are often terminated by coccolithoviruses (EhVs) with the transport of cellular debris and associated particulate organic carbon (POC) to depth being facilitated by TEP-bound "marine snow" aggregates. The dynamics of TEP production and particle aggregation in response to EhV infection are poorly understood. Using flow cytometry, spectrophotometry, and FlowCam visualization of alcian blue (AB)-stained aggregates, we assessed TEP production and the size spectrum of aggregates for E. huxleyi possessing different degrees of calcification and cellular CaCO 3 :POC mass ratios, when challenged with two EhVs (EhV207 and EhV99B1). FlowCam imaging also qualitatively assessed the relative amount of AB-stainable TEP (i.e. blue:red ratio of each particle). We show significant increases in TEP during early phase EhV207-infection (∼24 hours) of calcifying strains and a shift towards large aggregates following EhV99B1-infection. We also observed the formation of large aggregates with low blue:red ratios, suggesting that other exopolymer substances contribute towards aggregation. Our findings show the potential for virus infection and the associated response of their hosts to impact carbon flux dynamics and provide incentive to explore these dynamics in natural populations. This article is protected by copyright. All rights reserved. © 2018 Society for Applied Microbiology and John Wiley & Sons Ltd.

Comparison of Alcian blue and total carbohydrate assays for quantitation of transparent exopolymer particles (TEP) in biofouling studies.

Science.gov (United States)

Li, Xu; Skillman, Lucy; Li, Dan; Ela, Wendell P

2018-04-15

Transparent exopolymer particles (TEP) and their precursors are gel-like acidic polysaccharide particles. Both TEP precursors and TEP have been identified as causal factors in fouling of desalination and water treatment systems. For comparison between studies, it is important to accurately measure the amount and fouling capacity of both components. However, the accuracy and recovery of the currently used Alcian blue based TEP measurement of different surrogates and different size fractions are not well understood. In this study, we compared Alcian blue based TEP measurements with a total carbohydrate assay method. Three surrogates; xanthan gum, pectin and alginic acid; were evaluated at different salinities. Total carbohydrate concentrations of particulates (>0.4 μm) and their precursors (10 kDa) varied depending on water salinity and method of recovery. As xanthan gum is the most frequently used surrogate in fouling studies, TEP concentration is expressed as xanthan gum equivalents (mg XG eq /L) in this study. At a salinity of 35 mg/L sea salt, total carbohydrate assays showed a much higher particulate TEP fraction for alginic acid (38%) compared to xanthan gum (9%) and pectin (12%). The concentrations of particulate TEP therefore may only represent ∼10% of the total mass; while precursor TEP represents ∼80% of the total TEP. This highlights the importance of reporting both particulate and precursor TEP for membrane biofouling studies. The calculated concentrations of TEP and their precursors in seawater samples are also highly dependent on type of surrogate and resulting calibration factor. A linear correlation between TEP recovery and calibration factor was demonstrated in this study for all three surrogates. The relative importance and accuracy of measurement method, particulate size, surrogate type, and recovery are described in detail in this study. Copyright © 2017. Published by Elsevier Ltd.

TEP process flow diagram

Energy Technology Data Exchange (ETDEWEB)

Wilms, R Scott [Los Alamos National Laboratory; Carlson, Bryan [Los Alamos National Laboratory; Coons, James [Los Alamos National Laboratory; Kubic, William [Los Alamos National Laboratory

2008-01-01

This presentation describes the development of the proposed Process Flow Diagram (PFD) for the Tokamak Exhaust Processing System (TEP) of ITER. A brief review of design efforts leading up to the PFD is followed by a description of the hydrogen-like, air-like, and waterlike processes. Two new design values are described; the mostcommon and most-demanding design values. The proposed PFD is shown to meet specifications under the most-common and mostdemanding design values.

Photolysis of aromatic pollutants in clean and dirty ice

Science.gov (United States)

Kahan, T.; Malley, P.; Stathis, A.

2015-12-01

Anthropogenic aromatic pollutants such as polycyclic aromatic hydrocarbons (PAHs) and substituted benzenes often become more toxic following atmospheric oxidation. Photolysis of these pollutants in ice can be much faster than that in aqueous solution, which might lead to higher carcinogenic loadings in snow-covered regions. In this work we investigate two things. First, we investigate whether toluene, which has been detected at very elevated concentrations near hydraulic fracturing operations, can undergo photolysis at ice surfaces. Toluene in aqueous solution does not absorb sunlight, so photolysis has not been considered a potential atmospheric fate. However, benzene was recently demonstrated to undergo a significant red shift in its absorbance at ice surfaces, leading to photolysis under environmentally-relevant conditions. Here we show that toluene also undergoes photolysis at ice surfaces. In a second set of experiments, we have investigated the effects of organic matter on the photolysis kinetics ofPAHs in ice and at ice surfaces. We found that very small loadings of hydrophobic organics such as octanol can significantly suppress PAH photolysis kinetics in ice, but that the primary effect of the more soluble fulvic acid is competitive photon absorption. Our results show that photochemistry of anthropogenic pollutants can follow very different mechanisms and kinetics in ice than in aqueous solution, and that the photochemical fate of these pollutants depends strongly on the composition of the snow. These results have implications for pollutant fate and human health in a wide range of snow-covered environments including remote areas, cities, and regions near gas and oil extraction operations.

Is unilateral laparoscopic TEP inguinal hernia repair a job half done? The case for bilateral repair.

Science.gov (United States)

Pawanindra Lal; Philips, Prejesh; Chander, Jagdish; Ramteke, Vinod K

2010-07-01

Bilateral laparoscopic totally extraperitoneal (TEP) repair of unilateral hernia is conspicuous in published literature by its absence. There are no studies or data on the feasibility, advantages or disadvantages of bilateral repair in all cases or in any subset of patients with unilateral primary inguinal hernia. The objective of this study is to investigate the feasibility of bilateral laparoscopic exploration for all unilateral cases followed by laparoscopic TEP in all cases and to compare complications, recurrence rates, postoperative pain, patient satisfaction, and return to work retrospectively with a similar number of age-matched retrospective controls. One hundred fifty TEP operations were performed in 75 patients (group A) prospectively and were compared with 75 unilateral TEP operations (group B) in age-matched controls done previously by the same surgeon. All cases were performed under general anesthesia, and TEP repair was performed using three midline ports. All uncomplicated patients were discharged at 24 h, in keeping with departmental policy. Of 75 patients (group A), 25 (33.3%) were clinically diagnosed with bilateral hernia and the rest (50, 66.66%) with unilateral hernia. The distribution of the 25 bilateral cases was 11 bilateral direct and 14 bilateral indirect inguinal hernias. The distribution of the 75 age-matched controls (group B) was all unilateral hernia, of which 47 were right-sided and 28 were left-sided. There were 23 direct hernias and 52 indirect hernias among the control group. The mean operative time for all 150 cases was 76.66 +/- 15.92 min. The operative time in the control group (unilateral hernias) was 66.16 +/- 12.44 min, whereas the operative time in the test group (bilateral repair) was 87.2 +/- 11.32 min. The operative time in the bilateral group was significantly higher, by 21.04 min or 31.88% (p = 0.000). The operative time in the true unilateral group was 82.45 +/- 9.38 min, whereas the operative time in the former

Carbon content and C:N ratio of transparent exopolymeric particles (TEP) produced by bubbling exudates of diatoms

DEFF Research Database (Denmark)

Mari, Xavier

1999-01-01

The carbon content of transparent exopolymeric particles (TEP) was measured in the laboratory in particles produced by bubbling exudates of the diatom Thalassiosira weissflogii, grown under nitrogen non-limited conditions (N:P = 7). The carbon content of these particles (TEP-C) appears to vary...... a coastal area (Kattegat, Denmark), TEP carbon concentration in the surface mixed layer was on the order of 230 ± 150 µg C l-1. This is high relative to other sources of particulate organic carbon (e.g. phytoplankton) and depending on TEP turnover rates, suggests that TEP is an important pathway...... for dissolved organic carbon in coastal seas. The carbon to nitrogen ratio of TEP was measured from particles formed by bubbling exudates of the diatoms T. weissflogii, Skeletonema costatum, Chaetoceros neogracile and C. affinis. Each of these diatom species was grown under various N:P ratios, from N...

Laboratory study of nitrate photolysis in Antarctic snow. I. Observed quantum yield, domain of photolysis, and secondary chemistry

DEFF Research Database (Denmark)

Meusinger, Carl; Berhanu, Tesfaye A.; Erbland, Joseph

2014-01-01

undergoing secondary (recombination) chemistry. Modeled NOx emissions may increase significantly above measured values due to the observed quantum yield in this study. The apparent quantum yield in the 200 nm band was found to be ∼ 1%, much lower than reported for aqueous chemistry. A companion paper...... are understood. It has been shown that photolysis of nitrate in the snowpack plays a major role in nitrate loss and that the photolysis products have a significant influence on the local troposphere as well as on other species in the snow. Reported quantum yields for the main reaction spans orders of magnitude...

Photolysis of petroleum

International Nuclear Information System (INIS)

Bobra, M.

1992-05-01

A study was conducted to examine the chemical and physical changes that occur in oils as a result of photooxidation. A literature review of recent studies in petroleum photochemistry revealed reported effects of photo-induced reactions in petroleum, including changes in color, polymerization, solidification, increases in solubility and toxicity, and changes in interfacial properties. A list of products reported as a result of photolysis of petroleum is presented, including such compounds as aldehydes, ketones, esters, and lactones. The photoreactivity of various petroleum components is discussed and mechanisms of photooxidation of petroleum are suggested. In the experimental portion of the study, a variety of crude oils and petroleum products were used to determine how different oils are affected by photolysis, and to examine the importance of photolysis as a weathering process. Photooxidation products from several oils were isolated and identified, including aliphatic and aromatic acids, alcohols, and phenols. Some physical manifestations attributed to photolysis included yellowing, formation of precipitates or crusts, increases in density and viscosity with time, increases of asphaltene content in some oils, changes in pH of the surrounding water, and emulsification. 51 refs., 38 figs., 18 tabs

Immune-tolerant elastin-like polypeptides (iTEPs) and their application as CTL vaccine carriers.

Science.gov (United States)

Cho, S; Dong, S; Parent, K N; Chen, M

2016-01-01

Cytotoxic T lymphocyte (CTL) vaccine carriers are known to enhance the efficacy of vaccines, but a search for more effective carriers is warranted. Elastin-like polypeptides (ELPs) have been examined for many medical applications but not as CTL vaccine carriers. We aimed to create immune tolerant ELPs using a new polypeptide engineering practice and create CTL vaccine carriers using the ELPs. Four sets of novel ELPs, termed immune-tolerant elastin-like polypeptide (iTEP) were generated according to the principles dictating humoral immunogenicity of polypeptides and phase transition property of ELPs. The iTEPs were non-immunogenic in mice. Their phase transition feature was confirmed through a turbidity assay. An iTEP nanoparticle (NP) was assembled from an amphiphilic iTEP copolymer plus a CTL peptide vaccine, SIINFEKL. The NP facilitated the presentation of the vaccine by dendritic cells (DCs) and enhanced vaccine-induced CTL responses. A new ELP design and development practice was established. The non-canonical motif and the immune tolerant nature of the iTEPs broaden our insights about ELPs. ELPs, for the first time, were successfully used as carriers for CTL vaccines. It is feasible to concurrently engineer both immune-tolerant and functional peptide materials. ELPs are a promising type of CTL vaccine carriers.

Athletes with inguinal disruption benefit from endoscopic totally extraperitoneal (TEP) repair.

Science.gov (United States)

Roos, M M; Bakker, W J; Goedhart, E A; Verleisdonk, E J M M; Clevers, G J; Voorbrood, C E H; Sanders, F B M; Naafs, D B; Burgmans, J P J

2018-06-01

Inguinal disruption, a common condition in athletes, is a diagnostic and therapeutic challenge. The aim of this study was to evaluate the effect of endoscopic totally extraperitoneal (TEP) repair in athletes with inguinal disruption, selected through a multidisciplinary, systematic work-up. An observational, prospective cohort study was conducted in 32 athletes with inguinal disruption. Athletes were assessed by a sports medicine physician, radiologist and hernia surgeon and underwent subsequent endoscopic TEP repair with placement of polypropylene mesh. The primary outcome was pain reduction during exercise on the numeric rating scale (NRS) 3 months postoperatively. Secondary outcomes were sports resumption, physical functioning and long-term pain intensity. Patients were assessed preoperatively, 3 months postoperatively and after a median follow-up of 19 months. Follow-up was completed in 30 patients (94%). The median pain score decreased from 8 [interquartile range (IQR) 7-8] preoperatively to 2 (IQR 0-5) 3 months postoperatively (p disruption, selected through a multidisciplinary, systematic work-up, benefit from TEP repair.

TEP Power Partners Project [Tucson Electric Power

Energy Technology Data Exchange (ETDEWEB)

None, None

2014-02-06

The Arizona Governor’s Office of Energy Policy, in partnership with Tucson Electric Power (TEP), Tendril, and Next Phase Energy (NPE), formed the TEP Power Partners pilot project to demonstrate how residential customers could access their energy usage data and third party applications using data obtained from an Automatic Meter Reading (AMR) network. The project applied for and was awarded a Smart Grid Data Access grant through the U.S. Department of Energy. The project participants’ goal for Phase I is to actively engage 1,700 residential customers to demonstrate sustained participation, reduction in energy usage (kWh) and cost ($), and measure related aspects of customer satisfaction. This Demonstration report presents a summary of the findings, effectiveness, and customer satisfaction with the 15-month TEP Power Partners pilot project. The objective of the program is to provide residential customers with energy consumption data from AMR metering and empower these participants to better manage their electricity use. The pilot recruitment goals included migrating 700 existing customers from the completed Power Partners Demand Response Load Control Project (DRLC), and enrolling 1,000 new participants. Upon conclusion of the project on November 19, 2013; 1,390 Home Area Networks (HANs) were registered; 797 new participants installed a HAN; Survey respondents’ are satisfied with the program and found value with a variety of specific program components; Survey respondents report feeling greater control over their energy usage and report taking energy savings actions in their homes after participating in the program; On average, 43 % of the participants returned to the web portal monthly and 15% returned weekly; and An impact evaluation was completed by Opinion Dynamics and found average participant savings for the treatment period1 to be 2.3% of their household use during this period.2 In total, the program saved 163 MWh in the treatment period of 2013.

Ability of TEP1 in intestinal flora to modulate natural resistance of Anopheles dirus.

Science.gov (United States)

Wang, Yanyan; Wang, Ying; Zhang, Jingru; Xu, Wenyue; Zhang, Jian; Huang, Fu Sheng

2013-08-01

Blocking transmission of malaria is a reliable way to control and eliminate infection. However, in-depth knowledge of the interaction between Plasmodium and mosquito is needed. Studies suggest that innate immunity is the main mechanism inhibiting development of malaria parasites in the mosquito. Recent studies have found that use of antibiotics that inhibit the mosquito gut flora can reduce the immune response of Anopheles gambiae, thereby contributing to the development of malaria parasites. In our study, we used the non susceptible model of Anopheles dirus-Plasmodium yoelii to explore the effect of Anopheles intestinal flora on the natural resistance of A. dirus to P. yoelii. We found that in mosquitoes infected with Plasmodium, the intestinal flora can regulate expression of thioester-containing protein (TEP1) via an RNAi gene-silencing approach. Our results suggest that in the absence of TEP1, the natural microbiota cannot suppress the development of P. yoelii in A. dirus. This suggests that AdTEP1 plays an important role in the resistance of A. dirus to P. yoelii. The intestinal flora may modulate the development of P. yoelii in A. dirus by regulating TEP1 expression. Copyright © 2013 Elsevier Inc. All rights reserved.

Seasonal size spectra of transparent exopolymeric particles (TEP) in a coastal sea and comparison with those predicted using coagulation theory

DEFF Research Database (Denmark)

Mari, Xavier; Burd, A

1998-01-01

The abundance and size distribution of transparent exopolymeric particles (TEP) were monitored in the Kattegat (Denmark) during 1 yr. TEP number concentration ranged from 0.5 x 10(5) to 3.8 x 10(5) ml(-1) and the volume concentration between 3 and 310 ppm. TEP volume concentration peaked during...

MiTEP's Collaborative Field Course Design Process Based on Earth Science Literacy Principles

Science.gov (United States)

Engelmann, C. A.; Rose, W. I.; Huntoon, J. E.; Klawiter, M. F.; Hungwe, K.

2010-12-01

Michigan Technological University has developed a collaborative process for designing summer field courses for teachers as part of their National Science Foundation funded Math Science Partnership program, called the Michigan Teacher Excellence Program (MiTEP). This design process was implemented and then piloted during two two-week courses: Earth Science Institute I (ESI I) and Earth Science Institute II (ESI II). Participants consisted of a small group of Michigan urban science teachers who are members of the MiTEP program. The Earth Science Literacy Principles (ESLP) served as the framework for course design in conjunction with input from participating MiTEP teachers as well as research done on common teacher and student misconceptions in Earth Science. Research on the Earth Science misconception component, aligned to the ESLP, is more fully addressed in GSA Abstracts with Programs Vol. 42, No. 5. “Recognizing Earth Science Misconceptions and Reconstructing Knowledge through Conceptual-Change-Teaching”. The ESLP were released to the public in January 2009 by the Earth Science Literacy Organizing Committee and can be found at http://www.earthscienceliteracy.org/index.html. Each day of the first nine days of both Institutes was focused on one of the nine ESLP Big Ideas; the tenth day emphasized integration of concepts across all of the ESLP Big Ideas. Throughout each day, Michigan Tech graduate student facilitators and professors from Michigan Tech and Grand Valley State University consistantly focused teaching and learning on the day's Big Idea. Many Earth Science experts from Michigan Tech and Grand Valley State University joined the MiTEP teachers in the field or on campus, giving presentations on the latest research in their area that was related to that Big Idea. Field sites were chosen for their unique geological features as well as for the “sense of place” each site provided. Preliminary research findings indicate that this collaborative design

Diphosphine is an intermediate in the photolysis of phosphine to phosphorus and hydrogen

Energy Technology Data Exchange (ETDEWEB)

Ferris, J P; Benson, R [Rensselaer Polytechnic Inst., Troy, NY (USA). Dept. of Chemistry

1980-05-15

Photolysis of phosphine (PH/sub 3/) has been investigated because of its potential significance in the atmosphere chemistry of Jupiter. It is reported that P/sub 2/H/sub 4/is the initial product of PH/sub 3/ photolysis and that it is the principal intermediate in the formation of red phosphorus. It is stated that these findings require substantial revision of the previously accepted mechanism for PH/sub 3/ photolysis.

Reactions of uranium hexafluoride photolysis products

Science.gov (United States)

Lyman, John L.; Laguna, Glenn; Greiner, N. R.

1985-01-01

This paper confirms that the ultraviolet photolysis reactions of UF6 in the B band spectral region is simple bond cleavage to UF5 and F. The photolysis products may either recombine to UF6 or the UF5 may dimerize, and ultimately polymerize, to solid UF5 particles. We use four methods to set an upper limit for the rate constant for recombination of krUF6 and UF5 after laser photolysis of the UF6 gas sample.

NOM and TEP fouling of a forward osmosis (FO) membrane: Foulant identification and cleaning

KAUST Repository

Valladares Linares, Rodrigo

2012-12-01

The study of forward osmosis (FO) membranes has increased due to the already demonstrated advantages compared to high-energy membrane processes such as reverse osmosis (RO). This research focuses on characterization of the natural organic matter (NOM) fraction causing fouling on the active layer (AL) of a FO membrane in a novel plate and frame module configuration, facing secondary wastewater effluent as a feed solution (FS) and seawater used as a draw solution (DS). In addition, transparent exopolymer particles (TEP) were observed on the support layer (SL) of the membrane in contact with the DS. The NOM fouling layer, after characterizing the water samples and membranes used, was found to be composed of biopolymers and protein-like substances, which adversely affect the flux of water through the FO membrane. However, NOM fouling showed high reversibility, up to 90% when air scouring for 15. min is used as a cleaning technique. The irreversible fouling in this work was found to be 8.2% after chemical cleaning. On the support layer of the membrane, TEP formed clusters clearly identifiable with an optical microscope and a TEP-specific dye. Chemical cleaning with 1% NaOCl for 10. min proved to be the most effective method to remove TEP. © 2012.

NOM and TEP fouling of a forward osmosis (FO) membrane: Foulant identification and cleaning

KAUST Repository

Valladares Linares, Rodrigo; Yangali-Quintanilla, Victor; Li, Zhenyu; Amy, Gary L.

2012-01-01

The study of forward osmosis (FO) membranes has increased due to the already demonstrated advantages compared to high-energy membrane processes such as reverse osmosis (RO). This research focuses on characterization of the natural organic matter (NOM) fraction causing fouling on the active layer (AL) of a FO membrane in a novel plate and frame module configuration, facing secondary wastewater effluent as a feed solution (FS) and seawater used as a draw solution (DS). In addition, transparent exopolymer particles (TEP) were observed on the support layer (SL) of the membrane in contact with the DS. The NOM fouling layer, after characterizing the water samples and membranes used, was found to be composed of biopolymers and protein-like substances, which adversely affect the flux of water through the FO membrane. However, NOM fouling showed high reversibility, up to 90% when air scouring for 15. min is used as a cleaning technique. The irreversible fouling in this work was found to be 8.2% after chemical cleaning. On the support layer of the membrane, TEP formed clusters clearly identifiable with an optical microscope and a TEP-specific dye. Chemical cleaning with 1% NaOCl for 10. min proved to be the most effective method to remove TEP. © 2012.

Ecotoxicity of ketoprofen, diclofenac, atenolol and their photolysis byproducts in zebrafish (Danio rerio)

Energy Technology Data Exchange (ETDEWEB)

Diniz, M.S., E-mail: mesd@fct.unl.pt [REQUIMTE/CQFB, Chemistry Department, FCT, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal); Salgado, R., E-mail: r.salgado@campus.fct.unl.pt [REQUIMTE/CQFB, Chemistry Department, FCT, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal); ESTS-IPS, Escola Superior de Tecnologia de Setúbal do Instituto Politécnico de Setúbal, Rua Vale de Chaves, Campus do IPS, Estefanilha, 2910-761 Setúbal (Portugal); Pereira, V.J., E-mail: vanessap@itqb.unl.pt [Instituto de Biologia Experimental e Tecnológica (IBET), Av. da República (EAN), 2784-505 Oeiras (Portugal); Instituto de Tecnologia Química e Biológica (ITQB)—Universidade Nova de Lisboa (UNL), Estação Agronómica Nacional, Av. da República, 2780-157 Oeiras (Portugal); Carvalho, G., E-mail: gs.carvalho@fct.unl.pt [REQUIMTE/CQFB, Chemistry Department, FCT, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal); Instituto de Biologia Experimental e Tecnológica (IBET), Av. da República (EAN), 2784-505 Oeiras (Portugal); Oehmen, A., E-mail: a.oehmen@fct.unl.pt [REQUIMTE/CQFB, Chemistry Department, FCT, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal); Reis, M.A.M., E-mail: amr@fct.unl.pt [REQUIMTE/CQFB, Chemistry Department, FCT, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal); Noronha, J.P., E-mail: jpnoronha@fct.unl.pt [REQUIMTE/CQFB, Chemistry Department, FCT, Universidade Nova de Lisboa, 2829-516 Caparica (Portugal)

2015-02-01

The occurrence of pharmaceutical compounds in wastewater treatment plants and surface waters has been detected worldwide, constituting a potential risk for aquatic ecosystems. Adult zebrafish, of both sexes, were exposed to three common pharmaceutical compounds (atenolol, ketoprofen and diclofenac) and their UV photolysis by-products over seven days. The results show that diclofenac was removed to concentrations < LOD after 5 min of UV irradiation. The oxidative stress response of zebrafish to pharmaceuticals and their photolysis by-products was evaluated through oxidative stress enzymes (glutathione-S-transferase, catalase, superoxide dismutase) and lipid peroxidation. Results suggest that the photolysis by-products of diclofenac were more toxic than those from the other compounds tested, showing an increase in GST and CAT levels, which are also supported by higher MDA levels. Overall, the toxicity of waters containing atenolol and ketoprofen was reduced after the parent compounds were transformed by photolysis, whereas the toxicity increased significantly from the by-products generated through diclofenac photolysis. Therefore, diclofenac photolysis would possibly necessitate higher irradiation time to ensure that the associated by-products are completely degraded to harmless form(s). - Highlights: • Toxicity evaluated for 3 common pharmaceuticals (atenolol, ketoprofen and diclofenac). • Toxicity assessed for the pharmaceuticals and UV photolysis by-products in zebrafish. • Diclofenac photolysis by-products are more toxic than the parent compound. • Ketoprofen and atenolol show stronger oxidative stress response than by-products. • UV photolysis should ensure full removal of diclofenac metabolites to avoid toxicity.

Ecotoxicity of ketoprofen, diclofenac, atenolol and their photolysis byproducts in zebrafish (Danio rerio)

International Nuclear Information System (INIS)

Diniz, M.S.; Salgado, R.; Pereira, V.J.; Carvalho, G.; Oehmen, A.; Reis, M.A.M.; Noronha, J.P.

2015-01-01

The occurrence of pharmaceutical compounds in wastewater treatment plants and surface waters has been detected worldwide, constituting a potential risk for aquatic ecosystems. Adult zebrafish, of both sexes, were exposed to three common pharmaceutical compounds (atenolol, ketoprofen and diclofenac) and their UV photolysis by-products over seven days. The results show that diclofenac was removed to concentrations < LOD after 5 min of UV irradiation. The oxidative stress response of zebrafish to pharmaceuticals and their photolysis by-products was evaluated through oxidative stress enzymes (glutathione-S-transferase, catalase, superoxide dismutase) and lipid peroxidation. Results suggest that the photolysis by-products of diclofenac were more toxic than those from the other compounds tested, showing an increase in GST and CAT levels, which are also supported by higher MDA levels. Overall, the toxicity of waters containing atenolol and ketoprofen was reduced after the parent compounds were transformed by photolysis, whereas the toxicity increased significantly from the by-products generated through diclofenac photolysis. Therefore, diclofenac photolysis would possibly necessitate higher irradiation time to ensure that the associated by-products are completely degraded to harmless form(s). - Highlights: • Toxicity evaluated for 3 common pharmaceuticals (atenolol, ketoprofen and diclofenac). • Toxicity assessed for the pharmaceuticals and UV photolysis by-products in zebrafish. • Diclofenac photolysis by-products are more toxic than the parent compound. • Ketoprofen and atenolol show stronger oxidative stress response than by-products. • UV photolysis should ensure full removal of diclofenac metabolites to avoid toxicity

Monitoring the aging of pressure vessel steels by TEP measurements: Advantages and current limitations of the method

International Nuclear Information System (INIS)

Kleber, X.; Saillet, S.

2011-01-01

The TEP (Thermoelectric Power or Seebeck coefficient) characterizes the ability of a material to generate an electrical potential difference when the material is subjected to a heat flux. It can be defined from the Seebeck effect, which manifests itself in a circuit formed by two different metals subjected to a temperature gradient. The origin of the thermoelectric power is, as the resistivity, due to electronic phenomena occurring at the atomic scale in relation to the crystallographic structure of the material. TEP measurements are used to characterize small microstructural changes at the scale of crystal defects. The high sensitivity of TEP makes it an excellent probe able of detecting small changes in the microstructural state, including precipitation, dissolution of alloying elements, hardening and recovery after deformation. It has been shown recently that the TEP of pressure vessels steels was sensitive to irradiation, making this measurement technique a potential candidate for monitoring the aging of the pressure vessel steel. However, the first measurements on Charpy specimens of the EDF monitoring program (Pressure Vessel Surveillance Program) showed a strong negative effect of specimen geometry on the accuracy that can be achieved. In this paper we show what the origins of these inaccuracies are. From numerical simulation and finite element model, we describe the roles of the thermal contact resistance as well as the influence of the geometry of the blocks device. A model is proposed to overcome these negative effects. We also show the effect of the presence of heterogeneities in the material on the TEP measurement, and the importance of their localization. Finally, solutions are proposed to improve the device for measuring TEP on PVSP Charpy specimens. (authors)

Characterisation of transparent exopolymer particles (TEP) produced during algal bloom: A membrane treatment perspective

KAUST Repository

Villacorte, Loreen O.

2013-01-01

Algal blooms are currently a major concern of the membrane industry as it generates massive concentrations of organic matter (e.g. transparent exopolymer particles [TEP]), which can adversely affect the operation of membrane filtration systems. The goal of this study is to understand the production, composition and membrane rejection of these organic materials using different characterisation techniques. Two common species of bloom-forming freshwater and marine algae were cultivated in batch cultures for 30days and the productions of TEP and other organic matter were monitored at different growth phases. TEP production of the marine diatom, Chaetoceros affinis, produced 6-9 times more TEP than the freshwater blue-green algae, Microcystis. The organic substances produced by both algal species were dominated by biopolymeric substances such as polysaccharides (45-64%) and proteins (2-17%) while the remaining fraction comprises of low molecular weight refractory (humic-like) and/ or biogenic organic substances. MF/UF membranes mainly rejected the biopolymers but not the low molecular weight organic materials. MF membranes (0.1-0.4 lm) rejected 42-56% of biopolymers, while UF membranes (10-100 kDa) rejected 65-95% of these materials. Further analysis of rejected organic materials on the surface of the membranes revealed that polysac-charides and proteins are likely responsible for the fouling of MF/UF systems during an algal bloom situation. © 2013 Desalination Publications.

Quantitative real-time PCR analysis of Anopheles dirus TEP1 and NOS during Plasmodium berghei infection, using three reference genes

Directory of Open Access Journals (Sweden)

Jonathan W.K. Liew

2017-07-01

Full Text Available Quantitative reverse transcription PCR (qRT-PCR has been an integral part of characterizing the immunity of Anopheles mosquitoes towards Plasmodium invasion. Two anti-Plasmodium factors of Anopheles, thioester-containing protein 1 (TEP1 and nitric oxide synthase (NOS, play a role in the refractoriness of Anopheles towards Plasmodium infection and are generally expressed during infection. However, these are less studied in Anopheles dirus, a dominant malaria vector in Southeast Asia. Furthermore, most studies used a single reference gene for normalization during gene expression analysis without proper validation. This may lead to erroneous quantification of expression levels. Therefore, the present study characterized and investigated the expression profiles of TEP1 and NOS of Anopheles dirus during P. berghei infection. Prior to that, the elongation factor 1-alpha (EF1, actin 1 (Act and ribosomal protein S7 (S7 genes were validated for their suitability as a set of reference genes. TEP1 and NOS expressions in An. dirus were found to be significantly induced after P. berghei infection.

Synthesis and characterization of TEP-EDTA-regulated bioactive hydroxyapatite

Science.gov (United States)

Haders, Daniel Joseph, II

Hydroxyapatite (HA), Ca10(PO4)6(OH) 2, the stoichiometric equivalent of the ceramic phase of bone, is the preferred material for hard tissue replacement due to its bioactivity. However, bioinert metals are utilized in load-bearing orthopedic applications due to the poor mechanical properties of HA. Consequently, attention has been given to HA coatings for metallic orthopedic implants to take advantage of the bioactivity of HA and the mechanical properties of metals. Commercially, the plasma spray process (PS-HA) is the method most often used to deposit HA films on metallic implants. Since its introduction in the 1980's, however, concerns have been raised about the consequences of PS-HA's low crystallinity, lack of phase purity, lack of film-substrate chemical adhesion, passivation properties, and difficulty in coating complex geometries. Thus, there is a need to develop inexpensive reproducible next-generation HA film deposition techniques, which deposit high crystallinity, phase pure, adhesive, passivating, conformal HA films on clinical metallic substrates. The aim of this dissertation was to intelligently synthesize and characterize the material and biological properties of HA films on metallic substrates synthesized by hydrothermal crystallization, using thermodynamic phase diagrams as the starting point. In three overlapping interdisciplinary studies the potential of using ethylenediamine-tetraacetic acid/triethyl phosphate (EDTA/TEP) doubly regulated hydrothermal crystallization to deposit HA films, the TEP-regulated, time-and-temperature-dependent process by which films were deposited, and the bioactivity of crystallographically engineered films were investigated. Films were crystallized in a 0.232 molal Ca(NO3)2-0.232 molal EDTA-0.187 molal TEP-1.852 molal KOH-H2O chemical system at 200°C. Thermodynamic phase diagrams demonstrated that the chosen conditions were expected to produce Ca-P phase pure HA, which was experimentally confirmed. EDTA regulation of

Prevalence and sunlight photolysis of controlled and chemotherapeutic drugs in aqueous environments

International Nuclear Information System (INIS)

Lin, Angela Yu-Chen; Lin, Yen-Ching; Lee, Wan-Ning

2014-01-01

This study addresses the occurrences and natural fates of chemotherapeutics and controlled drugs when found together in hospital effluents and surface waters. The results revealed the presence of 11 out of 16 drugs in hospital effluents, and the maximum detected concentrations were at the μg L −1 level in the hospital effluents and the ng L −1 level in surface waters. The highest concentrations corresponded to meperidine, morphine, 5-fluorouracil and cyclophosphamide. The sunlight photolysis of the target compounds was investigated, and the results indicated that morphine and codeine can be significantly attenuated, with half-lives of 0.27 and 2.5 h, respectively, in natural waters. Photolysis can lower the detected environmental concentrations, also lowering the estimated environmental risks of the target drugs to human health. Nevertheless, 5-fluorouracil and codeine were found to have a high risk quotient (RQ), demonstrating the high risks of directly releasing hospital wastewater into the environment. - Highlights: • High occurrence of chemotherapeutics and controlled substances in aqueous systems. • Photolysis lowers the detected concentrations of morphine and codeine. • 5-fluorouracil and codeine in hospital effluents have high risk quotients. - Chemotherapeutics and controlled drugs occur at significant levels in hospital effluents and surface waters. Natural sunlight photolysis reduces their environmental occurrence

Preliminary studies on photolysis of polychlorinated dibenzo-p-dioxins on soils surface

Energy Technology Data Exchange (ETDEWEB)

Kobara, Y.; Ishihara, S.; Ohtsu, K.; Horio, T.; Endo, S.

2002-07-01

Polychlorinated dibenzo-p-dioxins (PCDDs) and di benzofurans (PCDFs) are ubiquitous environmental contaminants, and widely distributed in air, water and soil. They are persistent in the environmental and accumulate in living organisms. Some of these compounds are extremely toxic and carcinogenic to animals and possible humans. The Occurrence of PCDDs/PCDFs in the environment originated from both natural and anthropogenic sources. Anthropogenic sources are not manufactured for commercial purposes. These toxic compounds, however, are formed as unintentional by-products from chemical impurities in various industrial processes involving chlorine or by burning organic matter in the presence of chlorine molecules. A significant portion of PCDDs accumulated in soils in Japanese paddy fields was shown to have originated from agrochemicals, especially pentachlorophenol (PCP) and chloronitorofen (2, 4, 6-trichlorophenyl-4-nitrophenyl ether, CNP). Their impurities of PCP were mostly highly chlorinated congeners, especially OCDD that currently remains to the level of 20,000 pg/g in paddy soils. Compounds such as PCDDs/PCDFs that absorbed UV/Vis light can react photochemically by reaching excited state through the direct absorption of light (direct photolysis) or by accepting energy from an excited donor molecule (sensitized photolysis). Reactions can also occur with reactive oxygen species such as singlet oxygen, hydroxyl radicals, etc. formed from photochemical interactions with other organic molecules such as humic acids. Direct photolysis is the only mechanism for photolysis of organic chemicals in pure water and hydrocarbon solutions. However, PCDDs/PCDFs solubilities are extremely low in pure water. The low solubilities of these compounds in aqueous solution make photolysis experiments difficult. Therefore, in most previous studies of photolysis in aqueous solutions an acetonitrile/water mixture was used, furthermore, photolysis experiments were conducted through exposing

Transparent Exopolymeric Particles (TEP Selectively Increase Biogenic Silica Dissolution From Fossil Diatoms as Compared to Fresh Diatoms

Directory of Open Access Journals (Sweden)

Jordan Toullec

2018-03-01

Full Text Available Diatom production is mainly supported by the dissolution of biogenic silica (bSiO2 within the first 200 m of the water column. The upper oceanic layer is enriched in dissolved and/or colloidal organic matter, such as exopolymeric polysaccharides (EPS and transparent exopolymeric particles (TEP excreted by phytoplankton in large amounts, especially at the end of a bloom. In this study we explored for the first time the direct influence of TEP-enriched diatom excretions on bSiO2 dissolution. Twelve dissolution experiments on fresh and fossil diatom frustules were carried out on seawater containing different concentrations of TEP extracted from diatom cultures. Fresh diatom frustules were cleaned from the organic matter by low ash temperature, and fossil diatoms were made from diatomite powder. Results confirm that newly formed bSiO2 dissolved at a faster rate than fossil diatoms due to a lower aluminum (Al content. Diatom excretions have no effect on the dissolution of the newly formed bSiO2 from Chaetoceros muelleri. Reversely, the diatomite specific dissolution rate constant and solubility of the bSiO2 were positively correlated to TEP concentrations, suggesting that diatom excretion may provide an alternative source of dSi when limitations arise.

Updates to In-Line Calculation of Photolysis Rates

Science.gov (United States)

How photolysis rates are calculated affects ozone and aerosol concentrations predicted by the CMAQ model and the model?s run-time. The standard configuration of CMAQ uses the inline option that calculates photolysis rates by solving the radiative transfer equation for the needed ...

Fulvic Acid Mediated Photolysis of Ibuprofen in Water.

Science.gov (United States)

Photolysis of the nonsteroidal anti-inflammatory drug ibuprofen was studied in solutions of fulvic acid (FA) isolated from Pony Lake, Antarctica; Suwannee River, GA, USA; and Old Woman Creek, OH, USA. At an initial concentration of 10 µM ibuprofen degrades by direct photolysis...

Optical inhomogeneity developing in flashlamp photolysis lasers

Energy Technology Data Exchange (ETDEWEB)

Alekhin, B V; Borovkov, V V; Brodskii, A Ya; Lazhintsev, B V; Nor-Arevian, V A; Sukhanov, L V

1980-07-01

The paper discusses the dynamics of optical inhomogenity developing in the active medium of a high-power flashlamp-pumped photolysis laser in inverse population storage, fast inversion suppression, and free-running lasing regimes. A chemical component of the refractive index was found in a C3F7I photolysis experiment, along with the anomalous growth of a gas refractive index.

Direct photolysis of polycyclic aromatic hydrocarbons in drinking water sources

International Nuclear Information System (INIS)

Sanches, S.; Leitao, C.; Penetra, A.; Cardoso, V.V.; Ferreira, E.; Benoliel, M.J.; Crespo, M.T. Barreto; Pereira, V.J.

2011-01-01

Highlights: → Low pressure UV photolysis can be used by drinking water utilities to degrade PAHs. → Real water matrices with different compositions were tested. → Photolysis kinetic parameters and by-product formation are described. → The formation of photolysis by-products is highly dependent on the source waters. - Abstract: The widely used low pressure lamps were tested in terms of their efficiency to degrade polycyclic aromatic hydrocarbons listed as priority pollutants by the European Water Framework Directive and the U.S. Environmental Protection Agency, in water matrices with very different compositions (laboratory grade water, groundwater, and surface water). Using a UV fluence of 1500 mJ/cm 2 , anthracene and benzo(a)pyrene were efficiently degraded, with much higher percent removals obtained when present in groundwater (83-93%) compared to surface water (36-48%). The removal percentages obtained for fluoranthene were lower and ranged from 13 to 54% in the different water matrices tested. Several parameters that influence the direct photolysis of polycyclic aromatic hydrocarbons were determined and their photolysis by-products were identified by mass spectrometry. The formation of photolysis by-products was found to be highly dependent on the source waters tested.

Selective laser photolysis of simple molecules

International Nuclear Information System (INIS)

Golnabi, Hossein.

1984-01-01

A two-photon technique is reported for the measurement of relative cross section for the photolysis of simple molecules into particular product channels. In this method two independently tunable dye lasers were used to sequentially dissociate molecules of Cs 2 and Cs-Kr for the wavelengths in the range 420 to 660 nm, and then to excite the resulting products to determine the relative cross sections for the photolysis of Cs 2 and Cs-kr into each of the lowest four of the energetically possible product states

Exploiting Earth observation data pools for urban analysis: the TEP URBAN project

Science.gov (United States)

Heldens, W.; Esch, T.; Asamer, H.; Boettcher, M.; Brito, F.; Hirner, A.; Marconcini, M.; Mathot, E.; Metz, A.; Permana, H.; Zeidler, J.; Balhar, J.; Soukop, T.; Stankek, F.

2017-10-01

Large amounts of Earth observation (EO) data have been collected to date, to increase even more rapidly with the upcoming Sentinel data. All this data contains unprecedented information, yet it is hard to retrieve, especially for nonremote sensing specialists. As we live in an urban era, with more than 50% of the world population living in cities, urban studies can especially benefit from the EO data. Information is needed for sustainable development of cities, for the understanding of urban growth patterns or for studying the threats of natural hazards or climate change. Bridging this gap between the technology-driven EO sector and the information needs of environmental science, planning, and policy is the driver behind the TEP-Urban project. Modern information technology functionalities and services are tested and implemented in the Urban Thematic Exploitation Platform (U-TEP). The platform enables interested users to easily exploit and generate thematic information on the status and development of the environment based on EO data and technologies. The beta version of the web platform contains value added basic earth observation data, global thematic data sets, and tools to derive user specific indicators and metrics. The code is open source and the architecture of the platform allows adding of new data sets and tools. These functionalities and concepts support the four basic use scenarios of the U-TEP platform: explore existing thematic content; task individual on-demand analyses; develop, deploy and offer your own content or application; and, learn more about innovative data sets and methods.

Evaluation of potential particulate/colloidal TEP foulants on a pilot scale SWRO desalination study

KAUST Repository

Li, Sheng; Sinha, Shahnawaz; Leiknes, TorOve; Amy, Gary L.; Ghaffour, NorEddine

2016-01-01

This pilot study investigated the variation of potential foulants and different fractions of transparent exopolymer particles (TEP), along the treatment scheme under different conditions. The objectives are to provide a comprehensive understanding

Laboratory study of nitrate photolysis in Antarctic snow. I. Observed quantum yield, domain of photolysis, and secondary chemistry

Energy Technology Data Exchange (ETDEWEB)

Meusinger, Carl; Johnson, Matthew S. [Department of Chemistry, University of Copenhagen, Copenhagen (Denmark); Berhanu, Tesfaye A.; Erbland, Joseph; Savarino, Joel, E-mail: jsavarino@lgge.obs.ujf-grenoble.fr [Univ. Grenoble Alpes, LGGE, F-38000 Grenoble (France); CNRS, LGGE, F-38000 Grenoble (France)

2014-06-28

Post-depositional processes alter nitrate concentration and nitrate isotopic composition in the top layers of snow at sites with low snow accumulation rates, such as Dome C, Antarctica. Available nitrate ice core records can provide input for studying past atmospheres and climate if such processes are understood. It has been shown that photolysis of nitrate in the snowpack plays a major role in nitrate loss and that the photolysis products have a significant influence on the local troposphere as well as on other species in the snow. Reported quantum yields for the main reaction spans orders of magnitude – apparently a result of whether nitrate is located at the air-ice interface or in the ice matrix – constituting the largest uncertainty in models of snowpack NO{sub x} emissions. Here, a laboratory study is presented that uses snow from Dome C and minimizes effects of desorption and recombination by flushing the snow during irradiation with UV light. A selection of UV filters allowed examination of the effects of the 200 and 305 nm absorption bands of nitrate. Nitrate concentration and photon flux were measured in the snow. The quantum yield for loss of nitrate was observed to decrease from 0.44 to 0.003 within what corresponds to days of UV exposure in Antarctica. The superposition of photolysis in two photochemical domains of nitrate in snow is proposed: one of photolabile nitrate, and one of buried nitrate. The difference lies in the ability of reaction products to escape the snow crystal, versus undergoing secondary (recombination) chemistry. Modeled NO{sub x} emissions may increase significantly above measured values due to the observed quantum yield in this study. The apparent quantum yield in the 200 nm band was found to be ∼1%, much lower than reported for aqueous chemistry. A companion paper presents an analysis of the change in isotopic composition of snowpack nitrate based on the same samples as in this study.

Expression profiles of vault components MVP, TEP1 and vPARP and their correlation to other multidrug resistance proteins in ovarian cancer.

Science.gov (United States)

Szaflarski, Witold; Sujka-Kordowska, Patrycja; Pula, Bartosz; Jaszczyńska-Nowinka, Karolina; Andrzejewska, Małgorzata; Zawierucha, Piotr; Dziegiel, Piotr; Nowicki, Michał; Ivanov, Pavel; Zabel, Maciej

2013-08-01

Vaults are cytoplasmic ribonucleoprotein particles composed of three proteins (MVP, TEP1, vPARP) and vault‑associated RNAs (vRNAs). Although the cellular functions of vaults remain unclear, vaults are strongly linked to the development of multidrug resistance (MDR), the major obstacle to the efficient treatment of cancers. Available published data suggest that vaults and their components are frequently upregulated in broad variety of multidrug-resistant cancer cell lines and tumors of different histological origin. Here, we provide detailed analysis of vault protein expression in post-surgery ovarian cancer samples from patients that were not exposed to chemotherapy. Our analysis suggests that vault proteins are expressed in the ovaries of healthy individuals but their expression in cancer patients is changed. Specifically, MVP, TEP1 and vPARP mRNA levels are significantly decreased in cancer samples with tendency of lower expression in higher-grade tumors. The pattern of vault protein mRNA expression is strongly correlated with the expression of other MDR-associated proteins such as MDR1, MRP1 and BCRP. Surprisingly, the protein levels of MVP, TEP1 and vPARP are actually increased in the higher‑grade tumors suggesting existence of post-transcriptional regulation of vault component production.

Characterisation of transparent exopolymer particles (TEP) produced during algal bloom: A membrane treatment perspective

KAUST Repository

Villacorte, Loreen O.; Ekowati, Yuli; Winters, Harvey; Amy, Gary L.; Schippers, Jan Cornelis; Kennedy, D.

2013-01-01

Algal blooms are currently a major concern of the membrane industry as it generates massive concentrations of organic matter (e.g. transparent exopolymer particles [TEP]), which can adversely affect the operation of membrane filtration systems

Verification of RDX Photolysis Mechanism

National Research Council Canada - National Science Library

Peyton, Gary

1999-01-01

... such as formaldehyde and formic acid, as well as the inorganic ions nitrate and nitrite. This implies that UV photolysis might provide a satisfactory and economical treatment system for RDX in water...

Coastal Thematic Exploitation Platform (C-TEP): An innovative and collaborative platform to facilitate Big Data coastal research

Science.gov (United States)

Tuohy, Eimear; Clerc, Sebastien; Politi, Eirini; Mangin, Antoine; Datcu, Mihai; Vignudelli, Stefano; Illuzzi, Diomede; Craciunescu, Vasile; Aspetsberger, Michael

2017-04-01

The Coastal Thematic Exploitation Platform (C-TEP) is an on-going European Space Agency (ESA) funded project to develop a web service dedicated to the observation of the coastal environment and to support coastal management and monitoring. For over 20 years ESA satellites have provided a wealth of environmental data. The availability of an ever increasing volume of environmental data from satellite remote sensing provides a unique opportunity for exploratory science and the development of coastal applications. However, the diversity and complexity of EO data available, the need for efficient data access, information extraction, data management and high spec processing tools pose major challenges to achieving its full potential in terms of Big Data exploitation. C-TEP will provide a new means to handle the technical challenges of the observation of coastal areas and contribute to improved understanding and decision-making with respect to coastal resources and environments. C-TEP will unlock coastal knowledge and innovation as a collaborative, virtual work environment providing access to a comprehensive database of coastal Earth Observation (EO) data, in-situ data, model data and the tools and processors necessary to fully exploit these vast and heterogeneous datasets. The cloud processing capabilities provided, allow users to perform heavy processing tasks through a user-friendly Graphical User Interface (GUI). A connection to the PEPS (Plateforme pour l'Exploitation des Produits Sentinel) archive will provide data from Sentinel missions 1, 2 and 3. Automatic comparison tools will be provided to exploit the in-situ datasets in synergy with EO data. In addition, users may develop, test and share their own advanced algorithms for the extraction of coastal information. Algorithm validation will be facilitated by the capabilities to compute statistics over long time-series. Finally, C-TEP subscription services will allow users to perform automatic monitoring of some key

Earth Observation-Supported Service Platform for the Development and Provision of Thematic Information on the Built Environment - the Tep-Urban Project

Science.gov (United States)

Esch, T.; Asamer, H.; Boettcher, M.; Brito, F.; Hirner, A.; Marconcini, M.; Mathot, E.; Metz, A.; Permana, H.; Soukop, T.; Stanek, F.; Kuchar, S.; Zeidler, J.; Balhar, J.

2016-06-01

The Sentinel fleet will provide a so-far unique coverage with Earth observation data and therewith new opportunities for the implementation of methodologies to generate innovative geo-information products and services. It is here where the TEP Urban project is supposed to initiate a step change by providing an open and participatory platform based on modern ICT technologies and services that enables any interested user to easily exploit Earth observation data pools, in particular those of the Sentinel missions, and derive thematic information on the status and development of the built environment from these data. Key component of TEP Urban project is the implementation of a web-based platform employing distributed high-level computing infrastructures and providing key functionalities for i) high-performance access to satellite imagery and derived thematic data, ii) modular and generic state-of-the art pre-processing, analysis, and visualization techniques, iii) customized development and dissemination of algorithms, products and services, and iv) networking and communication. This contribution introduces the main facts about the TEP Urban project, including a description of the general objectives, the platform systems design and functionalities, and the preliminary portfolio products and services available at the TEP Urban platform.

Computation code TEP 1 for automated evaluation of technical and economic parameters of operation of WWER-440 nuclear power plant units

International Nuclear Information System (INIS)

Zadrazil, J.; Cvan, M.; Strimelsky, V.

1987-01-01

The TEP 1 program is used for automated evaluation of the technical and economic parameters of nuclear power plant units with WWER-440 reactors. This is an application program developed by the Research Institute for Nuclear Power Plants in Jaslovske Bohunice for the KOMPLEX-URAN 2M information system, delivered by the USSR to the V-2 nuclear power plants in Jaslovske Bohunice and in Dukovany. The TEP 1 program is written in FORTRAN IV and its operation has two parts. First the evaluation of technical and economic parameters of operation for a calculation interval of 10 mins and second, the control of the calculation procedure, follow-up on input data, determination of technical and economic parameters for a lengthy time interval, and data printout and storage. The TEP 1 program was tested at the first unit of the V-2 power plant and no serious faults appeared in the process of the evaluation of technical and economic parameters. A modification of the TEP 1 programme for the Dukovany nuclear power plant is now being tested on the first unit of the plant. (Z.M.)

Comparison of Vanillin and Isovanillin Photolysis in Aqueous Solutions

Science.gov (United States)

Vusovich, O. V.; Lapin, I. N.; Svetlichnyi, V. A.; Sul'timova, N. B.; Tchaikovskaya, O. N.

2014-03-01

General kinetic regularities of reactions of stationary and laser photolysis of 3-methoxy-4-hydroxybenzaldehyde (vanillin) and 3-hydroxy-4-methoxybenzaldehyde (isovanillin) are investigated by the method of nanosecond laser flash-photolysis. The 4th harmonic of a Nd:YAG laser (λexc = 266 nm) with pulse duration of 7 ns, output power of 100 MW/cm2, and delay time of 30 ns was used as an excitation source. As a result of photolysis, the same photoproducts are formed in the region of absorption at 715 nm. The rate constants of vanillin and isovanillin decomposition obey the first order law and are 2.3ṡ106 and 2.5ṡ106 s-1, respectively.

Improved method for measuring transparent exopolymer particles (TEP) and their precursors infresh and saline water

KAUST Repository

Villacorte, Loreen O.; Ekowati, Yuli; Calix-Ponce, Helga N.; Schippers, Jan Cornelis; Amy, Gary L.; Kennedy, Maria Dolores

2015-01-01

Transparent exopolymer particles (TEP) and their precursors produced by phyto-/bacterio-planktons in fresh and marine aquatic environments are increasingly considered as a major contributor to organic/particulate and biological fouling in micro

Photodegradation of dimethyl sulfide (DMS) in natural waters: laboratory assessment of the nitrate-photolysis-induced DMS oxidation.

Science.gov (United States)

Bouillon, René-Christian; Miller, William L

2005-12-15

The interaction of sunlight and dissolved chromophoric matter produces reactive chemical species that are significant in the removal of dimethyl sulfide (DMS) in the surface ocean. Using artificial solar radiation, we examined the role of several inorganic components of seawater on the kinetics of NO3- -photolysis-induced DMS removal in aqueous solution. This study strongly suggests that NO3- photolysis products react significantly with DMS in aqueous solution possibly via an electrophilic attack on the electron-rich sulfur atom. This supports previous field observations that indicate that NO3- photolysis has a substantial control on DMS photochemistry in nutrient-rich waters. A key finding of this research is that the oxidation rate of DMS induced by NO3- photolysis is dramatically enhanced in the presence of bromide ion. Moreover, our results suggest that bicarbonate/carbonate ions are involved in free radical production/scavenging processes important for DMS photochemistry. These reactions are pH dependent. We propose that DMS removal by some selective free radicals derived from bromide and bicarbonate/carbonate ion oxidation is a potentially important and previously unrecognized pathway for DMS photodegradation in marine waters.

Laboratory study of nitrate photolysis in Antarctic snow

DEFF Research Database (Denmark)

Berhanu, Tesfaye A.; Meusinger, Carl; Erbland, Joseph

2014-01-01

in Antarctic snow. I. Observed quantum yield, domain of photolysis, and secondary chemistry," J. Chem. Phys. 140, 244305 (2014)]) is to characterize nitrate photochemistry and improve the interpretation of the nitrate ice core record. Naturally occurring stable isotopes in nitrate (15N, 17O, and 18O) provide...... additional information concerning post-depositional processes. Here, we present results from studies of the wavelength-dependent isotope effects from photolysis of nitrate in a matrix of natural snow. Snow from Dome C, Antarctica was irradiated in selected wavelength regions using a Xe UV lamp and filters....... The irradiated snow was sampled and analyzed for nitrate concentration and isotopic composition (δ 15N, δ 18O, and Δ 17O). From these measurements an average photolytic isotopic fractionation of 15ε = (- 15 ± 1.2)‰ was found for broadband Xe lamp photolysis. These results are due in part to excitation...

Intimately coupling of photolysis accelerates nitrobenzene biodegradation, but sequential coupling slows biodegradation

Energy Technology Data Exchange (ETDEWEB)

Yang, Lihui [Department of Environmental Science and Engineering, College of Life and Environmental Science, Shanghai Normal University, Shanghai 200234 (China); Zhang, Yongming, E-mail: zhym@shnu.edu.cn [Department of Environmental Science and Engineering, College of Life and Environmental Science, Shanghai Normal University, Shanghai 200234 (China); Bai, Qi; Yan, Ning; Xu, Hua [Department of Environmental Science and Engineering, College of Life and Environmental Science, Shanghai Normal University, Shanghai 200234 (China); Rittmann, Bruce E. [Swette Center for Environmental Biotechnology, Biodesign Institute, Arizona State University, Tempe, AZ 85287-5701 (United States)

2015-04-28

Highlights: • Intimately coupled UV photolysis accelerated nitrobenzene biodegradation. • NB biodegradation was slowed by accumulation of nitrophenol. • Oxalic acid was a key product of UV photolysis. • Oxalic acid accelerated biodegradation of nitrobenzene and nitrophenol by a co-substrate effect. • Intimate coupling of UV and biodegradation accentuated the benefits of oxalic acid. - Abstract: Photo(cata)lysis coupled with biodegradation is superior to photo(cata)lysis or biodegradation alone for removal of recalcitrant organic compounds. The two steps can be carried out sequentially or simultaneously via intimate coupling. We studied nitrobenzene (NB) removal and mineralization to evaluate why intimate coupling of photolysis with biodegradation was superior to sequential coupling. Employing an internal circulation baffled biofilm reactor, we compared direct biodegradation (B), biodegradation after photolysis (P + B), simultaneous photolysis and biodegradation (P&B), and biodegradation with nitrophenol (NP) and oxalic acid (OA) added individually and simultaneously (B + NP, B + OA, and B + NP + OA); NP and OA were NB’s main UV-photolysis products. Compared with B, the biodegradation rate P + B was lower by 13–29%, but intimately coupling (P&B) had a removal rate that was 10–13% higher; mineralization showed similar trends. B + OA gave results similar to P&B, B + NP gave results similar to P + B, and B + OA + NP gave results between P + B and P&B, depending on the amount of OA and NP added. The photolysis product OA accelerated NB biodegradation through a co-substrate effect, but NP was inhibitory. Although decreasing the UV photolysis time could minimize the inhibition impact of NP in P + B, P&B gave the fastest removal of NB by accentuating the co-substrate effect of OA.

Intimately coupling of photolysis accelerates nitrobenzene biodegradation, but sequential coupling slows biodegradation

International Nuclear Information System (INIS)

Yang, Lihui; Zhang, Yongming; Bai, Qi; Yan, Ning; Xu, Hua; Rittmann, Bruce E.

2015-01-01

Highlights: • Intimately coupled UV photolysis accelerated nitrobenzene biodegradation. • NB biodegradation was slowed by accumulation of nitrophenol. • Oxalic acid was a key product of UV photolysis. • Oxalic acid accelerated biodegradation of nitrobenzene and nitrophenol by a co-substrate effect. • Intimate coupling of UV and biodegradation accentuated the benefits of oxalic acid. - Abstract: Photo(cata)lysis coupled with biodegradation is superior to photo(cata)lysis or biodegradation alone for removal of recalcitrant organic compounds. The two steps can be carried out sequentially or simultaneously via intimate coupling. We studied nitrobenzene (NB) removal and mineralization to evaluate why intimate coupling of photolysis with biodegradation was superior to sequential coupling. Employing an internal circulation baffled biofilm reactor, we compared direct biodegradation (B), biodegradation after photolysis (P + B), simultaneous photolysis and biodegradation (P&B), and biodegradation with nitrophenol (NP) and oxalic acid (OA) added individually and simultaneously (B + NP, B + OA, and B + NP + OA); NP and OA were NB’s main UV-photolysis products. Compared with B, the biodegradation rate P + B was lower by 13–29%, but intimately coupling (P&B) had a removal rate that was 10–13% higher; mineralization showed similar trends. B + OA gave results similar to P&B, B + NP gave results similar to P + B, and B + OA + NP gave results between P + B and P&B, depending on the amount of OA and NP added. The photolysis product OA accelerated NB biodegradation through a co-substrate effect, but NP was inhibitory. Although decreasing the UV photolysis time could minimize the inhibition impact of NP in P + B, P&B gave the fastest removal of NB by accentuating the co-substrate effect of OA

Degradation of Paracetamol by Photolysis Using C-N-codoped TiO2

Directory of Open Access Journals (Sweden)

Vanny Yulia Safitri

2017-11-01

Full Text Available Paracetamol is generally used as analgesic and antipyretic drugs. Contamination paracetamol in the environment can occur because of waste material disposal from production site and immediate disposal of household that cause water pollution. Paracetamol is degraded by photolysis method under irradiation 10 watt UV-light (λ=365 nm, visible-light (Philips LED 13 watt 1400 lux and solar-light with and without addition C-N-codoped TiO2catalyst. The solution is analyzed by UV-Vis spectrophotometer at λ 200-400 nm. Optimum weight of C-N-codoped TiO2 catalyst obtained is 20 mg under UV-light photolysis. Paracetamol 4 mg/L is degraded 45.48% after 120 minutes under UV-light irradiation without catalyst, and increases to be 69.31% by using 20 mg catalyst. While degradation percentage of paracetamol is 16.96 % without catalyst, the percentage increases to be 34.29% after using 20 mg catalyst for 120 minutes photolysis under visible-light. Degradation of paracetamol by solar light achieves only 12.27% in absance of catalyst for 120 minutes irradiation, but it increases significantly until 70.39% in presence of 20 mg catalyst.

The effect of ultrapro or prolene mesh on postoperative pain and well-being following endoscopic Totally Extraperitoneal (TEP hernia repair (TULP: study protocol for a randomized controlled trial

Directory of Open Access Journals (Sweden)

Schouten Nelleke

2012-06-01

Full Text Available Abstract Background The purpose of this study was to describe the rationale and design of a randomized controlled trial analyzing the effects of mesh type (Ultrapro versus Prolene mesh on postoperative pain and well-being following an endoscopic Totally Extraperitoneal (TEP repair for inguinal hernias (short: TULP trial. Methods and design The TULP trial is a prospective, two arm, double blind, randomized controlled trial to assess chronic postoperative pain and quality of life following implantation of a lightweight (Ultrapro and heavyweight (Prolene mesh in endoscopic TEP hernia repair. The setting is a high-volume single center hospital, specializing in TEP hernia repair. All patients are operated on by one of four surgeons. Adult male patients (≥18 years of age with primary, reducible, unilateral inguinal hernias and no contraindications for TEP repair are eligible for inclusion in the study. The primary outcome is substantial chronic postoperative pain, defined as moderate to severe pain persisting ≥ 3 months postoperatively (Numerical Rating Scale, NRS 4–10. Secondary endpoints are the individual development of pain until three years after the TEP procedure, the quality of life (QoL, recurrence rate, patient satisfaction and complications. Discussion Large prospective randomized controlled studies with a long follow-up evaluating the incidence of chronic postoperative pain following implantation of lightweight and heavyweight mesh in endoscopic (TEP hernia repair are limited. By studying the presence of pain and quality of life, but also complications and recurrences in a large patient population, a complete efficiency and feasibility assessment of both mesh types in TEP hernia repair will be performed. Trial registration The TULP study is registered in the Dutch Trial Register (NTR2131

Photolysis of O-nitrobenzoin: a reinvestigation

International Nuclear Information System (INIS)

Dicks, P.F.; Goosen, A.; McCleland, C.W.

1983-01-01

Photolysis of O-nitrobenzoin produces benzaldehyde and 2-phenylbenzo[b]furan. The addition of a nitrogen dioxide scavenger and a triplet n→πsup(*) carbonyl quencher are shown to inhibit 2-phenylbenzo[b]furan formation. It is proposed that cyclization occurs through the carbonyl n→πsup(*) triplet state. The benzaldehyde could result either from rapid α-cleavage of the carbonyl group, occurring from either the singlet or triplet n→πsup(*) states in a process which is concerted with cleavage of the O-NO 2 bond, or from fragmentation of the alkoxyl radical produced upon photolysis of the nitrate ester, or from a combination of both processes. Support for the intermediacy of the alkoxyl radical is afforded by the observation that O-nitro-hydrobenzoin and some of its derivatives all afforded benzaldehyde under similar conditions

Ozone Formation in Laser Flash Photolysis of Oxoacids and Oxoanions of Chlorine and Bromine

DEFF Research Database (Denmark)

Kläning, Ulrik; Sehested, Knud; Wolff, Thomas

1984-01-01

The kinetics of ozone formation in the photolysis of oxygen-containing solutions of HClO, ClO–, ClO–2, ClO–3, HBrO, BrO– and BrO–3 has been studied by laser flash photolysis and conventional flash photolysis. The usual assumption, that ozone only forms in the reaction of oxygen atoms in the spin-...

Photolysis of Periodate and Periodic Acid in Aqueous Solution

DEFF Research Database (Denmark)

Sehested, Knud; Kläning, U. K.

1978-01-01

The photochemistry of periodate and periodic acid in aqueous solution was studied (i) by quantum yield measurements at low light intensity (ii) by flash photolysis, and (iii) by photolysis of glassy samples at 77 K. The photochemical studies were supplemented with pulse radiolysis studies...... of aqueous periodate solutions and with kinetic studies using stopped-flow technique. In strongly alkaline solution the photodecomposition of periodate proceeds via formation of O– and IVI. At pH solution O3 P is formed in a small...

Utilization of solar energy through photosynthesis and artificial water photolysis

International Nuclear Information System (INIS)

Broda, E.

1976-01-01

The plants build up organic matter with a carbon content of the order of 1011 t/year by means of photochemistry. Energy farming for the production of liquid or gaseous fuel is discussed. Yet the abiotic photolysis of water with production of hydrogen is preferable. By means of synthetic, asymmetric, photochemically active, membranes the primary products of water photolysis could be spatially separated so that their recombination is prevented.(author)

Flash photolysis of carbon dioxide in the far ultra-violet

International Nuclear Information System (INIS)

Barat, F.

1970-01-01

The flash photolysis of CO 2 (3 torr) in the far ultra-violet, down to the transparency limit of lithium fluoride, produces vibrationally excited CO in its Χ 1 Σ electronic ground state and an electronically excited oxygen atom O( 1 D). After photolysis, the changes in the concentration of vibrationally de-excited CO in the 0 to 200 μsec, time range are followed using absorption spectroscopy. These changes can be explained on the basis of three main competing reactions: CO(Χ 1 Σ, ν'' = 0) + O( 1 D) → CO 2 ( 1 Σ g + ), O( 1 D) + CO 2 → O( 3 P) + CO 2 and CO 3 , CO(X 1 Σ, ν'' = 1,2) + CO 2 → CO(Χ 1 Σ, ν'' = 0) + CO 2 . The values of the rate constants for these three reactions are determined by analog calculations. The effect of O( 1 D) scavenging or quenching gases on the oxidation reaction of CO by O( 1 D) is examined. A study of the flash photolysis of O 2 in the presence of CO in the far ultra-violet makes it possible to eliminate the hypothesis that CO 3 is involved in the reaction leading to the disappearance of CO after photolysis. (author) [fr

Photolysis of 2,4,6-trinitrotoluene in seawater and estuary water: Impact of pH, temperature, salinity, and dissolved organic matter

International Nuclear Information System (INIS)

Luning Prak, Dianne J.; Breuer, James E.T.; Rios, Evelyn A.; Jedlicka, Erin E.; O'Sullivan, Daniel W.

2017-01-01

The influence of salinity, pH, temperature, and dissolved organic matter on the photolysis rate of 2,4,6-trinitrotoluene (TNT) in marine, estuary, and laboratory-prepared waters was studied using a Suntest CPS +® solar simulator equipped with optical filters. TNT degradation rates were determined using HPLC analysis, and products were identified using LC/MS. Minimal or no TNT photolysis occurred under a 395-nm long pass filter, but under a 295-nm filter, first-order TNT degradation rate constants and apparent quantum yields increased with increasing salinity in both natural and artificial seawater. TNT rate constants increased slightly with increasing temperature (10 to 32 °C) but did not change significantly with pH (6.4 to 8.1). The addition of dissolved organic matter (up to 5 mg/L) to ultrapure water, artificial seawater, and natural seawater increased the TNT photolysis rate constant. Products formed by TNT photolysis in natural seawater were determined to be 2,4,6-trinitrobenzaldehyde, 1,3,5-trinitrobenzene, 2,4,6-trinitrobenzoic acid, and 2-amino-4,6-dinitrobenzoic acid. - Highlights: • 2,4,6-trinitrotoluene (TNT) was photolyzed in marine, estuary, & laboratory waters. • TNT photolysis rates increased with increasing salinity & dissolved organic matter. • Temperature and pH had minimal impact on TNT photolysis in marine waters. • In seawater, TNT photolysis produced 1,3,5-trinitrobenzene & trinitrobenzaldehyde. • Polar products were 2,4,6-trinobenzoic acid & 2-amino-4,6-dinitrobenzoic acid.

Photolysis of the antidepressants amisulpride and desipramine in wastewaters: Identification of transformation products formed and their fate

International Nuclear Information System (INIS)

Gros, Meritxell; Williams, Mike; Llorca, Marta; Rodriguez-Mozaz, Sara; Barceló, Damià; Kookana, Rai S.

2015-01-01

Attenuation of pharmaceuticals due to natural sunlight is expected to be an important removal pathway in wastewater treatment plants using treatment lagoon systems. In this work, the photolysis of two antidepressants, amisulpride and desipramine, has been investigated in both ultrapure water and wastewater under simulated solar irradiation. Results showed that for amisulpride short irradiation times (t 1/2 approximately 3 h in pure water and 4 h in wastewater) were adequate to degrade the parent compound while a longer exposure period was required for desipramine (t 1/2 of approximately 36 h in pure water), although its degradation is enhanced almost three times by indirect photolysis in wastewaters. A significant number of transformation products (TPs) were identified for both pharmaceuticals by high-resolution mass spectrometry. In general, TPs formed are not persistent although acute toxicity tests for desipramine and its TPs showed an increase of the mixture toxicity after solar irradiation, suggesting that some TPs may be more toxic than the parent compound. In wastewaters collected from treatment lagoons, only amisulpride and one of its major TPs, TP 357, were detected. This indicates that long solar exposure times may be necessary for an effective elimination of these substances in lagoon systems or that photolysis may not be the main removal pathway for these particular compounds. - Highlights: • Photolysis of both compounds resulted in several transformation products, some of which were previously unknown. • Short irradiation times may be adequate to degrade amisulpride whereas a longer exposure is required for desipramine. • Transformation of desipramine was enhanced by about three times due to indirect photolysis in wastewaters. • For desipramine, mixture acute toxicity increased after solar irradiation. • Photolysis is unlikely to be the main removal pathway for the two antidepressants during wastewater treatment

Photolysis of the antidepressants amisulpride and desipramine in wastewaters: Identification of transformation products formed and their fate

Energy Technology Data Exchange (ETDEWEB)

Gros, Meritxell [Commonwealth Scientific and Industrial Research Organization (CSIRO), Land and Water Flagship, Waite Campus, Urrbrae, 5064 Adelaide, SA (Australia); Swedish University of Agricultural Sciences (SLU), Department of Aquatic Sciences and Assessment, Lennart Hjelms väg 9, 75007 Uppsala (Sweden); Williams, Mike, E-mail: Mike.Williams@csiro.au [Commonwealth Scientific and Industrial Research Organization (CSIRO), Land and Water Flagship, Waite Campus, Urrbrae, 5064 Adelaide, SA (Australia); Llorca, Marta; Rodriguez-Mozaz, Sara [Catalan Institute for Water Research (ICRA), Scientific and Technological Park of the University of Girona, C/Emili Grahit, 101 Girona (Spain); Barceló, Damià [Catalan Institute for Water Research (ICRA), Scientific and Technological Park of the University of Girona, C/Emili Grahit, 101 Girona (Spain); Water and Soil Quality Research Group, Department of Environmental IDAEA-CSIC, Jordi Girona 18-26, E-08034 Barcelona (Spain); Kookana, Rai S. [Commonwealth Scientific and Industrial Research Organization (CSIRO), Land and Water Flagship, Waite Campus, Urrbrae, 5064 Adelaide, SA (Australia)

2015-10-15

Attenuation of pharmaceuticals due to natural sunlight is expected to be an important removal pathway in wastewater treatment plants using treatment lagoon systems. In this work, the photolysis of two antidepressants, amisulpride and desipramine, has been investigated in both ultrapure water and wastewater under simulated solar irradiation. Results showed that for amisulpride short irradiation times (t{sub 1/2} approximately 3 h in pure water and 4 h in wastewater) were adequate to degrade the parent compound while a longer exposure period was required for desipramine (t{sub 1/2} of approximately 36 h in pure water), although its degradation is enhanced almost three times by indirect photolysis in wastewaters. A significant number of transformation products (TPs) were identified for both pharmaceuticals by high-resolution mass spectrometry. In general, TPs formed are not persistent although acute toxicity tests for desipramine and its TPs showed an increase of the mixture toxicity after solar irradiation, suggesting that some TPs may be more toxic than the parent compound. In wastewaters collected from treatment lagoons, only amisulpride and one of its major TPs, TP 357, were detected. This indicates that long solar exposure times may be necessary for an effective elimination of these substances in lagoon systems or that photolysis may not be the main removal pathway for these particular compounds. - Highlights: • Photolysis of both compounds resulted in several transformation products, some of which were previously unknown. • Short irradiation times may be adequate to degrade amisulpride whereas a longer exposure is required for desipramine. • Transformation of desipramine was enhanced by about three times due to indirect photolysis in wastewaters. • For desipramine, mixture acute toxicity increased after solar irradiation. • Photolysis is unlikely to be the main removal pathway for the two antidepressants during wastewater treatment.

Atmospheric degradation of 2- nitrobenzaldehyde: Photolysis and reaction with OH radicals

Science.gov (United States)

Bouya, H.; Al Rashidi, M.; Roth, E.; Salghi, R.; Chakir, A.

2017-12-01

This work presents an experimental study of the gas phase kinetics of 2-nitrobenzaldehyde (2-NBA) photolysis and oxidation by OH radicals. The experiments were carried out in an atmospheric simulation chamber coupled to an FTIR spectrometer and CG/MS. The UV spectra of 2-NBA were also measured and the experimentally determined absorption cross sections were used to estimate the atmospheric photo-dissociation constant of 2-NBA with a global quantum yield of 0.5. The obtained results indicate that 2-NBA is a highly photolysable. A mechanism of 2-NBA photolysis was proposed based on the identification of photolysis degradation products. The kinetics of oxidation of 2-NBA by OH radicals was investigated over the temperature range 308-352 K. The obtained rate coefficients exhibits slight negative temperature dependence and the Arrhenius expression obtained is as follows: kOH+2-NBA(T)= (7.00 ± 3.40) × 10-12exp (577 ± 156/T) cm3 molecule-1 s-1. The calculated rate coefficients lead to tropospheric lifetimes of 2-NBA that are in the order of a few minutes, relative to photolysis, or a few hours, relative to oxidation by OH radicals.

Early photolysis intermediates of gecko and bovine artificial visual pigments.

Science.gov (United States)

Lewis, J W; Liang, J; Ebrey, T G; Sheves, M; Livnah, N; Kuwata, O; Jäger, S; Kliger, D S

1997-11-25

Nanosecond laser photolysis measurements were conducted on digitonin extracts of artificial pigments prepared from the cone-type visual pigment, P521, of the Tokay gecko (Gekko gekko) retina. Artificial pigments were prepared by regeneration of bleached gecko photoreceptor membranes with 9-cis-retinal, 9-cis-14-methylretinal, or 9-cis-alpha-retinal. Absorbance difference spectra were recorded at a sequence of time delays from 30 ns to 60 microseconds following excitation with a pulse of 477-nm actinic light. Global analysis showed the kinetic data for all three artificial gecko pigments to be best fit by two-exponential processes. These two-exponential decays correspond to similar decays observed after photolysis of P521 itself, with the first process being the decay of the equilibrated P521 BathoP521 BSI mixture to P521 Lumi and the second process being the decay of P521 Lumi to P521 Meta I. In spite of its large blue shift relative to P521, iso-P521 displays a normal chloride depletion induced blue shift. Iso-P521's early intermediates up to Lumi were also blue-shifted, with the P521 BathoP521 BSI equilibrated mixture being 15 nm blue-shifted and P521 Lumi being 8 nm blue-shifted relative to the intermediates formed after P521 photolysis. The blue shift associated with the iso-pigment is reduced or disappears entirely by P521 Meta I. Similar blue shifts were observed for the early intermediates observed after photolysis of bovine isorhodopsin, with the Lumi intermediate blue-shifted 5 nm compared to the Lumi intermediate formed after photolysis of bovine rhodopsin. These shifts indicate that a difference exists between the binding sites of 9- and 11-cis pigments which persists for microseconds at 20 degrees C.

Photolysis of polycyclic aromatic hydrocarbons adsorbed on spruce [Picea abies (L.) Karst.] needles under sunlight irradiation

International Nuclear Information System (INIS)

Niu Junfeng; Chen Jingwen; Martens, D.; Quan Xie; Yang Fenglin; Kettrup, A.; Schramm, K.-W.

2003-01-01

Photolysis of PAHs on surfaces may determine their ultimate fate in the environment. - Photolysis of polycyclic aromatic hydrocarbons (PAHs) sorbed on surfaces of spruce [Picea abies (L.) Karst.] needles under sunlight irradiation was investigated. PAHs were produced by combustion of polyvinyl chloride (PVC), wood, high-density polyethylene (HDPE), and styrene in a stove. The factors of sunlight irradiation on the surfaces of spruce needles were taken into consideration when investigating the kinetic parameters. The photolysis of the 18 PAHs under study follows first-order kinetics. The photolysis half-lives range from 15 h for dibenzo(a,h)anthracene to 75 h for phenanthrene. Photolysis of some PAHs on surfaces of spruce needles may play an important role on the fate of PAHs in the environment

Photolysis of rhodamine-WT dye

Science.gov (United States)

Tai, D.Y.; Rathbun, R.E.

1988-01-01

Photolysis of rhodamine-WT dye under natural sunlight conditions was determined by measuring the loss of fluorescence as a function of time. Rate coefficients at 30?? north latitude ranged from 4.77 x 10-2 day-1 for summer to 3.16 x 10-2 day-1 for winter. Experimental coefficients were in good agreement with values calculated using a laboratory-determined value of the quantum yield.

Photolysis of nonylphenol ethoxylates: the determination of the degradation kinetics and the intermediate products.

Science.gov (United States)

Chen, Ling; Zhou, Hai-Yun; Deng, Qin-Ying

2007-06-01

The photolysis of nonylphenol ethoxylates with an average oligomers length of ten ethoxylate units (NPEO(10)) in aqueous solution under UV, as well as the influence of humic acid (HA) on the photolysis was studied. A 125W high-pressure mercury lamp was employed as the light source. The intermediate products from the photolysis were determined by LC-MS. The results indicated that NPEO(10) underwent direct photolysis upon exposed to UV. The degradation pathway was complex. Besides the generally proposed degradation pathway of ethylene oxide (EO) side chains shortening, the oxidation of alkyl chain and EO chain led to intermediates having both a carboxylated (as well as carbonylated) ethoxylate and alkyl chain of varying lengths. The hydrogenation of benzene ring was also detected. The kinetics data showed that the first order reaction kinetics could be well used to describe the kinetics of NPEO(10) degradation. In the presence of dissolved organic matter by HA addition, the performance of NPEO(10) photodegradation was reduced. The photolysis rate decreased with increased HA concentration.

Photolysis of low concentration H2S under UV/VUV irradiation emitted from high frequency discharge electrodeless lamps.

Science.gov (United States)

Xu, Jianhui; Li, Chaolin; Liu, Peng; He, Di; Wang, Jianfeng; Zhang, Qian

2014-08-01

The photolysis of low concentration of H2S malodorous gas was studied under UV irradiation emitted by self-made high frequency discharge electrodeless lamp with atomic mercury lines at 185/253.7nm. Experiments results showed that the removal efficiency (ηH2S) of H2S was decreased with increasing initial H2S concentration and increased slightly with gas residence time. ηH2S was increased dramatically with relative humidity from<5% to 43% while the concentration of oxygen in gas environments affected the removal of H2S. The mechanisms for direct and indirect photolysis (generation of ozone) were illustrated by the experimental results on photolysis of H2S under argon environments and ozonation of H2S under air environments, respectively. The overall ηH2S by photolysis is higher than the combination of ηH2S by direct photolysis and ozonation, suggesting that hydroxyl radical-mediated indirect photolysis played an important role during photolysis processes. The main photolysis product was confirmed to be SO4(2-) with ion chromatograph. Copyright © 2014 Elsevier Ltd. All rights reserved.

Experimental validation of a method for performance monitoring of the impurity processing stage in the TEP system of ITER

International Nuclear Information System (INIS)

Bornschein, B.; Corneli, D.; Glugla, M.; Guenther, K.; Le, T.L.; Simon, K.H.

2007-01-01

The Tokamak Exhaust Processing (TEP) system within the Tritium Plant of ITER needs to be designed such that tritium is recovered from all exhaust gases produced during different modes and operational conditions of the vacuum vessel. The reference process for the TEP system of ITER is called CAPER and comprises three different, consecutive steps to recover hydrogen isotopes at highest purity for direct transfer to the cryogenic Isotope Separation system. The second step ('impurity processing', IP) is carried out in a closed loop involving heterogeneously catalyzed cracking or conversion reactions to liberate tritium from tritiated hydrocarbons or tritiated water combined with permeation of hydrogen isotopes through a Pd/Ag permeator. This combination shifts chemical equilibria towards dehydrogenation and, therefore, enables detritiation factors higher than 1000 in the IP stage. Such a high decontamination factor requires the optimal performance of the permeator, which on the other hand is operated under conditions which provoke coking of the permeator membrane by hydrocarbon cracking. For this reason the permeator in the impurity processing loop needs to be repeatedly regenerated in order to sustain decontamination factors higher/in the order of 1000. At the Tritium Laboratory Karlsruhe (TLK) a method to measure the actual performance of the second stage of the CAPER process has been developed. This method has been successfully tested with the CAPER facility and appears feasible for the TEP system of ITER

CDOM Sources and Photobleaching Control Quantum Yields for Oceanic DMS Photolysis

KAUST Repository

Galí, Martí

2016-11-14

Photolysis is a major removal pathway for the biogenic gas dimethylsulfide (DMS) in the surface ocean. Here we tested the hypothesis that apparent quantum yields (AQY) for DMS photolysis varied according to the quantity and quality of its photosensitizers, chiefly chromophoric dissolved organic matter (CDOM) and nitrate. AQY compiled from the literature and unpublished studies ranged across 3 orders of magnitude at the 330 nm reference wavelength. The smallest AQY(330) were observed in coastal waters receiving major riverine inputs of terrestrial CDOM (0.06-0.5 m3 (mol quanta)-1). In open-ocean waters, AQY(330) generally ranged between 1 and 10 m3 (mol quanta)-1. The largest AQY(330), up to 34 m3 (mol quanta)-1), were seen in the Southern Ocean potentially associated with upwelling. Despite the large AQY variability, daily photolysis rate constants at the sea surface spanned a smaller range (0.04-3.7 d-1), mainly because of the inverse relationship between CDOM absorption and AQY. Comparison of AQY(330) with CDOM spectral signatures suggests there is an interplay between CDOM origin (terrestrial versus marine) and photobleaching that controls variations in AQYs, with a secondary role for nitrate. Our results can be used for regional or large-scale assessment of DMS photolysis rates in future studies.

CDOM Sources and Photobleaching Control Quantum Yields for Oceanic DMS Photolysis.

Science.gov (United States)

Galí, Martí; Kieber, David J; Romera-Castillo, Cristina; Kinsey, Joanna D; Devred, Emmanuel; Pérez, Gonzalo L; Westby, George R; Marrasé, Cèlia; Babin, Marcel; Levasseur, Maurice; Duarte, Carlos M; Agustí, Susana; Simó, Rafel

2016-12-20

Photolysis is a major removal pathway for the biogenic gas dimethylsulfide (DMS) in the surface ocean. Here we tested the hypothesis that apparent quantum yields (AQY) for DMS photolysis varied according to the quantity and quality of its photosensitizers, chiefly chromophoric dissolved organic matter (CDOM) and nitrate. AQY compiled from the literature and unpublished studies ranged across 3 orders of magnitude at the 330 nm reference wavelength. The smallest AQY(330) were observed in coastal waters receiving major riverine inputs of terrestrial CDOM (0.06-0.5 m 3 (mol quanta) -1 ). In open-ocean waters, AQY(330) generally ranged between 1 and 10 m 3 (mol quanta) -1 . The largest AQY(330), up to 34 m 3 (mol quanta) -1 ), were seen in the Southern Ocean potentially associated with upwelling. Despite the large AQY variability, daily photolysis rate constants at the sea surface spanned a smaller range (0.04-3.7 d -1 ), mainly because of the inverse relationship between CDOM absorption and AQY. Comparison of AQY(330) with CDOM spectral signatures suggests there is an interplay between CDOM origin (terrestrial versus marine) and photobleaching that controls variations in AQYs, with a secondary role for nitrate. Our results can be used for regional or large-scale assessment of DMS photolysis rates in future studies.

Marine aggregates and transparent exopolymeric particles (TEPs) as substrates for the stramenopilan fungi, the thraustochytrids: Roller table experimental approach.

Digital Repository Service at National Institute of Oceanography (India)

Damare, V.S.; Raghukumar, S.

In order to understand the kind of organic substrates utilized by thraustochytrids in the coastal water column, their growth in the presence of Transparent Exopolymeric Substances (TEPS) and aggregates generated in roller table experiments...

Pressure dependent deuterium fractionation in the formation of molecular hydrogen in formaldehyde photolysis

DEFF Research Database (Denmark)

Nilsson, Elna Johanna Kristina; Andersen, Vibeke Friis; Skov, Henrik

2009-01-01

The pressure dependence of the relative photolysis rates of HCHO and HCDO has been investigated using a new photochemical reactor at the University of Copenhagen. The relative photolysis rate of HCHO vs. HCDO under UVA lamp irradiation was mea- 5 sured at total pressures of 50, 200, 400, 600...

Relative tropospheric photolysis rates of acetaldehyde and formaldehyde measured at the European Photoreactor Facility

DEFF Research Database (Denmark)

Nilsson, Elna Johanna Kristina; Bache-Andreassen, Lihn; Johnson, Matthew Stanley

2009-01-01

The photolysis rates of HCHO, DCDO, CH3CHO, and CH3CDO are studied by long-path FTIR spectroscopy in natural tropospheric conditions at the European Photoreactor Facility (EUPHORE) in Valencia, Spain. Average relative photolysis rates jHCHO/jDCDO ) 3.15 ( 0.08 and jCH3CHO/jCH3CDO ) 1.26 ( 0.03 ar.......03 are obtained from three days of experiments for each reaction in the period June 17 to July 7, 2006.......The photolysis rates of HCHO, DCDO, CH3CHO, and CH3CDO are studied by long-path FTIR spectroscopy in natural tropospheric conditions at the European Photoreactor Facility (EUPHORE) in Valencia, Spain. Average relative photolysis rates jHCHO/jDCDO ) 3.15 ( 0.08 and jCH3CHO/jCH3CDO ) 1.26 ( 0...

Continuous Monitoring of Photolysis Products by Thz Spectroscopy

Science.gov (United States)

Omar, Abdelaziz; Cuisset, Arnaud; Mouret, Gaël; Hindle, Francis; Eliet, Sophie; Bocquet, Robin

2015-06-01

We demonstrate the potential of THz spectroscopy to monitor the real time evolution of the gas phase concentration of photolysis products and determine the kinetic reaction rate constant. In the primary work, we have chosen to examine the photolysis of formaldehyde (H_2CO). Exposure of H_2CO to a UVB light (250 to 360 nm) in a single pass of 135 cm length cell leads to decomposition via two mechanisms: the radical channel with production of HCO and the molecular channel with production of CO. A commercial THz source (frequency multiplication chain) operating in the range 600-900 GHz was used to detect and quantify the various chemical species as a function of time. Monitoring the concentrations of CO and H_2CO via rotational transitions, allowed the kinetic rate of H_2CO consummation to be obtained, and an estimation of the rate constants for both the molecular and radical photolysis mechanisms. We have modified our experimental setup to increase the sensitivity of the spectrometer and changed sample preparation protocol specifically to quantify the HCO concentration. Acetaldehyde was used as the precursor for photolysis by UVC resulting in the decompositon mechanism can be described by: CH_3CHO+hν→ CH_3 + HCO → CH_4 + CO Frequency modulation of the source and Zeeman modulation is used to achieve the high sensitivity required. Particular attention has been paid to the mercury photosensitization effect that allowed us to increase the HCO production enabling quantification of the monitored radical. We quantify the HCO radical and start a spectroscopic study of the line positions. H. M. Pickett and T. L. Boyd, Chem. Phys. Lett, Vol 58, 446-449, (1978) S. Eliet, A. Cuisset, M Guinet, F. Hindle, G. Mouret, R. Bocquet, and J. Demaison, Journal of Molecular Spectroscopy, Vol 279, 12-15 (2012). G. Mouret, M. Guinet, A. Cuisset, L. Croizé, S. Eliet, R. Bocquet and F. Hindle, Sensors Journal. IEEE, Vol 13, 133 - 138, (2013)

Photochemical of Polychlorinated biphenyl by the photolysis and ...

African Journals Online (AJOL)

Michael Horsfall

reaction mixture inside the cell was continuously stirred with a .... work on PCB photolysis was carried out in alkanes and alcohols. .... dominant mechanism of PCBs destruction becomes hydroxyl ... (2004). Using solar and ultraviolet light to.

Non-invasive bleaching of the human lens by femtosecond laser photolysis

DEFF Research Database (Denmark)

Kessel, L.; Eskildsen, Lars; Poel, Mike van der

2010-01-01

. Reducing blindness from cataract requires solutions that can be applied outside operating theatres. Cataract is a protein conformational disease characterized by accumulation of light absorbing, fluorescent and scattering protein aggregates. The aim of the study was to investigate whether these compounds...... by a non-invasive procedure based on femtosecond laser photolysis. Cataract is a disease associated with old age. At the current technological stage, lens aging is delayed but with a treatment covering the entire lens volume complete optical rejuvenation is expected. Thus, femtosecond photolysis has...

Analysis of N-nitrosodiethylamine by ion chromatography coupled with UV photolysis pretreatment

Directory of Open Access Journals (Sweden)

Xueli Li

2016-04-01

Full Text Available Nitrosamines such as N-nitrosodiethylamine (NDEA are commonly detected by spectrophotometry after photolysis and Griess reaction (PG in food industries for lower cost. Results of this research indicate that NDEA decays rapidly under UV irradiation, and concentrations of the generated NO2− and NO3− ions vary with photolysis conditions. Thus, the measurement of the PG method may be inconsistent because it is based on the amount of photoproduced NO2−. In addition, more errors may be present in the PG method since NO3− cannot be measured colorimetrically using Griess reagent. In this work, the sum of the concentrations of photoproduced NO2− and NO3− was found to be equivalent to the initial NDEA before photolysis, and a photolysis–ion chromatography method was validated, which may serve as a feasible and accurate method to determine nitrosamines.

CO2 laser photolysis of clustered ions, (1)

International Nuclear Information System (INIS)

Ikezoe, Yasumasa; Soga, Takeshi; Suzuki, Kazuya; Ohno, Shin-ichi.

1990-09-01

Vibrational excitation and the following decomposition of cluster ions by CO 2 laser photons are studied. Characteristics of the cluster ion and the CO 2 laser photon are summarized in their relation to the photolysis of cluster ions. An apparatus was installed, which is composed of (1) corona discharge-jet expansion section (formation of cluster ions), (2) CO 2 laser section (photolysis of cluster ions), and (3) mass spectrometer section. Experimental results of ammonia cluster ions were described. Effects of repeller voltage, shape of repellers, and adiabatic cooling are examined on the formation of ammonia cluster ions by corona discharge-jet expansion method. Collisional dissociation of cluster ions was observed at high repeller voltages. Size distribution of the ammonia cluster ion is discussed in connection with the temperature of cluster ions. Intensity of CO 2 laser was related to decomposition yield of cluster ions. (author)

Photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm

Science.gov (United States)

Tang, Yongxin; Zhu, Lei

2005-06-01

We have studied the photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm by using laser photolysis combined with cavity ring-down spectroscopy. The HCO radical is a photodissociation product at 193 and 248 nm. The corresponding HCO quantum yields are 0.55 ± 0.07 and 0.12 ± 0.01, independent of butenedial pressure and nitrogen buffer gas pressure. Absorption cross-sections of butenedial are (6.88 ± 0.39) × 10 -18 and (3.62 ± 0.69) × 10 -19 cm 2 at 193 and 248 nm. The end-products from the photolysis of butenedial at 193, 248, 308, and 351 nm were measured by FTIR. Acrolein and 3H-furan-2-one were observed and their yields have been estimated.

Pulse photolysis of NADH in the presence of cysteine

International Nuclear Information System (INIS)

Scheel, H.E.

1976-01-01

In the UV irradiation of NADH under anaerobic conditions, cysteine, which often acts as a radioprotective substance, has a sensitizing effect. With the aid of pulse photolysis, it was studied which reaction mechanisms in the presence or absence of cysteine are responsible for the damage to NADH in aqueous solution. In the absence of cysteine, the characteristic NADH absorption at 340 nm is reduced immediately after UV quanta have been absorbed by the adenine fraction of the molecules; in the presence of cysteine, a secondary reaction causes additional damage. The spectra of the intermediate products of NADH and cysteine have been recorded for different cysteine concentrations, and the reaction constants have been determined. These values suggest that the sensitizing effect is due to a reaction of NADH with radical anions produced by photolysis. (orig.) [de

Effect of colloids on the occurrence, distribution and photolysis of emerging organic contaminants in wastewaters

Energy Technology Data Exchange (ETDEWEB)

Yan, Caixia [School of Geography and Environment, Key Laboratory of Poyang Lake Wetland and Watershed Research, Ministry of Education, Jiangxi Normal University, No. 99, Ziyang Road, Nanchang 330022 (China); State Key Laboratory of Estuarine and Coastal Research, East China Normal University, 3663 North Zhongshan Road, Shanghai 200062 (China); SmartState Center for Environmental Nanoscience and Risk, Arnold School of Public Health, University of South Carolina, 921 Assembly Street, Columbia 29208,USA (United States); Nie, Minghua [School of Geography and Environment, Key Laboratory of Poyang Lake Wetland and Watershed Research, Ministry of Education, Jiangxi Normal University, No. 99, Ziyang Road, Nanchang 330022 (China); Department of Environmental Science and Engineering, Fudan University, 220Handan Road, Shanghai 200433 (China); Yang, Yi, E-mail: yyang@geo.ecnu.edu.cn [State Key Laboratory of Estuarine and Coastal Research, East China Normal University, 3663 North Zhongshan Road, Shanghai 200062 (China); Key Laboratory of Geographic Information Science of the Ministry of Education, Department of Geosciences, East China Normal University, 3663 North Zhongshan Road, Shanghai 200062 (China); Zhou, Junliang [State Key Laboratory of Estuarine and Coastal Research, East China Normal University, 3663 North Zhongshan Road, Shanghai 200062 (China); Liu, Min [Key Laboratory of Geographic Information Science of the Ministry of Education, Department of Geosciences, East China Normal University, 3663 North Zhongshan Road, Shanghai 200062 (China); Baalousha, Mohammed; Lead, Jamie R. [SmartState Center for Environmental Nanoscience and Risk, Arnold School of Public Health, University of South Carolina, 921 Assembly Street, Columbia 29208,USA (United States)

2015-12-15

Highlights: • Colloidal fractions in wastewaters were isolated using cross flow ultrafiltration. • EOCs exhibited a pseudo - first - order degradation kinetics in all water samples. • Photolysis of EOCs in permeate were accelerated, while inhibited in the retentates. • EOCs with higher degradation rates were detected at low level in natural water. - Abstract: The effect of colloids on the occurrence, phase distribution and photolysis of twenty-seven emerging organic contaminants (EOCs) was studied in domestic and livestock wastewaters (DW and LW), respectively. Filtered water (<1 μm) was separated into permeate (<1 kDa) and retentate (1 kDa-1 μm) by cross flow ultrafiltration. Results indicated that total concentration of EOCs ranged from 1220 ng L{sup −1} in permeate of DW to 5065 ng L{sup −1} in retentate of LW. The average EOC fraction associated with colloids was 13.5% and 14.4% in DW and LW. Most of the EOCs exhibited pseudo-first-order degradation kinetics in all water samples. Control experiments using glass and quartz reactors showed that UV light was more effective on the photolysis of most EOCs. The EOCs photolysis in the three fractions of DW and LW could be accelerated or inhibited compared to ultrapure water with the enhancement factor ranging from −0.94 to 7.33. The impact of colloids on the photolysis of EOCs depended on the compound and the source of water. The photolysis of most EOCs in permeates and filtrates was generally accelerated, while inhibited in the retentates, which could be attributed to the relatively high dissolved organic carbon contents in retentates.

Photolysis of imidacloprid in aqueous solution

International Nuclear Information System (INIS)

Moza, P.N.; Hustert, K.; Feicht, E.; Kettrup, A.

1998-01-01

The photolysis of the insecticide imidacloprid in aqueous solution has been examined. Irradiation at 290 nm resulted in 90 % substrate transformation in 4 h. The degradation approximately followed first order kinetics; the rate constant is 1.6 × 10 −4 s −1 and half-life 1.2 h. 6-Chloronicotinaldehyde, N-methylnicotinacidamide, 1-(6-chloronicotinyl)imidazolidone and 6-chloro-3-pyridyl-methylethylendiamine were the main photoproducts identified by CG-MS analysis. (author)

LAS TIC-TAC-TEP: un referente para la educación policial

Directory of Open Access Journals (Sweden)

Gloria Esperanza Ortiz Russi

2015-11-01

Full Text Available La lectura que las autoras esbozan, hace parte de un discurso tejido durante años en trabajo continuo de cerca a la educación policial, desde el centro de Mediaciones Pedagógicas y Tecnológicas –CEMPE-, se puede comentar que dicho discurso es aún inacabado, pero sí propone una postura clave para ser tenida en cuenta en los procesos educativos que demandan la globalidad en una socio-cultura cada vez más inmersa en las TIC-TAC-TEP,  esas siglas tienen unas nuevas acepciones muy especiales para la educación y que desde la PONAL son necesarias trabajarlas.

Hydrolysis and photolysis of diacylhydrazines-type insect growth regulator JS-118 in aqueous solutions under abiotic conditions.

Science.gov (United States)

Hu, J-Y; Liu, C; Zhang, Y-C; Zheng, Z-X

2009-05-01

JS-118 is a diacylhydrazines-type insect growth regulator which is now used extensively in China. The hydrolysis and photolysis of the pesticide JS-118 in aqueous solutions have been assessed under natural and controlled conditions in this project. Hydrolysis experimental results show that JS-118 is quite stable in aqueous solutions in dark, with no significant variations be observed in degradation under various conditions. Abiotic hydrolysis is relatively unimportant compared to photolysis. The rate of photodecomposition of JS-118 in aqueous solutions follows first-order kinetics both in UV radiation and natural sunlight. The degradation rates are faster under UV light than sunlight, with the half-lives (t (1/2) = ln2/k) of 6.00-10.85 min and 6.63-10.16 day, respectively. Under UV light, two major photoproducts are detected, and tentatively identified according to HPLC-MS spectral information as N-t-butyl-N-(3,5-dimethylbenzoyl) and 3,7-dimethyl-benzoatedihydrofuran. The corresponding photolysis pathways of JS-118 are also proposed. The results obtained indicate that direct photoreaction is an important dissipation pathway of JS-118 in natural water systems.

Phytoplankton aggregate formation: observations of patterns and mechanisms of cell sticking and the significance of exopolymeric material

DEFF Research Database (Denmark)

Kiørboe, Thomas; Hansen, Jorgen L. S.

1993-01-01

are sticky in themselves, and coagulation depends on cell-cell sticking and does not involve mucus. Aggregates are composed solely of cells. Cells of the diatom Chaetoceros affinis, on the other hand, are not in themselves sticky. Transparent exopolymeric particles (TEP), produced by the diatom, cause...... the cells to aggregate and coagulation depends on TEP-cell rather than cell-cell sticking. Aggregates are formed of a mixture of mucus and cells. We found several species of diatoms and one flagellate species to produce copious amounts of TEP. TEP from some species (e.g. Coscinodiscus sp.) is sticky and may...

Mass-dependent and non-mass-dependent isotope effects in ozone photolysis: Resolving theory and experiments

International Nuclear Information System (INIS)

Cole, Amanda S.; Boering, Kristie A.

2006-01-01

In addition to the anomalous 17 O and 18 O isotope effects in the three-body ozone formation reaction O+O 2 +M, isotope effects in the destruction of ozone by photolysis may also play a role in determining the isotopic composition of ozone and other trace gases in the atmosphere. While previous experiments on ozone photolysis at 254 nm were interpreted as evidence for preferential loss of light ozone that is anomalous (or 'non-mass-dependent'), recent semiempirical theoretical calculations predicted a preferential loss of heavy ozone at that wavelength that is mass dependent. Through photochemical modeling results presented here, we resolve this apparent contradiction between experiment and theory. Specifically, we show that the formation of ozone during the UV photolysis experiments is not negligible, as had been assumed, and that the well-known non-mass-dependent isotope effects in ozone formation can account for the non-mass-dependent enrichment of the heavy isotopologs of ozone observed in the experiment. Thus, no unusual non-mass-dependent fractionation in ozone photolysis must be invoked to explain the experimental results. Furthermore, we show that theoretical predictions of a mass-dependent preferential loss of the heavy isotopologs of ozone during UV photolysis are not inconsistent with the experimental data, particularly if mass-dependent isotope effects in the chemical loss reactions of ozone during the photolysis experiments or experimental artifacts enrich the remaining ozone in 17 O and 18 O. Before the calculated fractionation factors can be quantitatively evaluated, however, further investigation of possible mass-dependent isotope effects in the reactions of ozone with O( 1 D), O( 3 P), O 2 ( 1 Δ), and O 2 ( 1 Σ) is needed through experiments we suggest here

Photolysis of oxyfluorfen in aqueous methanol.

Science.gov (United States)

Chakraborty, Subhasish K; Chakraborty, Savitri; Bhattacharyya, Anjan; Chowdhury, Ashim

2013-01-01

Photolysis of oxyfluorfen, an herbicide of the nitrodiphenyl ether class, was studied in aqueous methanol under UV and sunlight. UV irradiation was carried out in a borosilicate glass photoreactor (containing 250 ppm oxyfluorfen in 50% aqueous methanol) equipped with a quartz filter and 125 watt mercury lamp (maximum output 254 nm) at 25 ± 1°C. Sunlight irradiation was conducted at 28 ± 1°C in borosilicate Erlenmeyer flasks containing 250 ppm oxyfluorfen in 50% aqueous methanol. The samples from both the irradiated conditions were withdrawn at a definite time interval and extracted to measure oxyfluorfen content by gas chromatography-flame ionization detector for rate study. The half-life values were 20 hours and 2.7 days under UV and sunlight exposure, respectively. Photolysis of oxyfluorfen yielded 13 photoproducts of which three were characterized by infrared spectrophotometer and (1)H NMR and (13)C NMR spectroscopy. The rest of the photoproducts were identified by gas chromatography-mass spectrometry (GC-MS) and thin layer chromatography (TLC). An ionization potential 70 eV was used for electron impact-mass spectrometry (EI-MS) and methane was used as reagent gas for chemical ionization-mass spectrometry (CI-MS). Two of the photoproducts were also synthesized for comparison. The main phototransformation pathways of oxyfluorfen involved nitro reduction, dechlorination, and hydrolysis as well as nucleophiles displacement reaction.

Impacts of cloud water droplets on the OH production rate from peroxide photolysis.

Science.gov (United States)

Martins-Costa, M T C; Anglada, J M; Francisco, J S; Ruiz-López, Manuel F

2017-12-06

Understanding the difference between observed and modeled concentrations of HO x radicals in the troposphere is a current major issue in atmospheric chemistry. It is widely believed that existing atmospheric models miss a source of such radicals and several potential new sources have been proposed. In recent years, interest has increased on the role played by cloud droplets and organic aerosols. Computer modeling of ozone photolysis, for instance, has shown that atmospheric aqueous interfaces accelerate the associated OH production rate by as much as 3-4 orders of magnitude. Since methylhydroperoxide is a main source and sink of HO x radicals, especially at low NO x concentrations, it is fundamental to assess what is the influence of clouds on its chemistry and photochemistry. In this study, computer simulations for the photolysis of methylhydroperoxide at the air-water interface have been carried out showing that the OH production rate is severely enhanced, reaching a comparable level to ozone photolysis.

In vitro and in vivo anti-Staphylococcus aureus activities of a new disinfection system utilizing photolysis of hydrogen peroxide.

Science.gov (United States)

Hayashi, Eisei; Mokudai, Takayuki; Yamada, Yasutomo; Nakamura, Keisuke; Kanno, Taro; Sasaki, Keiichi; Niwano, Yoshimi

2012-08-01

The present study aimed to evaluate in vitro and in vivo antibacterial activity of hydroxyl radical generation system by photolysis of H(2)O(2), which is a new disinfection system for the treatment of oral infection diseases such as periodontitis developed in our laboratory. Firstly, generation of the hydroxyl radical by the photolysis of H(2)O(2) in which 1 mol l(-1) H(2)O(2) was irradiated with a dual wavelength-light emitting diode (LED) at wavelengths of 400 and 465 nm was confirmed by applying an electron spin resonance-spin trapping technique. Secondly, the bactericidal effect of the system was examined under a similar condition in which Staphylococcus aureus suspended in 1 mol l(-1) H(2)O(2) was irradiated with LED light, resulting in substantial reduction of the colony forming unit (CFU) of the bacteria within a short time as 2 min. Finally, in vivo antibacterial effect of the photolysis of H(2)O(2) on a rat model of S. aureus infection was evaluated by a culture study. Since a significant reduction of recovered CFU of S. aureus was obtained, it is expected that in vitro antibacterial effect attributable to hydroxyl radicals generated by photolysis of H(2)O(2) could be well reflected in in vivo superficial bacterial infection. Copyright © 2012 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

LAPAROSCOPIC TEP VERSUS OPEN HERNIOPLASTY: A COMPARATIVE STUDY OF EXTRAPERITONEAL TENSION FREE MESH REPAIRS IN INGUINAL HERNIA

OpenAIRE

Rehan Sabir; Sadiq; Shadan

2015-01-01

Inguinal hernia repair is now one of the most commonly performed general surgical procedures in practice. 'Tension - free repair' is the procedure of choice . [ 1 ] due to its low recurrence rate, these tension - free repair procedures can be roughly categorized into two groups: laparoscopic and open anterior approach. TEP is accepted as the most ideal method because it can avoid entry into the peritoneal cavity, which can cause intraperitoneal compli...

Antimicrobial activity of hydroxyl radicals generated by hydrogen peroxide photolysis against Streptococcus mutans biofilm.

Science.gov (United States)

Nakamura, Keisuke; Shirato, Midori; Kanno, Taro; Örtengren, Ulf; Lingström, Peter; Niwano, Yoshimi

2016-10-01

Prevention of dental caries with maximum conservation of intact tooth substance remains a challenge in dentistry. The present study aimed to evaluate the antimicrobial effect of H2O2 photolysis on Streptococcus mutans biofilm, which may be a novel antimicrobial chemotherapy for treating caries. S. mutans biofilm was grown on disk-shaped hydroxyapatite specimens. After 1-24 h of incubation, growth was assessed by confocal laser scanning microscopy and viable bacterial counting. Resistance to antibiotics (amoxicillin and erythromycin) was evaluated by comparing bactericidal effects on the biofilm with those on planktonic bacteria. To evaluate the effect of the antimicrobial technique, the biofilm was immersed in 3% H2O2 and was irradiated with an LED at 365 nm for 1 min. Viable bacterial counts in the biofilm were determined by colony counting. The thickness and surface coverage of S. mutans biofilm increased with time, whereas viable bacterial counts plateaued after 6 h. When 12- and 24-h-old biofilms were treated with the minimum concentration of antibiotics that killed viable planktonic bacteria with 3 log reduction, their viable counts were not significantly decreased, suggesting the biofilm acquired antibiotic resistance by increasing its thickness. By contrast, hydroxyl radicals generated by photolysis of 3% H2O2 effectively killed S. mutans in 24-h-old biofilm, with greater than 5 log reduction. The technique based on H2O2 photolysis is a potentially powerful adjunctive antimicrobial chemotherapy for caries treatment. Copyright © 2016 Elsevier B.V. and International Society of Chemotherapy. All rights reserved.

OR TEP-II: a FORTRAN Thermal-Ellipsoid Plot Program for crystal structure illustrations

International Nuclear Information System (INIS)

Johnson, C.K.

1976-03-01

A computer program is described for drawing crystal structure illustrations using a mechanical plotter. Ball-and-stick type illustrations of a quality suitable for publication are produced with either spheres or thermal-motion probability ellipsoids on the atomic sites. The program can produce stereoscopic pairs of illustrations which aid in the visualization of complex packing arrangements of atoms and thermal motion patterns. Interatomic distances, bond angles, and principal axes of thermal motion are also calculated to aid the structural study. The most recent version of the program, OR TEP-II, has a hidden-line-elimination feature to omit those portions of atoms or bonds behind other atoms or bonds

OR TEP-II: a FORTRAN Thermal-Ellipsoid Plot Program for crystal structure illustrations

Energy Technology Data Exchange (ETDEWEB)

Johnson, C.K.

1976-03-01

A computer program is described for drawing crystal structure illustrations using a mechanical plotter. Ball-and-stick type illustrations of a quality suitable for publication are produced with either spheres or thermal-motion probability ellipsoids on the atomic sites. The program can produce stereoscopic pairs of illustrations which aid in the visualization of complex packing arrangements of atoms and thermal motion patterns. Interatomic distances, bond angles, and principal axes of thermal motion are also calculated to aid the structural study. The most recent version of the program, OR TEP-II, has a hidden-line-elimination feature to omit those portions of atoms or bonds behind other atoms or bonds.

Bactericidal Effect of Photolysis of H2O2 in Combination with Sonolysis of Water via Hydroxyl Radical Generation.

Science.gov (United States)

Sheng, Hong; Nakamura, Keisuke; Kanno, Taro; Sasaki, Keiichi; Niwano, Yoshimi

2015-01-01

The bactericidal effect of hydroxyl radical (·OH) generated by combination of photolysis of hydrogen peroxide (H2O2) and sonolysis of water was examined under the condition in which the yield of ·OH increased additively when H2O2 aqueous solution was concomitantly irradiated with laser and ultrasound. The suspension of Staphylococcus aureus mixed with the different concentrations of H2O2 was irradiated simultaneously with a laser light (wavelength: 405 nm, irradiance: 46 and 91 mW/cm2) and ultrasound (power: 30 w, frequency: 1.65 MHz) at 20 ± 1°C of the water bulk temperature for 2 min. The combination of laser and ultrasound irradiation significantly reduced the viable bacterial count in comparison with the laser irradiation of H2O2 alone. By contrast, the ultrasound irradiation alone exerted almost no bactericidal effect. These results suggested that the combination effect of photolysis of H2O2 and sonolysis of water on bactericidal activity was synergistic. A multi-way analysis of variance also revealed that the interaction of H2O2 concentration, laser power and ultrasound irradiation significantly affected the bactericidal activity. Since the result of oxidative DNA damage evaluation demonstrated that the combination of laser and ultrasound irradiation significantly induced oxidative damage of bacterial DNA in comparison with the laser irradiation of H2O2 alone, it was suggested that the combination effect of photolysis of H2O2 and sonolysis of water on bactericidal activity would be exerted via oxidative damage of cellular components such as DNA.

Investigations of UV photolysis of PVP-capped silver nanoparticles in the presence and absence of dissolved organic carbon

International Nuclear Information System (INIS)

Poda, Aimee R.; Kennedy, Alan J.; Cuddy, Michael F.; Bednar, Anthony J.

2013-01-01

This study investigated the effect of UV irradiation on the characteristics and toxicity of 50 nm (nominal diameter) polyvinylpyrrolidone-capped silver nanoparticles (AgNPs) in the presence and absence of dissolved organic carbon (DOC). The photolysis resulted in a decrease in average particle size as measured by field flow fractionation interfaced with inductively coupled plasma mass spectrometry. The decrease in size was attributed to the photo-induced oxidation of the PVP and dissolution of metallic silver. Moreover, photolysis of the AgNPs in solutions containing DOC appeared to give rise to small nanoparticles (∼5 nm) formed via reduction of dissolved silver ions. These results were consistent with photolysis of AgNO 3 solutions initially devoid of nanoparticles. Thus, the carbon-containing constituents of DOC serve as reducing agents for Ag + , primarily under conditions of UV irradiation. The standard zooplankton model, Daphnia magna, indicated that the toxicity of nanosilver was significantly reduced when the AgNPs have been exposed to UV light. Observed toxicity was further reduced when AgNPs in DOC-containing solutions were exposed to UV. These results suggest that environmentally relevant conditions such as DOC and UV light are important mitigating factors that mediate the aquatic toxicity of AgNPs.

Unimolecular H2 elimination during the liquid phase radiolysis and photolysis of alkane - alkane mixtures

International Nuclear Information System (INIS)

Wojnarovits, L.; Foeldiak, G.

1980-01-01

Unimolecular H 2 elimination from alkanes was investigated in cyclopentane-cyclohexane, n-hexane-cyclohexane and cyclohexane-cyclooctane mixtures during fluradiolysis and 7.6 eV photolysis. During the radiolysis of all systems, and when the fluorescence shift law allowed it, during the photolysis as well, inhibited H 2 detachment was observed from the first component and sensitized hydrogen molecule elimination from the second. It has been concluded that the same excited state (the lowest singlet, S 1 ) is responsible for the H 2 elimination during radiolysis and photolysis and this is that one that gives rise to fluorescence in the experiments of other authors. The H 2 and H elimination from alkanes generally have different excited precursors. The direct population of S 1 by γ-irradiation is of limited importance and this intermediate is mainly produced in ''charge neutralization'' processes. (author)

Testing of a 7-tube palladium membrane reactor for potential use in TEP

International Nuclear Information System (INIS)

Carlson, Bryan J.; Trujillo, Stephen; Willms, R. Scott

2010-01-01

A Palladium Membrane Reactor (PMR) consists of a palladium/silver membrane permeator filled with catalyst (catalyst may be inside or outside the membrane tubes). The PMR is designed to recover tritium from the methane, water, and other impurities present in fusion reactor effluent. A key feature of a PMR is that the total hydrogen isotope content of a stream is significantly reduced as (1) methane-steam reforming and/or water-gas shift reactions proceed on the catalyst bed and (2) hydrogen isotopes are removed via permeation through the membrane. With a PMR design matched to processing requirements, nearly complete hydrogen isotope removals can be achieved. A 3-tube PMR study was recently completed. From the results presented in this study, it was possible to conclude that a PMR is appropriate for TEP, perforated metal tube protectors function well, platinum on aluminum (PtA) catalyst performs the best, conditioning with air is probably required to properly condition the Pd/Ag tubes, and that CO/CO 2 ratios maybe an indicator of coking. The 3-tube PMR had a permeator membrane area of 0.0247 m 2 and a catalyst volume to membrane area ratio of 4.63 cc/cm 2 (with the catalyst on the outside of the membrane tubes and the catalyst only covering the membrane tube length). A PMR for TEP will require a larger membrane area (perhaps 0.35 m 2 ). With this in mind, an intermediate sized PMR was constructed. This PMR has 7 permeator tubes and a total membrane area of 0.0851 m 2 . The catalyst volume to membrane area ratio for the 7-tube PMR was 5.18 cc/cm 2 . The total membrane area of the 7-tube PMR (0.0851 m 2 ) is 3.45 times larger than total membrane area of the 3-tube PMR (0.0247 m 2 ). The following objectives were identified for the 7-tube PMR tests: (1) Refine test measurements, especially humidity and flow; (2) Refine maintenance procedures for Pd/Ag tube conditioning; (3) Evaluate baseline PMR operating conditions; (4) Determine PMR scaling method; (5) Evaluate PMR

New Measurements of Methyl Ethyl Ketone (MEK) Photolysis Rates and Their Relevance to Global Oxidative Capacity

Science.gov (United States)

Brewer, J.; Ravishankara, A. R.; Mellouki, A.; Fischer, E. V.; Kukui, A.; Véronique, D.; Ait-helal, W.; Leglise, J.; Ren, Y.

2017-12-01

Methyl ethyl ketone (MEK) is one of the most abundant ketones in the atmosphere. MEK can be emitted directly into the atmosphere from both anthropogenic and natural sources, and it is also formed during the gas-phase oxidation of volatile organic compounds (VOCs). MEK is lost via reaction with OH, photolysis and deposition to the surface. Similar to the other atmospheric ketones, the photolysis of MEK may represent a source of HOx (OH + HO2) radicals in the upper troposphere. The degradation of MEK also leads to the atmospheric formation of acetaldehyde and formaldehyde. This work presents a new analysis of the temperature dependence of MEK photolysis cross-sections and a quantification of MEK photolysis rates under surface pressures using the CNRS HELIOS outdoor atmospheric chamber (Chambre de simulation atmosphérique à irradiation naturelle d'Orléans; http://www.era-orleans.org/ERA-TOOLS/helios-project.html). Additionally, we use the GEOS-Chem 3-D CTM (version 10-01, www.geos-chem.org) to investigate the impact of these newly measured rates and cross-sections on the global distribution and seasonality of MEK, as well as its importance to the tropospheric oxidative capacity.

Room temperature FePt nanoparticles formation kinetics by laser solution photolysis

CSIR Research Space (South Africa)

Nkosi, S

2012-04-01

Full Text Available An experiment has been designed to measure the radiation emission during photolysis, as well as the production of either positive or negative metallic ions in liquid from of FePt nanoparticles....

Time-kill kinetic analysis of antimicrobial chemotherapy based on hydrogen peroxide photolysis against Streptococcus mutans biofilm.

Science.gov (United States)

Shirato, Midori; Nakamura, Keisuke; Kanno, Taro; Lingström, Peter; Niwano, Yoshimi; Örtengren, Ulf

2017-08-01

A recently developed antimicrobial technique utilizing hydroxyl radicals generated by hydrogen peroxide (H 2 O 2 ) photolysis represents a promising new therapy for preventing and treating dental caries. The present study compared the antimicrobial time-kill kinetics of H 2 O 2 photolysis, conventional antiseptics, and antimicrobial photodynamic therapy (aPDT) against biofilm-forming Streptococcus mutans (cariogenic bacteria) grown on hydroxyapatite disks. H 2 O 2 photolysis was performed by irradiating the biofilm immersed in 3% H 2 O 2 with 365-nm light-emitting diode (LED) light at an irradiance of 1000mW/cm 2 for up to 1.5min. Antiseptic treatments consisted of 0.2% chlorhexidine gluconate, 0.5% povidone-iodine, and 3% H 2 O 2 . The biofilm was immersed in each antiseptic for up to 4min. aPDT was performed by irradiating the biofilm immersed in 100μM methylene blue or toluidine blue O with 655-nm laser light at 1000mW/cm 2 for up to 4min. Based on the time-kill assay, the decimal reduction value (D-value) of each treatment was determined. With a D-value of 0.06min, H 2 O 2 photolysis exhibited the highest bactericidal effect against biofilm-forming S. mutans. In contrast, antiseptics and aPDT exerted a slower bactericidal effect, with D-values of 0.9-2.7min. In conclusion, the antimicrobial technique based on H 2 O 2 photolysis using 365-nm LED represents a strong adjunctive chemotherapy for dental caries treatment. Copyright © 2017 Elsevier B.V. All rights reserved.

Synthesis of silver nanoparticles by radiolysis, photolysis and chemical reduction of AgNO3 in Hibiscus sabdariffa infusion (karkade)

International Nuclear Information System (INIS)

Cataldo, Franco; Ursini, Ornella; Angelini, Giancarlo

2016-01-01

Silver nanoparticles of different average diameters were synthesized by γ-radiolysis, UV-photolysis and chemical reduction of AgNO 3 solutions in Hibiscus sabdariffa infusion commonly known as 'karkade'. The UV-photolysis was performed either by using a conventional Hg low pressure lamp emitting at 254 nm and also by using a new compact UV-LED source emitting at 360 nm. The kinetics rate constant of silver nanoparticles synthesis produced by γ-radiolysis and UV photolysis were determined and the average diameter of the resulting nanoparticles was estimated. (author)

Solar photolysis of ozone to singlet D oxygen atoms, O(1D)

International Nuclear Information System (INIS)

Blackburn, T.E.

1984-01-01

Ground level solar photolysis rate coefficients (jO 3 ) were measured for the photolysis of ozone by sunlight, (O 3 + hnu( 2 + O( 1 D)). The O( 1 D) atoms produced react with nitrous oxide (N 2 O) carrier gas to form higher oxides of nitrogen (NOx). Computer model predictions show that these are mainly N 2 O 5 and NO 3 . Seventy five days of data were taken during the summer of 1983, at Ann Arbor, Michigan, and are presented in the appendix. Over 390 clear air jO 3 values are correlated with effective ozone column densities, and 500 nm aerosol optical depths. The solar direct beam component of ozone photolysis was measured for the different aerosol optical depths, over two entire days from sun-up to sun-down. Temperature dependence of jO 3 was measured from 10 0 C to 39 0 C with good agreement to models. Comparison of jO 3 versus global and ultraviolet radiation are made under various ozone column densities and aerosol optical depths. A jO 3 -photometer was built using an interference filter to pass only ozone photolyzing light. Improvements to instrumental parts are shown for balloon and aircraft flyable payloads

Photolysis of 5-bromouracil and some related compounds in solution. Pt. 6

International Nuclear Information System (INIS)

Campbell, J.M.; Sonntag, C. von; Schulte-Frohlinde, D.

1974-01-01

The steady state photolysis of 5-bromouracil (BU) in aqueous solution has been studied as a function of wavelength, pH, temperature, and hydrogen-donor concentration. Under all conditions studied, the primary reaction is shown to be C-Br bond cleavage followed by abstraction from the hydrogen-donor to give uracil and HBr. At pH > 12 further products are formed. In deoxygenated aqueous solution at pH 6, 20 0 C, and 254 nm, the quantum yield of BU consumption, PHI (-BU), is 1.8 x 10 -3 independent of hydrogen-donor type or concentration (e.g. 3 x 10 -2 to 2 m MeOH). With increasing pH, PHI (-BU) increases stepwise to 0.012 at pH 10 and to 0.28 at pH 14. pK-values calculated from these data are the same as ground state pK values. The results have been explained in terms of a homolytic dissociation of the C-Br bond of the excited BU followed by recombination or H atom abstraction by the radicals. At high hydrogen-donor concentration H atom abstraction can compete with cage recombination. A comparison has been made between BU photolysis in organic, hydrogen-donor solvents and BU photolysis within the DNA of bacteria or phages. (orig./HK) [de

Bactericidal Effect of Photolysis of H2O2 in Combination with Sonolysis of Water via Hydroxyl Radical Generation.

Directory of Open Access Journals (Sweden)

Hong Sheng

Full Text Available The bactericidal effect of hydroxyl radical (·OH generated by combination of photolysis of hydrogen peroxide (H2O2 and sonolysis of water was examined under the condition in which the yield of ·OH increased additively when H2O2 aqueous solution was concomitantly irradiated with laser and ultrasound. The suspension of Staphylococcus aureus mixed with the different concentrations of H2O2 was irradiated simultaneously with a laser light (wavelength: 405 nm, irradiance: 46 and 91 mW/cm2 and ultrasound (power: 30 w, frequency: 1.65 MHz at 20 ± 1°C of the water bulk temperature for 2 min. The combination of laser and ultrasound irradiation significantly reduced the viable bacterial count in comparison with the laser irradiation of H2O2 alone. By contrast, the ultrasound irradiation alone exerted almost no bactericidal effect. These results suggested that the combination effect of photolysis of H2O2 and sonolysis of water on bactericidal activity was synergistic. A multi-way analysis of variance also revealed that the interaction of H2O2 concentration, laser power and ultrasound irradiation significantly affected the bactericidal activity. Since the result of oxidative DNA damage evaluation demonstrated that the combination of laser and ultrasound irradiation significantly induced oxidative damage of bacterial DNA in comparison with the laser irradiation of H2O2 alone, it was suggested that the combination effect of photolysis of H2O2 and sonolysis of water on bactericidal activity would be exerted via oxidative damage of cellular components such as DNA.

Laser Flash Photolysis and Pulse Radiolysis of Iodate and Periodate in Aqueous Solution

DEFF Research Database (Denmark)

Kläning, U K; Sehested, Knud; Wolff, Thomas

1981-01-01

photolysis study of IeVI and I0VI suggests that the predominant IeVI and I0VI species formed are IO42– and IO3 at 3 12. Redox reactions of the iodine(VI) species are fast compared with interconversion among the various iodine(VI) species......Species containing iodine in oxidation state six are formed by photolysis and radiolysis of aqueous iodate and periodate solutions in the following reactions: IO3–+ O–→ IO42–; IO3–+ OH → IO3; IVII+ eaq–→ IeVI and IVII [graphic omitted] I0VI+ O–(or OH). The present pulse radiolysis and laser flash...

Magnetic and micellar effects on photoreactions. 1. 13C isotopic enrichment of dibenzyl ketone via photolysis in aqueous detergent solution

International Nuclear Information System (INIS)

Turro, N.J.; Chow, M.F.; Chung, C.J.; Kraeutler, B.

1981-01-01

The photolysis of dibenzyl ketone (DBK) in homogeneous organic solutions and in micelle-containing detergent solutions has been investigated from the standpoint of determining the extent and location of 13 C enrichment that occurs. In a series of experiments it is established that for incomplete conversions the residual, recovered DBK is enriched in 13 C relative to the initial unphotolyzed DBK. The efficiency of the 13 C/ 12 C separation is shown to be characterized by an isotope enrichment parameter, α, which is independent of the extent of conversion. A combination of mass spectrometry and nuclear magnetic resonance spectroscopy provides support for the primary location of the 13 C enrichment at C-1 (the carbonyl carbon) with a lesser but significant enrichment at C-2 (the methylene carbon). A very small but experimentally distinct enrichment of the aromatic rings is indicated by 13 C NMR analysis. An isomer of DBK, 1-phenyl-4'-methylacetophenone (PMAP) is formed as a minor product of photolysis in micellar solutions. PMAP, like the recovered, residual DBK, is found to be substantially enriched in 13 C relative to the starting DBK. The magnitude of α is found to be significantly influenced by the application of laboratory magnetic fields to the photolysis sample. The latter result, along with the unusually large magnitude of α, suggests that the mechanism involved in isotopic enrichment is not dominated by kinetic mass isotope effects but rather by nuclear magnetic moment and/or magnetic spin isotope effects

Absolute absorption cross-section and photolysis rate of I2

Directory of Open Access Journals (Sweden)

A. Saiz-Lopez

2004-01-01

Full Text Available Following recent observations of molecular iodine (I2 in the coastal marine boundary layer (MBL (Saiz-Lopez and Plane, 2004, it has become important to determine the absolute absorption cross-section of I2 at reasonably high resolution, and also to evaluate the rate of photolysis of the molecule in the lower atmosphere. The absolute absorption cross-section (σ of gaseous I2 at room temperature and pressure (295K, 760Torr was therefore measured between 182 and 750nm using a Fourier Transform spectrometer at a resolution of 4cm-1 (0.1nm at λ=500nm. The maximum absorption cross-section in the visible region was observed at λ=533.0nm to be σ=(4.24±0.50x10-18cm2molecule-1. The spectrum is available as supplementary material accompanying this paper. The photo-dissociation rate constant (J of gaseous I2 was also measured directly in a solar simulator, yielding J(I2=0.12±0.03s-1 for the lower troposphere. This is in excellent agreement with the value of 0.12±0.015s-1 calculated using the measured absorption cross-section, terrestrial solar flux for clear sky conditions and assuming a photo-dissociation yield of unity. A two-stream radiation transfer model was then used to determine the variation in photolysis rate with solar zenith angle (SZA, from which an analytic expression is derived for use in atmospheric models. Photolysis appears to be the dominant loss process for I2 during daytime, and hence an important source of iodine atoms in the lower atmosphere.

Elucidating Direct Photolysis Mechanisms of Different Dissociation Species of Norfloxacin in Water and Mg2+ Effects by Quantum Chemical Calculations.

Science.gov (United States)

Wang, Se; Wang, Zhuang

2017-11-11

The study of pollution due to combined antibiotics and metals is urgently needed. Photochemical processes are an important transformation pathway for antibiotics in the environment. The mechanisms underlying the effects of metal-ion complexation on the aquatic photochemical transformation of antibiotics in different dissociation forms are crucial problems in science, and beg solutions. Herein, we investigated the mechanisms of direct photolysis of norfloxacin (NOR) in different dissociation forms in water and metal ion Mg 2+ effects using quantum chemical calculations. Results show that different dissociation forms of NOR had different maximum electronic absorbance wavelengths (NOR 2+ direct photolysis pathways were de-ethylation (N7-C8 bond cleavage) and decarboxylation (C2-C5 bond cleavage). Furthermore, the presence of Mg 2+ changed the order of the wavelength at maximum electronic absorbance (NOR⁺-Mg 2+ direct photolysis of NOR⁰, NOR⁺, and NOR 2+ . The calculated TS results indicated that the presence of Mg 2+ increased E a for most direct photolysis pathways of NOR, while it decreased E a for some direct photolysis pathways such as the loss of the piperazine ring and the damage of the piperazine ring of NOR⁰ and the defluorination of NOR⁺.

Nitrate photolysis in salty snow

Science.gov (United States)

Donaldson, D. J.; Morenz, K.; Shi, Q.; Murphy, J. G.

2016-12-01

Nitrate photolysis from snow can have a significant impact on the oxidative capacity of the local atmosphere, but the factors affecting the release of gas phase products are not well understood. Here, we report the first systematic study of the amounts of NO, NO2, and total nitrogen oxides (NOy) emitted from illuminated snow samples as a function of both nitrate and total salt (NaCl and Instant Ocean) concentration. We show that the release of nitrogen oxides to the gas phase is directly related to the expected nitrate concentration in the brine at the surface of the snow crystals, increasing to a plateau value with increasing nitrate, and generally decreasing with increasing NaCl or Instant Ocean (I.O.). In frozen mixed nitrate (25 mM) - salt (0-500 mM) solutions, there is an increase in gas phase NO2 seen at low added salt amounts: NO2 production is enhanced by 35% at low prefreezing [NaCl] and by 70% at similar prefreezing [I.O.]. Raman microscopy of frozen nitrate-salt solutions shows evidence of stronger nitrate exclusion to the air interface in the presence of I.O. than with added NaCl. The enhancement in nitrogen oxides emission in the presence of salts may prove to be important to the atmospheric oxidative capacity in polar regions.

A Moessbauer study on the photolysis of potassium trisoxalatoferrate(III) in solid and solutions

International Nuclear Information System (INIS)

Sato, H.; Tominaga, T.

1977-01-01

The photolysis of potassium trisoxalatoferrate(III) in solid and aqueous solutions was studied by Moessbauer spectroscopy. A ferrous species was mainly detected as an intermediate product in the photoirradiated solutions. A tentative mechanism was proposed for the overall reactions in and after the photolysis of this compound. The Moessbauer spectra were measured with a Hitachi AA-40 or Shimadzu MEG-2 Moessbauer spectrometer against Co-57 in copper foil. Acrylic holders (32 mm in diameter) were used for measurements of solutions: the irradiated solution was quickly frozen before measurement by adding it dropwise into the acrylic holder which had been cooled with liquid nitrogen or dry-ice. (T.I.)

Spin-trapping and ESR studies of the direct photolysis of aromatic amino acids, dipeptides, tripeptides and polypeptides in aqueous solutions-II. Tyrosine and related compounds

Energy Technology Data Exchange (ETDEWEB)

Lion, Y; Kuwabara, M; Riesz, P [National Cancer Inst., Bethesda, MD (USA)

1982-01-01

The UV-photolysis of peptides containing tyrosine (Tyr) was investigated in aqueous solutions at room temperature at 220 and 265 nm. The short-lived free radicals formed during photolysis were spin-trapped by t-nitrosobutane and identified by electron spin resonance. For N-acetyl-and N-formyl-L-Tyr and for peptides containing L-Tyr as the middle residue, photolysis at 265 nm under neutral conditions produced mainly spin-adducts due to the scission between the alpha carbon and the methylene group attached to the aromatic ring, while at 220 nm decarboxylation radicals were spin-trapped. Photolysis of di- and tripeptides at 275 nm in alkaline solutions predominantly generated deamination radicals. The radicals produced in the photolysis of the oxidized A chain of insulin were tentatively characterized by comparison with the results for di- and tripeptides.

Multi-photon UV photolysis of gaseous polycyclic aromatic hydrocarbons: Extinction spectra and dynamics

Energy Technology Data Exchange (ETDEWEB)

Walsh, A. J.; Gash, E. W.; Mansfield, M. W. D. [Physics Department, University College Cork, Cork (Ireland); Ruth, A. A. [Physics Department, University College Cork, Cork (Ireland); Environmental Research Institute, University College Cork, Cork (Ireland)

2013-08-07

The extinction spectra of static naphthalene and static biphenylene vapor, each buffered with a noble gas at room temperature, were measured as a function of time in the region between 390 and 850 nm after UV multi-photon laser photolysis at 308 nm. Employing incoherent broadband cavity enhanced absorption spectroscopy (IBBCEAS), the spectra were found to be unstructured with a general lack of isolated features suggesting that the extinction was not solely based on absorption but was in fact dominated by scattering from particles formed in the photolysis of the respective polycyclic aromatic hydrocarbon. Following UV multi-photon photolysis, the extinction dynamics of the static (unstirred) closed gas-phase system exhibits extraordinary quasi-periodic and complex oscillations with periods ranging from seconds to many minutes, persisting for up to several hours. Depending on buffer gas type and pressure, several types of dynamical responses could be generated (classified as types I, II, and III). They were studied as a function of temperature and chamber volume for different experimental conditions and possible explanations for the oscillations are discussed. A conclusive model for the observed phenomena has not been established. However, a number of key hypotheses have made based on the measurements in this publication: (a) Following the multi-photon UV photolysis of naphthalene (or biphenylene), particles are formed on a timescale not observable using IBBCEAS. (b) The observed temporal behavior cannot be described on basis of a chemical reaction scheme alone. (c) The pressure dependence of the system's responses is due to transport phenomena of particles in the chamber. (d) The size distribution and the refractive indices of particles are time dependent and evolve on a timescale of minutes to hours. The rate of particle coagulation, involving coalescent growth and particle agglomeration, affects the observed oscillations. (e) The walls of the chamber act as a

A thermal lensing study of a photolysis of di- t-butyl peroxide

Science.gov (United States)

Fuke, K.; Hasegawa, A.; Ueda, M.; Itoh, M.

1981-11-01

A photolysis of di- t-butyl peroxide (BOOB) was studied by using a thermal lensing technique. This technique is found to be applicable to the determination Of the rate Constants of the decay of t-butoxy radical (BO ) and the hydrogen abstraction reaction.

Quantitative assessment on the contribution of direct photolysis and radical oxidation in photochemical degradation of 4-chlorophenol and oxytetracycline.

Science.gov (United States)

Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D

2016-07-01

In UV-254 nm/H2O2 advanced oxidation process (AOP), the potential degradation pathways for organic pollutants include (1) hydrolysis, (2) direct H2O2 oxidation, (3) UV direct photolysis, and (4) hydroxyl radical (HO(•)) reaction. In this study, the contribution of these pathways was quantitatively assessed in the photochemical destruction of 4-chlorophenol (4-CP), demonstrating pathways (3) and (4) to be predominantly responsible for the removal of 4-CP by UV/H2O2 in 50 mM phosphate buffer solution. Increasing reaction pH could significantly enhance the contribution of direct photolysis in UV/H2O2 process. The contribution of HO(•) oxidation was improved with increasing initial H2O2 concentration probably due to the increased formation of HO(•). Presence of sodium carbonate (Na2CO3) as in UV/H2O2/Na2CO3 system promoted the degradation of 4-CP, with carbonate radical (CO3 (•-)) reaction and direct photolysis identified to be the main contributing pathways. The trends in the contribution of each factor were further evaluated and validated on the degradation of the antibiotic compound oxytetracycline (OTC). This study provides valuable information on the relative importance of different reaction pathways on the photochemical degradation of organic contaminants such as 4-CP and OTC in the presence and absence of a CO3 (•-) precursor.

Continuous flow photolysis of aryl azides: Preparation of 3H-azepinones

Directory of Open Access Journals (Sweden)

Farhan R. Bou-Hamdan

2011-08-01

Full Text Available Photolysis of aryl azides to give nitrenes, and their subsequent rearrangement in the presence of water to give 3H-azepinones, is performed in continuous flow in a photoreactor constructed of fluorinated ethylene polymer (FEP tubing. Fine tuning of the reaction conditions using the flow reactor allowed minimization of secondary photochemical reactions.

Determination of the photolysis rate coefficient of monochlorodimethyl sulfide (MClDMS) in the atmosphere and its implications for the enhancement of SO2 production from the DMS + Cl2 reaction.

Science.gov (United States)

Copeland, G; Lee, E P F; Williams, R G; Archibald, A T; Shallcross, D E; Dyke, J M

2014-01-01

In this work, the photolysis rate coefficient of CH3SCH2Cl (MClDMS) in the lower atmosphere has been determined and has been used in a marine boundary layer (MBL) box model to determine the enhancement of SO2 production arising from the reaction DMS + Cl2. Absorption cross sections measured in the 28000-34000 cm(-1) region have been used to determine photolysis rate coefficients of MClDMS in the troposphere at 10 solar zenith angles (SZAs). These have been used to determine the lifetimes of MClDMS in the troposphere. At 0° SZA, a photolysis lifetime of 3-4 h has been obtained. The results show that the photolysis lifetime of MClDMS is significantly smaller than the lifetimes with respect to reaction with OH (≈ 4.6 days) and with Cl atoms (≈ 1.2 days). It has also been shown, using experimentally derived dissociation energies with supporting quantum-chemical calculations, that the dominant photodissocation route of MClDMS is dissociation of the C-S bond to give CH3S and CH2Cl. MBL box modeling calculations show that buildup of MClDMS at night from the Cl2 + DMS reaction leads to enhanced SO2 production during the day. The extra SO2 arises from photolysis of MClDMS to give CH3S and CH2Cl, followed by subsequent oxidation of CH3S.

Laser Photolysis and Thermolysis of Organic Selenides and Tellurides for Chemical Gas-phase Deposition of Nanostructured Materials

Directory of Open Access Journals (Sweden)

Josef Pola

2009-03-01

Full Text Available Laser radiation-induced decomposition of gaseous organic selenides and tellurides resulting in chemical deposition of nanostructured materials on cold surfaces is reviewed with regard to the mechanism of the gas-phase decomposition and properties of the deposited materials. The laser photolysis and laser thermolysis of the Se and Te precursors leading to chalcogen deposition can also serve as a useful approach to nanostructured chalcogen composites and IVA group (Si, Ge, Sn element chalcogenides provided that it is carried out simultaneously with laser photolysis or thermolysis of polymer and IVA group element precursor.

Degradation mechanisms of Microcystin-LR during UV-B photolysis and UV/H2O2 processes: Byproducts and pathways.

Science.gov (United States)

Moon, Bo-Ram; Kim, Tae-Kyoung; Kim, Moon-Kyung; Choi, Jaewon; Zoh, Kyung-Duk

2017-10-01

The removal and degradation pathways of microcystin-LR (MC-LR, [M+H] +  = 995.6) in UV-B photolysis and UV-B/H 2 O 2 processes were examined using liquid chromatography-tandem mass spectrometry. The UV/H 2 O 2 process was more efficient than UV-B photolysis for MC-LR removal. Eight by-products were newly identified in the UV-B photolysis ([M+H] +  = 414.3, 417.3, 709.6, 428.9, 608.6, 847.5, 807.4, and 823.6), and eleven by-products were identified in the UV-B/H 2 O 2 process ([M+H] +  = 707.4, 414.7, 429.3, 445.3, 608.6, 1052.0, 313.4, 823.6, 357.3, 245.2, and 805.7). Most of the MC-LR by-products had lower [M+H] + values than the MC-LR itself during both processes, except for the [M+H] + value of 1052.0 during UV-B photolysis. Based on identified by-products and peak area patterns, we proposed potential degradation pathways during the two processes. Bond cleavage and intramolecular electron rearrangement by electron pair in the nitrogen atom were the major reactions during UV-B photolysis and UV-B/H 2 O 2 processes, and hydroxylation by OH radical and the adduct formation reaction between the produced by-products were identified as additional pathways during the UV-B/H 2 O 2 process. Meanwhile, the degradation by-products identified from MC-LR during UV-B/H 2 O 2 process can be further degraded by increasing H 2 O 2 dose. Copyright © 2017 Elsevier Ltd. All rights reserved.

Photolysis of Mono- and Dichloramines in UV/Hydrogen Peroxide: Effects on 1,4-Dioxane Removal and Relevance in Water Reuse.

Science.gov (United States)

Patton, Samuel; Romano, Mariano; Naddeo, Vincenzo; Ishida, Kenneth P; Liu, Haizhou

2018-06-05

Growing demands and increasing scarcity of fresh water resources necessitate potable water reuse, which has been implemented with the aid of UV-based advanced oxidation processes (UV/AOPs) that remove potentially hazardous trace organic contaminants from reclaimed water. During the potable reuse treatment process, chloramines are added to prevent membrane fouling that are carried over to the UV/AOP, where hydrogen peroxide (H 2 O 2 ) is commonly added. However, the impact of chloramines on the photolysis of H 2 O 2 and the overall performance of the UV/AOP remains unknown. This study investigated the impacts of the photochemistry of monochloramine (NH 2 Cl) and dichloramine (NHCl 2 ) associated with the photolysis of H 2 O 2 on the degradation of 1,4-dioxane (1,4-D), a trace organic contaminant ubiquitous in recycled water. Results indicated that NH 2 Cl and NHCl 2 alone functioned as oxidants upon UV photolysis, which produced HO • and Cl 2 •- as the two primary oxidative radicals. The speciation of chloramines did not have a significant impact on the degradation kinetics. The inclusion of monochloramine in UV/H 2 O 2 greatly decreased 1,4-D removal efficiency. HO • was the major radical in the mixed H 2 O 2 /chloramine system. Results from this study suggest that recognizing the existence of chloramines in UV/H 2 O 2 systems is important for predicting UV/AOP performance in the treatment train of potable reuse.

Flash photolysis-shock tube studies

Energy Technology Data Exchange (ETDEWEB)

Michael, J.V. [Argonne National Laboratory, IL (United States)

1993-12-01

Even though this project in the past has concentrated on the measurement of thermal bimolecular reactions of atomic species with stable molecules by the flash or laser photolysis-shock tube (FP- or LP-ST) method using atomic resonance absorption spectrometry (ARAS) as the diagnostic technique, during the past year the authors have concentrated on studies of the thermal decompositions of selected chlorocarbon molecules. These studies are necessary if the degradation of chlorine containing organic molecules by incineration are to be understood at the molecular level. Clearly, destruction of these molecules will not only involve abstraction reactions, when possible, but also thermal decomposition followed by secondary reactions of the initially formed atoms and radicals. Studies on the thermal decomposition of CH{sub 3}Cl are complete, and the curve-of-growth for Cl-atom atomic resonance absorption has been determined. The new thermal decomposition studies are similar to those already reported for CH{sub 3}Cl.

Inhibition of Neutral Red Photolysis with Different Antioxidants

Directory of Open Access Journals (Sweden)

Zlatan Rimpapa

2007-02-01

Full Text Available Neutral red is a dye the azine structure which has been used as an acido-base indicator and a dye in histochemistry. In 1960 Goldhaber introduced Neutral red into the medium of resorbing bone cultures to localize the osteoclast in the living cultures. Using time-lapse microcinematography in order to follow the osteoclasts, he reported excellent contrast could be obtained with Neutral red due to the avidity of osteoclasts for this dye. Unfortunately, however, the photodynamic effect resulting from subsequent exposure of these cultures to light precluded this approach, and again in 1963. it was observed that the death of the osteoclasts was probably due to a photodynamic effect related to the dye in the cell, the presence of oxygen and the frequent exposure of light by our time-lapse photography. VIS and UV irradiation induced photolysis of Neutral red, and from Neutral red cation produced with photons a Neutral red radical. This Neutral red radical can be inhibited with action of an antioxidant, such as melatonin, glutathione, ascorbic acid, E vitamin, etc. We developed an assay with Neutral redphotolysis which utilizes a VIS and UV irradiation technique for quantification the inhibition of photolysis with action of an antioxidant. In this method Neutral red acts double, as a free radical generator and as a photosensitizer.

Influence of satellite-derived photolysis rates and NOx emissions on Texas ozone modeling

Science.gov (United States)

Tang, W.; Cohan, D. S.; Pour-Biazar, A.; Lamsal, L. N.; White, A. T.; Xiao, X.; Zhou, W.; Henderson, B. H.; Lash, B. F.

2015-02-01

Uncertain photolysis rates and emission inventory impair the accuracy of state-level ozone (O3) regulatory modeling. Past studies have separately used satellite-observed clouds to correct the model-predicted photolysis rates, or satellite-constrained top-down NOx emissions to identify and reduce uncertainties in bottom-up NOx emissions. However, the joint application of multiple satellite-derived model inputs to improve O3 state implementation plan (SIP) modeling has rarely been explored. In this study, Geostationary Operational Environmental Satellite (GOES) observations of clouds are applied to derive the photolysis rates, replacing those used in Texas SIP modeling. This changes modeled O3 concentrations by up to 80 ppb and improves O3 simulations by reducing modeled normalized mean bias (NMB) and normalized mean error (NME) by up to 0.1. A sector-based discrete Kalman filter (DKF) inversion approach is incorporated with the Comprehensive Air Quality Model with extensions (CAMx)-decoupled direct method (DDM) model to adjust Texas NOx emissions using a high-resolution Ozone Monitoring Instrument (OMI) NO2 product. The discrepancy between OMI and CAMx NO2 vertical column densities (VCDs) is further reduced by increasing modeled NOx lifetime and adding an artificial amount of NO2 in the upper troposphere. The region-based DKF inversion suggests increasing NOx emissions by 10-50% in most regions, deteriorating the model performance in predicting ground NO2 and O3, while the sector-based DKF inversion tends to scale down area and nonroad NOx emissions by 50%, leading to a 2-5 ppb decrease in ground 8 h O3 predictions. Model performance in simulating ground NO2 and O3 are improved using sector-based inversion-constrained NOx emissions, with 0.25 and 0.04 reductions in NMBs and 0.13 and 0.04 reductions in NMEs, respectively. Using both GOES-derived photolysis rates and OMI-constrained NOx emissions together reduces modeled NMB and NME by 0.05, increases the model

The effect of clouds on photolysis rates and ozone formation in the unpolluted troposphere

Science.gov (United States)

Thompson, A. M.

1984-01-01

The photochemistry of the lower atmosphere is sensitive to short- and long-term meteorological effects; accurate modeling therefore requires photolysis rates for trace gases which reflect this variability. As an example, the influence of clouds on the production of tropospheric ozone has been investigated, using a modification of Luther's two-stream radiation scheme to calculate cloud-perturbed photolysis rates in a one-dimensional photochemical transport model. In the unpolluted troposphere, where stratospheric inputs of odd nitrogen appear to represent the photochemical source of O3, strong cloud reflectance increases the concentration of NO in the upper troposphere, leading to greatly enhanced rates of ozone formation. Although the rate of these processes is too slow to verify by observation, the calculation is useful in distinguishing some features of the chemistry of regions of differing mean cloudiness.

Nitrogen-Containing, Light-Absorbing Oligomers Produced in Aerosol Particles Exposed to Methylglyoxal, Photolysis, and Cloud Cycling.

Science.gov (United States)

De Haan, David O; Tapavicza, Enrico; Riva, Matthieu; Cui, Tianqu; Surratt, Jason D; Smith, Adam C; Jordan, Mary-Caitlin; Nilakantan, Shiva; Almodovar, Marisol; Stewart, Tiffany N; de Loera, Alexia; De Haan, Audrey C; Cazaunau, Mathieu; Gratien, Aline; Pangui, Edouard; Doussin, Jean-François

2018-04-03

Aqueous methylglyoxal chemistry has often been implicated as an important source of oligomers in atmospheric aerosol. Here we report on chemical analysis of brown carbon aerosol particles collected from cloud cycling/photolysis chamber experiments, where gaseous methylglyoxal and methylamine interacted with glycine, ammonium, or methylammonium sulfate seed particles. Eighteen N-containing oligomers were identified in the particulate phase by liquid chromatography/diode array detection/electrospray ionization high-resolution quadrupole time-of-flight mass spectrometry. Chemical formulas were determined and, for 6 major oligomer products, MS 2 fragmentation spectra were used to propose tentative structures and mechanisms. Electronic absorption spectra were calculated for six tentative product structures by an ab initio second order algebraic-diagrammatic-construction/density functional theory approach. For five structures, matching calculated and measured absorption spectra suggest that they are dominant light-absorbing species at their chromatographic retention times. Detected oligomers incorporated methylglyoxal and amines, as expected, but also pyruvic acid, hydroxyacetone, and significant quantities of acetaldehyde. The finding that ∼80% (by mass) of detected oligomers contained acetaldehyde, a methylglyoxal photolysis product, suggests that daytime methylglyoxal oligomer formation is dominated by radical addition mechanisms involving CH 3 CO*. These mechanisms are evidently responsible for enhanced browning observed during photolytic cloud events.

Isotopomer fractionation during photolysis of nitrous oxide by ultraviolet of 206 to 210 nm

International Nuclear Information System (INIS)

Toyoda, S.; Yoshida, N.; Suzuki, T.; Tsuji, K.; Shibuya, K.

2002-01-01

Nitrous oxide (N 2 O) is an important trace gas in the stratospheric chemistry as well as in the tropospheric radiative balance. Although there have been observations on the distribution of N 2 O in the atmosphere and its flux from individual sources, the global N 2 O budget is not fully understood. The isotopic information of N 2 O has been useful for constraining the N 2 O cycle since each source and sink has its own isotopic signature and isotope fractionation that is unique to the process. We have recently developed a method to determine isotopomers of N 2 O and showed that intramolecular distribution of 15 N is a parameter that has more fundamental and sensitive information than bulk 15 N abundance for constraining the atmospheric N 2 O budget. Here, we report the fractionation of isotopomers during ultraviolet photolysis of N 2 O in a 206 to 210 nm region. The fractionation factors are different among isotopomers and the site preference between two nitrogen isotopomers becomes larger along with the photolysis. The isotopomer fractionation factors of this representative wavelength are close to the apparent fractionation factors observed in the stratosphere indicating ultraviolet photolysis in the stratosphere is the dominant sink of N 2 O. Sources of atmospheric N 2 O including terrestrial and oceanic biological processes, agricultural activities, industrial formation and fossil fuel combustion are expected to be characterized to better constrain the global budget of N 2 O. (author)

Impacts of aerosol direct effects on tropospheric ozone through changes in atmospheric dynamics and photolysis rates

Science.gov (United States)

Xing, Jia; Wang, Jiandong; Mathur, Rohit; Wang, Shuxiao; Sarwar, Golam; Pleim, Jonathan; Hogrefe, Christian; Zhang, Yuqiang; Jiang, Jingkun; Wong, David C.; Hao, Jiming

2017-08-01

Aerosol direct effects (ADEs), i.e., scattering and absorption of incoming solar radiation, reduce radiation reaching the ground and the resultant photolysis attenuation can decrease ozone (O3) formation in polluted areas. One the other hand, evidence also suggests that ADE-associated cooling suppresses atmospheric ventilation, thereby enhancing surface-level O3. Assessment of ADE impacts is thus important for understanding emission reduction strategies that seek co-benefits associated with reductions in both particulate matter and O3 levels. This study quantifies the impacts of ADEs on tropospheric ozone by using a two-way online coupled meteorology and atmospheric chemistry model, WRF-CMAQ, using a process analysis methodology. Two manifestations of ADE impacts on O3 including changes in atmospheric dynamics (ΔDynamics) and changes in photolysis rates (ΔPhotolysis) were assessed separately through multiple scenario simulations for January and July of 2013 over China. Results suggest that ADEs reduced surface daily maxima 1 h O3 (DM1O3) in China by up to 39 µg m-3 through the combination of ΔDynamics and ΔPhotolysis in January but enhanced surface DM1O3 by up to 4 µg m-3 in July. Increased O3 in July is largely attributed to ΔDynamics, which causes a weaker O3 sink of dry deposition and a stronger O3 source of photochemistry due to the stabilization of the atmosphere. Meanwhile, surface OH is also enhanced at noon in July, though its daytime average values are reduced in January. An increased OH chain length and a shift towards more volatile organic compound (VOC)-limited conditions are found due to ADEs in both January and July. This study suggests that reducing ADEs may have the potential risk of increasing O3 in winter, but it will benefit the reduction in maxima O3 in summer.

Reaction of hydrogen atoms produced by radiolysis and photolysis in solid phase at 4 and 77 K

International Nuclear Information System (INIS)

Miyazaki, Tetsuo

1991-01-01

The behavior of H atoms in the solid phase has been reviewed with special attention to comparison of H atoms produced by radiolysis with those produced by photolysis. The paper consists of three parts. I -Production of H atoms: (1) the experimental results which indicate H-atom formation in the radiolysis of solid alkane are summarized; (2) ESR saturation behavior of trapped H atoms depends upon the method of H-atom-production, i.e. photolysis or radiolysis, and upon the initial energy of H atoms in the photolysis. II - Diffusion of H atoms: (1) activation energies for thermally-activated diffusion of H atoms are shown; (2) quantum diffusion of H atoms in solid H 2 is explained in terms of repetition of tunneling reaction H 2 + H → H + H 2 . III -Reaction of H atoms: (1) reactions and trapping processes of hot H atoms have been shown in solid methane and argon by use of hot H atoms with specified initial energy; (2) when H atoms are produced by the radiolysis of solvent alkane or by the photolysis of HI in the alkane mixtures at 77 K, the H atoms react very selectively with solute alkane at low concentration. The selective reaction of the H atom has been found in eight matrices; (3) activation energy for a hydrogen-atom-abstraction reaction by thermal H atoms at low temperatures is less than than several kJ mol -1 because of quantum tunneling. The absolute rate constants for H 2 (D 2 , HD) + H(D) tunneling reactions have been determined experimentally in solid hydrogen at 4.2K; (4) theoretical studies for tunneling reactions H 2 (D 2 ,HD) + H(D) at ultralow temperatures were reviewed. The calculated rate constants were compared with the rate constants obtained experimentally. (author)

Atmospheric fate of a series of carbonyl nitrates: photolysis frequencies and OH-oxidation rate constants.

Science.gov (United States)

Suarez-Bertoa, R; Picquet-Varrault, B; Tamas, W; Pangui, E; Doussin, J-F

2012-11-20

Multifunctional organic nitrates are potential NO(x) reservoirs whose atmospheric chemistry is somewhat little known. They could play an important role in the spatial distribution of reactive nitrogen species and consequently in ozone formation and distribution in remote areas. In this work, the rate constants for the reaction with OH radical and the photolysis frequencies of α-nitrooxyacetone, 3-nitrooxy-2-butanone, and 3-methyl-3-nitrooxy-2-butanone have been determined at room temperature at 1000 mbar total pressure of synthetic air. The rate constants for the OH oxidation were measured using the relative rate technique, with methanol as reference compound. The following rate constants were obtained for the reaction with OH: k(OH) = (6.7 ± 2.5) × 10(-13) cm(3) molecule(-1) s(-1) for α-nitrooxyacetone, (10.6 ± 4.1) × 10(-13) cm(3) molecule(-1) s(-1) for 3-nitrooxy-2-butanone, and (2.6 ± 0.9) × 10(-13) cm(3) molecule(-1) s(-1) for 3-methyl-3-nitrooxy-2-butanone. The corresponding photolysis frequencies extrapolated to typical atmospheric conditions for July first at noon at 40° latitude North were (4.8 ± 0.3) × 10(-5) s(-1), (5.7 ± 0.3) × 10(-5) s(-1), and (7.4 ± 0.2) × 10(-5) s(-1), respectively. The data show that photolysis is a major atmospheric sink for these organic nitrates.

Transients observed in the low temperature photolysis of alkyl radicals and divalent sulfur substrates

International Nuclear Information System (INIS)

Adam, F.C.

1976-01-01

The 253.7 nm photolysis of the isometric butyl radicals is described. These radicals are produced by electron capture during the γ-radiolysis of the corresponding butyl chlorides diluted in a rigid glass of 3-methylpentane-d14 at 77K. Thus t-butyl gives an equilibrium mixture of i-butyl and methyl radicals. Solvent radicals, M, are also produced and these obscure the former species in 3-MP-h14. Likewise sec-butyl radicals give rise to the ethyl, n-butyl, methyl and small amounts of the i-butyl radicals. Solvent radicals also rearrange and degrade in the photolytic beam, and the mechanism by which these processes occur is discussed. The procedure has also been used to study the formation and photolability of the alkyl thinyl and perthyl radicals occuring in the photolysis of RSH, RSR and RSSR. The thinyl radical is found to be unstable and gives the alkyl radical and atomic sulfur while the perthiyl radical is stable to radiation > 240 nm. (author)

Data acquisition and PV module power production in upgraded TEP/AzRISE solar test yard

Science.gov (United States)

Bennett, Whit E.; Fishgold, Asher D.; Lai, Teh; Potter, Barrett G.; Simmons-Potter, Kelly

2017-08-01

The Tucson Electric Power (TEP)/University of Arizona AzRISE (Arizona Research Institute for Solar Energy) solar test yard is continuing efforts to improve standardization and data acquisition reliability throughout the facility. Data reliability is ensured through temperature-insensitive data acquisition devices with battery backups in the upgraded test yard. Software improvements allow for real-time analysis of collected data, while uploading to a web server. Sample data illustrates high fidelity monitoring of the burn-in period of a polycrystalline silicon photovoltaic module test string with no data failures over 365 days of data collection. In addition to improved DAQ systems, precision temperature monitoring has been implemented so that PV module backside temperatures are routinely obtained. Weather station data acquired at the test yard provides local ambient temperature, humidity, wind speed, and irradiance measurements that have been utilized to enable characterization of PV module performance over an extended test period

Laboratory study of nitrate photolysis in Antarctic snow. II. Isotopic effects and wavelength dependence

Energy Technology Data Exchange (ETDEWEB)

Berhanu, Tesfaye A.; Erbland, Joseph; Savarino, Joël [Laboratoire de Glaciologie et Géophysique de l’Environnement, CNRS, F-38041 Grenoble (France); Univ. Grenoble Alpes, LGGE, F-38041 Grenoble (France); Meusinger, Carl; Johnson, Matthew S. [Copenhagen Center for Atmospheric Research (CCAR), Department of Chemistry, University of Copenhagen, Copenhagen (Denmark); Jost, Rémy [Laboratoire de Interdisciplinaire de Physique (LIPHY) Univ. de Grenoble, Grenoble (France); Bhattacharya, S. K. [Research Center for Environmental Changes, Academia Sinica, Nangang, Taipei 115, Taiwan (China)

2014-06-28

Atmospheric nitrate is preserved in Antarctic snow firn and ice. However, at low snow accumulation sites, post-depositional processes induced by sunlight obscure its interpretation. The goal of these studies (see also Paper I by Meusinger et al. [“Laboratory study of nitrate photolysis in Antarctic snow. I. Observed quantum yield, domain of photolysis, and secondary chemistry,” J. Chem. Phys. 140, 244305 (2014)]) is to characterize nitrate photochemistry and improve the interpretation of the nitrate ice core record. Naturally occurring stable isotopes in nitrate ({sup 15}N, {sup 17}O, and {sup 18}O) provide additional information concerning post-depositional processes. Here, we present results from studies of the wavelength-dependent isotope effects from photolysis of nitrate in a matrix of natural snow. Snow from Dome C, Antarctica was irradiated in selected wavelength regions using a Xe UV lamp and filters. The irradiated snow was sampled and analyzed for nitrate concentration and isotopic composition (δ{sup 15}N, δ{sup 18}O, and Δ{sup 17}O). From these measurements an average photolytic isotopic fractionation of {sup 15}ε = (−15 ± 1.2)‰ was found for broadband Xe lamp photolysis. These results are due in part to excitation of the intense absorption band of nitrate around 200 nm in addition to the weaker band centered at 305 nm followed by photodissociation. An experiment with a filter blocking wavelengths shorter than 320 nm, approximating the actinic flux spectrum at Dome C, yielded a photolytic isotopic fractionation of {sup 15}ε = (−47.9 ± 6.8)‰, in good agreement with fractionations determined by previous studies for the East Antarctic Plateau which range from −40 to −74.3‰. We describe a new semi-empirical zero point energy shift model used to derive the absorption cross sections of {sup 14}NO{sub 3}{sup −} and {sup 15}NO{sub 3}{sup −} in snow at a chosen temperature. The nitrogen isotopic fractionations obtained by applying

Aerosol formation on the flash photolysis of SO2/gas mixtures

International Nuclear Information System (INIS)

Fogel, L.D.; Sutherland, J.W.

1979-01-01

A long-lived transient absorption observed on the flash photolysis of SO 2 /gas mixtures at lambda> or =190 nm has been identified as resulting from light scattering by H 2 SO 4 aerosols. No detectable signals were monitored on photolysis at lambda> or =270 nm, indicating that the aerosol precursors originated from the promotion of SO 2 into its second singlet level and into its dissociation continuum. The SO 3 that was formed was hydrated immediately to yield H 2 SO 4 vapor in a highly supersaturated state and heteromolecular homogeneous nucleation to produce H 2 SO 4 aerosols ensued. This nucleation was quenched rapidly as the acid vapor was consumed by further nucleation, by condensation, and by vapor diffusion to the cell walls. A model was formulated in which the condensations of the H 2 SO 4 and the H 2 O vapors on the growing droplets were considered kinetically negligible and the particles grew by coagulation; simultaneously, they were lost by tranquil gravitational settling and by diffusion to the cell walls. Computer simulations demonstrated that the observed time dependence of the absorbance data (measured at a fixed wavelength) could be accounted for by this scheme. The effects of temperature, pressure, and wavelength (of the analyzing light) were also described satisfactorily by this model

Oxidation of Cu(II) aminopolycarboxylates by carbonate radical. A flash photolysis study

International Nuclear Information System (INIS)

Mandal, P.C.; Bardhan, D.K.

1999-01-01

Reactions of carbonate radical (CO 3 -. ) generated by photolysis or by radiolysis of a carbonate solution, with Cu(II) complexes of aminopolycarboxylic acids viz., Cu(II)ethylenediamine tetraacetate [Cu II EDTA] 2- and Cu(II)-iminodiacetate [Cu II IDA] were studied at pH 10.5 and ionic strength 0.2 mol x dm -3 . Time-resolved spectroscopy and kinetics for the transients were studied using flash photolysis and stable products arising from the ligand degradation of the complex were ascertained by steady-state radiolysis experiments. From the kinetic data it is observed that CO 3 -. radical reacts initially with Cu II -complex to form a transient intermediate having maximum absorption at 335 nm and 430 nm. From the subsequent reactions of this intermediate it was assigned to be Cu III .species. This Cu(III) species undergoes intermolecular electron transfer with the Cu II -complex to give a radical intermediate which again slowly reacts with Cu II -complex to give a long lived species containing Cu-C bond. This long lived species, however, slowly decomposed to give glyoxalic reaction between Cu III -complex and a suitable donor, the one electron reduction potential for [Cu III EDTA] 1- /[Cu II EDTA] 2- and [Cu III IDA] +1 /Cu II IDA was determined. (author)

Snow nitrate photolysis in polar regions and the mid-latitudes: Impact on boundary layer chemistry and implications for ice core records

Science.gov (United States)

Zatko, Maria C.

The formation and recycling of nitrogen oxides (NOx=NO+NO 2) associated with snow nitrate photolysis has important implications for air quality and the preservation of nitrate in ice core records. This dissertation examines snow nitrate photolysis in polar and mid-latitude regions using field and laboratory based observations combined with snow chemistry column models and a global chemical transport model to explore the impacts of snow nitrate photolysis on boundary layer chemistry and the preservation of nitrate in polar ice cores. Chapter 1 describes how a global chemical transport model is used to calculate the photolysis-driven flux and redistribution of nitrogen across Antarctica, and Chapter 2 presents similar work for Greenland. Snow-sourced NOx is most dependent on the quantum yield for nitrate photolysis as well as the concentration of photolabile nitrate and light-absorbing impurities (e.g., black carbon, dust, organics) in snow. Model-calculated fluxes of snow-sourced NOx are similar in magnitude in Antarctica (0.5--7.8x108 molec cm-2 s -1) and Greenland (0.1--6.4x108 molec cm-2 s-1) because both nitrate and light-absorbing impurity concentrations in snow are higher (by factors of 2 and 10, respectively) in Greenland. Snow nitrate photolysis influences boundary layer chemistry and ice-core nitrate preservation less in Greenland compared to Antarctica largely due to Greenland's proximity to NOx-source regions. Chapter 3 describes how a snow chemistry column model combined with chemistry and optical measurements from the Uintah Basin Winter Ozone Study (UBWOS) 2014 is used to calculate snow-sourced NOx in eastern Utah. Daily-averaged fluxes of snow-sourced NOx (2.9x10 7--1.3x108 molec cm-2 s-1) are similar in magnitude to polar snow-sourced NO x fluxes, but are only minor components of the Uintah Basin boundary layer NOx budget and can be neglected when developing ozone reduction strategies for the region. Chapter 4 presents chemical and optical

Photolysis study of octyl p-methoxycinnamate loaded microemulsion by molecular fluorescence and chemometric approach

Science.gov (United States)

Nascimento, Danielle Silva; Insausti, Matías; Band, Beatriz Susana Fernández; Grünhut, Marcos

2018-02-01

Octyl p-methoxycinnamate (OMC) is one of the most widely used sunscreen agents. However, the efficiency of OMC as UV filter over time is affected due to the formation of the cis-isomer which presents a markedly lower extinction coefficient (εcis = 12,600 L mol- 1 cm- 1 at 291 nm) than the original trans-isomer (εtrans = 24,000 L mol- 1 cm- 1 at 310 nm). In this work, a novel carrier for OMC based on an oil-in-water microemulsion is proposed in order to improve the photostability of this sunscreen. The formulation was composed of 29.2% (w/w) of a 3:1 mixture of ethanol (co-surfactant) and decaethylene glycol mono-dodecyl ether (surfactant), 1.5% (w/w) of oleic acid (oil phase) and 69.2% (w/w) of water. This microemulsion was prepared in a simple way, under moderate stirring at 25 °C and using acceptable, biocompatible and accessible materials for topical use. OMC was incorporated in the vehicle at a final concentration of 5.0% (w/w), taking into account the maximum permitted levels established by international norms. Then, a photolysis study of the loaded formulation was performed using a continuous flow system. The direct photolysis was monitored over time by molecular fluorescence. The recorded spectra data between 370 y 490 nm were analyzed by multivariate curve resolution-alternating least squares algorithm. The kinetic rate constants corresponding to the photolysis of the trans-OMC were calculated from the concentration profiles, resulting in 0.0049 s- 1 for the trans-OMC loaded microemulsion and 0.0131 s- 1 for the trans-OMC in aqueous media. These results demonstrate a higher photostability of the trans-OMC when loaded in the proposed vehicle with respect to the free trans-OMC in aqueous media.

Effect of nitrate, carbonate/bicarbonate, humic acid, and H2O2 on the kinetics and degradation mechanism of Bisphenol-A during UV photolysis.

Science.gov (United States)

Kang, Young-Min; Kim, Moon-Kyung; Zoh, Kyung-Duk

2018-08-01

In this study, the effects of natural water components (nitrate, carbonate/bicarbonate, and humic acid) on the kinetics and degradation mechanisms of bisphenol A (BPA) during UV-C photolysis and UV/H 2 O 2 reaction were examined. The presence of NO 3 - (0.04-0.4 mM) and CO 3 2- /HCO 3 - (0.4-4 mM) ions increased BPA degradation during UV photolysis. Humic acid less than 3 mg/L promoted BPA degradation, but greater than 3 mg/L of humic acid inhibited BPA degradation. During the UV/H 2 O 2 reaction, all water matrix components acted as radical scavengers in the order of humic acid > CO 3 2- /HCO 3 -  > NO 3 - . All of the degradation reactions agreed with the pseudo-first-order kinetics. While eight byproducts (m/z = 122, 136, 139, 164, 181, 244, 273, 289) were identified in UV-C/NO 3 - photolysis reaction, four (m/z = 122, 136, 164, 244) and three byproducts (m/z = 122, 136, 164) were observed during UV-C/NO 3 - /CO 3 2- /HCO 3 - and UV-C/CO 3 2- /HCO 3 - reactions. Nitrogenated and hydrogenated byproducts were first observed during the UV-C/NO 3 - photolysis, but only hydrogenated byproducts as adducts were detected during the UV-C/NO 3 - /CO 3 2- /HCO 3 - photolysis. Nitrogenated and hydrogenated byproducts were formed in the early stage of degradation by OH or NO 2 radicals, and these byproducts were subsequently degraded into smaller compounds with further reaction during UV-C/NO 3 - and UV-C/NO 3 - /CO 3 2- /HCO 3 - reactions. In contrast, BPA was directly degraded into smaller compounds by β-scission of the isopropyl group by CO 3 - /HCO 3 radicals during UV-C/CO 3 2- /HCO 3 - reaction. Our results imply that the water components can change the degradation mechanism of BPA during UV photolysis. Copyright © 2018 Elsevier Ltd. All rights reserved.

Spinal anesthesia is safe in laparoscopic total extraperitoneal inguinal hernia repair. A retrospective clinical trial.

Science.gov (United States)

Yildirim, Dogan; Hut, Adnan; Uzman, Sinan; Kocakusak, Ahmet; Demiryas, Suleyman; Cakir, Mikail; Tatar, Cihad

2017-12-01

Laparoscopic total extraperitoneal (TEP) inguinal hernia repair is an effective and safe method for the treatment of inguinal hernia. There are very few studies on regional anesthesia methods in TEP surgery. To compare TEP inguinal hernia repair performed when the patient was treated under spinal anesthesia (SA) with that performed under general anesthesia (GA). All total of 80 patients were studied between December 2015 and March 2017. Hyperbaric bupivacaine and fentanyl were used for SA, to achieve a sensorial level of T3. Propofol, sevoflurane, rocuronium, fentanyl, and tracheal intubation were used for GA. Intraoperative events related to SA, surgical times, intra- and postoperative complications, and pain scores were recorded. The mean operative time in the SA TEP group was 70.2 ±6.7 min, which was significantly longer than the mean operative time in the GA TEP group of 67.2 ±6.2 min (p < 0.038). The mean pain scores in the SA TEP group were 0.23 ±0.42 at the first hour, 1.83 ±0.64 at 6 h and 1.28 ±0.45 at 24 h. These scores were significantly lower than the corresponding scores of 5.18 ±0.84 (p < 0.001), 2.50 ±0.55 (p < 0.001) and 1.58 ±0.55 in the GA TEP group. Generally, patients were more satisfied with SA than GA (p < 0.004). Spinal anesthesia TEP is significantly less painful in the early postoperative period, leading to earlier ambulation than GA TEP. Additionally, SA TEP results in significantly less need for analgesics and better patient satisfaction results. SA TEP seems to be a better alternative than the existing GA TEP.

The in vitro photolysis of whole rat lenses using focused 290nm laser radiation

International Nuclear Information System (INIS)

Hibbard, L.B.; Kirk, N.J.; Borkman, R.F.

1985-01-01

Whole rat lenses have been irradiated with a UV laser at 290 or 298 nm focused to a 0.08 mm diameter spot. The irradiated spot was analyzed using fluorescence spectroscopy and it was observed that the intensity of fluorescence fell as the irradiation proceeded. These observations were interpreted in terms of a model which postulates photolysis of tryptophan, primarily present as residues in lens proteins, and formation of photoproducts which absorb the UV laser radiation to an ever-increasing extent as the irradiation proceeds. Evidence is also presented which indicates that an observed fast component of the tryptophan fluorescence decay results from local heating of the lens tissues due to energy dissipation by the laser. Tryptophan residues can be photolyzed by UV light in the whole lens, in vitro, in a fashion entirely analogous to that reported previously only for lens protein solutions. The photochemical behavior of lens protein solutions is relevant to whole lens photolysis and no special protective mechanism appears to be operative in the intact organ. (author)

Internal reflection flash photolysis study of the photochemistry of eosin at TiO sub 2 semiconductor electrodes

Energy Technology Data Exchange (ETDEWEB)

Ryan, M.A.; Fitzgerald, E.C.; Spitler, M.T. (Polaroid Corp., Cambridge, MA (USA))

1989-08-10

It is shown that the photoelectrochemical data on eosin Y sensitized TiO{sub 2} single-crystal electrodes cannot be interpreted unambiguously without concomitant data from flash photolysis measurements on this system. By use of a combination of internal reflection spectroscopy and laser flash photolysis, electron exchange with TiO{sub 2} was observed for the excited singlet state, the triplet state, and the cation radical of the dye. With a temporal resolution of 100 ns, the kinetics of the charge transfer are compared with those of the dye in solution and used to interpret the photoelectrochemistry of the dye at the electrode. Spectroscopic evidence revealed photocurrent production by the triplet state and a reduction of the eosin cation radical by electrons from the TiO{sub 2} conduction band and by hydroquinone.

Impacts of aerosol direct effects on tropospheric ozone through changes in atmospheric dynamics and photolysis rates

Science.gov (United States)

Aerosol direct effects (ADE), i.e., scattering and absorption of incoming solar radiation, reduce radiation reaching the ground and the resultant photolysis attenuation can decrease O3 formation in polluted areas. One the other hand, evidence also suggests that ADE associated coo...

Investigation of N2O Production from 266 and 532 nm Laser Flash Photolysis of O3/N2/O2 Mixtures

Science.gov (United States)

Estupinan, E. G.; Nicovich, J. M.; Li, J.; Cunnold, D. M.; Wine, P. H.

2002-01-01

Tunable diode laser absorption spectroscopy has been employed to measure the amount of N2O produced from laser flash photolysis of O3/N2/O2 mixtures at 266 and 532 nm. In the 532 nm photolysis experiments very little N2O is observed, thus allowing an upper limit yield of 7 x 10(exp -8) to be established for the process O3 + N2 yield N2O + O2, where O3 is nascent O3 that is newly formed via O(3P(sub J)) + O2 recombination (with vibrational excitation near the dissociation energy of O3). The measured upper limit yield is a factor of approx. 600 smaller than a previous literature value and is approximately a factor of 10 below the threshold for atmospheric importance. In the 266 nm photolysis experiments, significant N2O production is observed and the N2O quantum yield is found to increase linearly with pressure over the range 100 - 900 Torr in air bath gas. The source of N2O in the 266 nm photolysis experiments is believed to be the addition reaction O(1D(sub 2)) + N2 + M yields (k(sub sigma)) N2O + M, although reaction of (very short-lived) electronically excited O3 with N2 cannot be ruled out by the available data. Assuming that all observed N2O comes from the O(1D(sub 2)) + N2 + M reaction, the following expression describes the temperature dependence of k(sub sigma) (in its third-order low-pressure limit) that is consistent with the N2O yield data: k(sub sigma) = (2.8 +/- 0.1) x 10(exp -36)(T/300)(sup -(0-88+0.36)) cm(sup 6) molecule(sup -2)/s, where the uncertainties are 2(sigma) and represent precision only. The accuracy of the reported rate coefficients at the 95% confidence level is estimated to be 30 - 40% depending on the temperature. Model calculations suggest that gas phase processes initiated by ozone absorption of a UV photon represent about 1.4% of the currently estimated global source strength of atmospheric N2O. However, these processes could account for a significant fraction of the oxygen mass-independent enrichment observed in atmospheric N2O, and

Study of the selective abstration reaction of the hydrogen atom in the radiolysis and photolysis of alkane mixture at 77 K

International Nuclear Information System (INIS)

Guedes, S.M.L.

1979-01-01

The occurence of the selective abstraction reaction of the solute hydrogen atom by hydrogen atom produced during radiolysis or photolysis of the systems such as neopentane/cyclo-hexane/HI, neopentane/2,3 dimethylbutane, n-pentane/HI/cyclo-hexane and cyclo-hexane/HI/n-pentane, at 77 K is studied. Experiments have been undertaken on the kinetics nature of the active species, the H atom, during radiolysis and photolysis of the neopentane/cyclo-hexane/HI system at 77 K, presenting competitive reactions. Studies have also been made on the occurrence of the selective abstraction reaction in inverted systems, in which the concentrations of the components of a system are so much altered that the solute becomes the solvent and vice-versa, in the other system. By means of photolysis at 77 K, it has been observed that for the two systems constitued by the cyclo-hexane and n-pentane the selective abstraction reaction occurs. However, for radiolysis of that same two systems it has been observed that only the hydrogen atom abstraction reaction corresponding to the solvent occurs. (Author) [pt

Degradation of Paracetamol by Photolysis Using C-N-codoped TiO2

OpenAIRE

Vanny Yulia Safitri; Adlis Santoni; Diana Vanda Wellia; Khoiriah Khoiriah; Safni Safni

2017-01-01

Paracetamol is generally used as analgesic and antipyretic drugs. Contamination paracetamol in the environment can occur because of waste material disposal from production site and immediate disposal of household that cause water pollution. Paracetamol is degraded by photolysis method under irradiation 10 watt UV-light (λ=365 nm), visible-light (Philips LED 13 watt 1400 lux) and solar-light with and without addition C-N-codoped TiO2catalyst. The solution is analyzed by UV-Vis spectrophotomete...

Biogeochemical significance of transport exopolymer particles in the Indian Ocean

Digital Repository Service at National Institute of Oceanography (India)

DileepKumar, M.; Sarma, V.V.S.S.; Ramaiah, N.; Gauns, M.; DeSousa, S.N.

was found between waters of the Arabian Sea and the Bay of Bengal. The TEP concentrations were lower in the Bay of Bengal due to faster scavenging from water column because of interaction with mineral particles. They were higher and occurred even in intense...

The role of direct photolysis and indirect photochemistry in the environmental fate of ethylhexyl methoxy cinnamate (EHMC) in surface waters

International Nuclear Information System (INIS)

Vione, D.; Calza, P.; Galli, F.; Fabbri, D.; Santoro, V.; Medana, C.

2015-01-01

The aquatic environmental fate of ethylhexyl methoxy cinnamate (EHMC), one of the most used UVB filters worldwide, was studied by assessing its environmental persistence and photoinduced transformations. The role of direct and indirect photolysis was evaluated. Direct photolysis was shown to play a key role, and this process is expected to be the main attenuation route of EHMC in sunlit surface waters. In contrast, the reaction with ·OH radicals would be negligible and that with "3CDOM* would at most be a secondary process. The measurement of the quantum yield of direct photolysis and of the rate constants of reaction with photogenerated transient species (or, sometimes, the use of reasonable values for the latter) allowed the prediction of the EHMC half-life time in surface waters, by means of a validated photochemical model. The predicted EHMC lifetime is of the order of hours to a few days in fair-weather summertime, and the main factors controlling the EHMC phototransformation in sunlit surface waters would be the water depth and the dissolved organic carbon (DOC) content. The formation of transformation products (TPs) was followed as well via HPLC/HRMS. Three TPs were detected in the samples exposed to UVA radiation, while one additional TP was detected in the samples exposed to UVB radiation. The detected TPs comprised 4-methoxybenzaldehyde, a hydroxylated derivative and dimeric species. Through the use of heterogeneous photocatalysis with TiO_2, seven additional TPs were identified, most of them resulting from the further degradation of primary TPs formed through direct photolysis and that might be detected in aquatic systems as well. The photodegradation of EHMC in the presence of TiO_2 yielded more toxic TPs than the parent compound (as determined with the Vibrio fischeri Microtox assay). The increased toxicity is partially accounted for by the formation of 4-methoxybenzaldehyde. - Highlights: • Study of the photolytic and photocatalytic transformation

The role of direct photolysis and indirect photochemistry in the environmental fate of ethylhexyl methoxy cinnamate (EHMC) in surface waters

Energy Technology Data Exchange (ETDEWEB)

Vione, D. [Department of Chemistry, University of Torino, via P. Giuria 5, 10125 Torino (Italy); Calza, P., E-mail: paola.calza@unito.it [Department of Chemistry, University of Torino, via P. Giuria 5, 10125 Torino (Italy); Galli, F.; Fabbri, D. [Department of Chemistry, University of Torino, via P. Giuria 5, 10125 Torino (Italy); Santoro, V.; Medana, C. [Department of Molecular Biotechnology and Health Sciences, University of Torino, via P. Giuria 5, 10125 Torino (Italy)

2015-12-15

The aquatic environmental fate of ethylhexyl methoxy cinnamate (EHMC), one of the most used UVB filters worldwide, was studied by assessing its environmental persistence and photoinduced transformations. The role of direct and indirect photolysis was evaluated. Direct photolysis was shown to play a key role, and this process is expected to be the main attenuation route of EHMC in sunlit surface waters. In contrast, the reaction with ·OH radicals would be negligible and that with {sup 3}CDOM* would at most be a secondary process. The measurement of the quantum yield of direct photolysis and of the rate constants of reaction with photogenerated transient species (or, sometimes, the use of reasonable values for the latter) allowed the prediction of the EHMC half-life time in surface waters, by means of a validated photochemical model. The predicted EHMC lifetime is of the order of hours to a few days in fair-weather summertime, and the main factors controlling the EHMC phototransformation in sunlit surface waters would be the water depth and the dissolved organic carbon (DOC) content. The formation of transformation products (TPs) was followed as well via HPLC/HRMS. Three TPs were detected in the samples exposed to UVA radiation, while one additional TP was detected in the samples exposed to UVB radiation. The detected TPs comprised 4-methoxybenzaldehyde, a hydroxylated derivative and dimeric species. Through the use of heterogeneous photocatalysis with TiO{sub 2}, seven additional TPs were identified, most of them resulting from the further degradation of primary TPs formed through direct photolysis and that might be detected in aquatic systems as well. The photodegradation of EHMC in the presence of TiO{sub 2} yielded more toxic TPs than the parent compound (as determined with the Vibrio fischeri Microtox assay). The increased toxicity is partially accounted for by the formation of 4-methoxybenzaldehyde. - Highlights: • Study of the photolytic and photocatalytic

Solvent effects on the photochemistry of dimethyl sulfoxide-Cl complexes studied by combined pulse radiolysis and laser flash photolysis

International Nuclear Information System (INIS)

Sumiyoshi, Takashi; Minegishi, Hideki; Fujiyoshi, Ryoko; Sawamura, Sadashi

2006-01-01

Photolysis of complexes of dimethyl sulfoxide (DMSO) with chlorine atoms results in rapid and permanent photobleaching which may be due to intramolecular hydrogen abstraction. The effects of solvent polarity were examined in a wide variety of DMSO-carbon tetrachloride mixed solvents. The quantum yields of photobleaching decreased from 0.27 to 0.08 as the solvent polarity increased, while significant changes were observed in the low DMSO concentration range ( -3 ). This cannot be accounted for by simple solvent polarity effects. The effects of polar and nonpolar additives were also examined and it is concluded that the specific solvation effect of DMSO was the main cause of the significant change in quantum yields in the low concentration range of DMSO

Construction of a flash-photolysis apparatus having a short discharge time

International Nuclear Information System (INIS)

Devillers, C.

1964-01-01

Flash photolysis aims at reaching directly the primary mechanisms resulting from the action of light on an absorbent matter. This makes it necessary to produce a flash as short and as bright as possible. Our main effort was directed towards reducing the duration of the flash by decreasing the self-inductance of the discharge circuit. A description of this circuit and study of the characteristics of the apparatus are followed by a short description of the two analytical methods: flash spectrography and absorption spectrophotometry at a given wave-length. (author) [fr

Chemistry of bifunctional photoprobes. 3 -- Correlation between the efficiency of CH insertion by photolabile chelating agents and lifetimes of singlet nitrenes by flash photolysis: First example of photochemical attachment of 99mTc-complex with human serum albumin

International Nuclear Information System (INIS)

Pandurangi, R.S.; Lusiak, P.; Kuntz, R.R.; Volkert, W.A.; Rogowski, J.; Platz, M.S.

1998-01-01

Systematic functionalization of perfluoroaryl azides with chelating agents capable of complexing transition metals produces a new class of bifunctional photolabile chelating agents (BFPCAs). The strategy is shield the azide functionality from the electronic and steric influence of the electron-rich metal Pd through ester and amide bridges raised CH insertion efficiency to unprecedented levels (>92%) in a model solvent (cyclohexane). In contrast, perfluoroaryl azides attached to chelating agents via hydrazones show no significant CH insertion in cyclohexane upon photolysis. Measurements of the lifetimes of the singlet nitrenes derived from these agents by flash photolysis techniques correlate well with the efficiency of CH insertion by demonstrating longer lifetimes (10--50 times) for singlet nitrenes derived from azidotetrafluorinated esters and amides compared with the related hydrazones, which failed to yield significant CH insertion. A representative BFPCA 12 is chelated to diagnostic radionuclide 99m Tc and covalently attached to human serum albumin via photochemical activation extending the favorable bimolecular insertion characteristics of BFPCA to tracer level concentrations in buffer conditions. Flash photolysis experiments correlate singlet nitrene lifetimes with the efficiency of intermolecular insertion reactions. This work provides new photo-cross-linking technology, useful in radiodiagnostics and radiotherapy in nuclear medicine

Investigation of local optical inhomogeneities in flashlamp photolysis lasers

Energy Technology Data Exchange (ETDEWEB)

Alekhin, B V; Borovkov, V V; Lazhintsev, B V; Nor-Arenian, V A; Sukhanov, L V; Ustinenko, V A

1979-09-01

Local changes in the refractive index which occur in the active medium under flashlamp-excited photolysis laser action are examined experimentally. Under conditions of the inverse population storage and suppression of the laser action by a strong quencher, local inhomogeneities have been absent. It is shown that the stimulated emission is inhomogeneous over the active medium and features regular character with the radiation density modulation within 20-30 percent and with typical size of inhomogeneities of not greater than 0.5 mm. On the basis of experimental results and estimation, a conclusion is drawn that the local optical inhomogeneities are caused by gasdynamic displacements of the gas due to different heat evolutions in the regions of the radiation density maximum and minimum.

Laser flash-photolysis and gas discharge in N2O-containing mixture: kinetic mechanism

Science.gov (United States)

Kosarev, Ilya; Popov, Nikolay; Starikovskaia, Svetlana; Starikovskiy, Andrey; mipt Team

2011-10-01

The paper is devoted to further experimental and theoretical analysis of ignition by ArF laser flash-photolysis and nanosecond discharge in N2O-containing mixture has been done. Additional experiments have been made to assure that laser emission is distributed uniformly throughout the cross-section. The series of experiments was proposed and carried out to check validity of O(1D) determination in experiments on plasma assisted ignition initiated by flash-photolysis. In these experiments, ozone density in the given mixture (mixture composition and kinetics has been preliminary analyzed) was measured using UV light absorption in Hartley band. Good coincidence between experimental data and results of calculations have been obtained Temporal behavior of energy input, electric field and electric current has been measured and analyzed. These data are considered as initial conditions for numerical modeling of the discharge in O2:N2O:H2:Ar = 0.3:1:3:5 mixture. Ion-molecular reactions and reactions of active species production in Ar:H2:O2:N2O mixture were analyzed. The set of reactions to describe chemical transformation in the system due to the discharge action has been selected.

Synchronization modulation increases transepithelial potentials in MDCK monolayers through Na/K pumps.

Directory of Open Access Journals (Sweden)

Vu Tran

Full Text Available Transepithelial potential (TEP is the voltage across a polarized epithelium. In epithelia that have active transport functions, the force for transmembrane flux of an ion is dictated by the electrochemical gradient in which TEP plays an essential role. In epithelial injury, disruption of the epithelial barrier collapses the TEP at the wound edge, resulting in the establishment of an endogenous wound electric field (∼100 mV/mm that is directed towards the center of the wound. This endogenous electric field is implicated to enhance wound healing by guiding cell migration. We thus seek techniques to enhance the TEP, which may increase the wound electric fields and enhance wound healing. We report a novel technique, termed synchronization modulation (SM using a train of electric pulses to synchronize the Na/K pump activity, and then modulating the pumping cycles to increase the efficiency of the Na/K pumps. Kidney epithelial monolayers (MDCK cells maintain a stable TEP and transepithelial resistance (TER. SM significantly increased TEP over four fold. Either ouabain or digoxin, which block Na/K pump, abolished SM-induced TEP increases. In addition to the pump activity, basolateral distribution of Na/K pumps is essential for an increase in TEP. Our study for the first time developed an electrical approach to significantly increase the TEP. This technique targeting the Na/K pump may be used to modulate TEP, and may have implication in wound healing and in diseases where TEP needs to be modulated.

Aqueous-phase photochemical oxidation and direct photolysis of vanillin - a model compound of methoxy phenols from biomass burning

Science.gov (United States)

Li, Y. J.; Huang, D. D.; Cheung, H. Y.; Lee, A. K. Y.; Chan, C. K.

2014-03-01

We present here experimental results on aqueous-phase (A) photochemical oxidation (with UV and OH radicals generated from H2O2 photolysis) and (B) direct photolysis (with only UV irradiation) of a methoxy phenol, vanillin (VL), as a model compound from biomass burning. Both on-line aerosol mass spectrometric (AMS) characterization and off-line chemical analyses were performed. AMS analyses of dried atomized droplets of the bulk reacting mixtures showed that VL almost entirely evaporates during the drying process. Large amounts of organic mass remained in the particle phase after reactions under both conditions. Under condition (A), AMS measured organic mass first increased rapidly and then decreased, attributable to the formation of non-volatile products and subsequent formation of smaller and volatile products, respectively. The oxygen-to-carbon (O : C) ratio of the products reached 1.5 after about 80 min, but dropped substantially thereafter. In contrast, organic mass increased slowly under condition (B). The O : C ratio reached 1.0 after 180 min. In off-line analyses, small oxygenates were detected under condition (A), while hydroxylated products and dimers of VL were detected under condition (B). Particle hygroscopic growth factor (GF) and cloud condensation nuclei (CCN) activity of the reacting mixtures were found to depend on both organic volume fraction and the degree of oxygenation of organics. Results show that (1) aqueous-phase processes can lead to the retention of a large portion of the organic mass in the particle phase; (2) once retained, this portion of organic mass significantly changes the hygroscopicity and CCN activity of the aerosol particles; (3) intensive photochemical oxidation gave rise to an O : C ratio as high as 1.5 but the ratio decreased as further oxidation led to smaller and more volatile products; and (4) polymerization occurred with direct photolysis, resulting in high-molecular-weight products of a yellowish color. This study

Aqueous-phase photochemical oxidation and direct photolysis of vanillin - a model compound of methoxy-phenols from biomass burning

Science.gov (United States)

Li, Y. J.; Huang, D. D.; Cheung, H. Y.; Lee, A. K. Y.; Chan, C. K.

2013-10-01

We present here experimental results on aqueous-phase (A) photochemical oxidation (with UV and OH radicals generated from H2O2 photolysis) and (B) direct photolysis (with only UV irradiation) of a methoxy-phenol, vanillin (VL), as a model compound from biomass burning. Both on-line aerosol mass spectrometric (AMS) characterization and off-line chemical analyses were performed. AMS analyses of dried atomized droplets of the bulk reacting mixtures showed that VL almost entirely evaporates during the drying process. Large amounts of organic mass remained in the particle phase after reactions under both conditions. Under condition (A), AMS measured organic mass first increased rapidly and then decreased, attributable to the formation of non-volatile products and subsequent formation of smaller and volatile products, respectively. The oxygen-to-carbon (O:C) ratio of the products reached 1.5 after about 80 min, but dropped substantially thereafter. In contrast, organic mass increased slowly under condition (B). The O:C ratio reached 1.0 after 180 min. In off-line analyses, small oxygenates were detected under condition (A), while hydroxylated products and dimers of VL were detected under condition (B). Particle hygroscopic growth factor (GF) and cloud condensation nuclei (CCN) activity of the reacting mixtures were found to be dependent on both organic volume fraction and the degree of oxygenation of organics. Results show that (1) aqueous-phase processes can lead to the retention of a large portion of the organic mass in the particle phase; (2) once retained, this portion of organic mass significantly changes the hygroscopicity and CCN activity of the aerosol particles; (3) intensive photochemical oxidation gave rise to an O:C ratio as high as 1.5 but the ratio decreased as further oxidation led to smaller and more volatile products; and (4) polymerization occurred with direct photolysis, resulting in high-molecular-weight products of a yellowish color. This study

Prompt and delayed excitation and photolysis of cesium dimers

International Nuclear Information System (INIS)

Davanloo, F.; Collins, C.B.; Inamdar, A.S.; Mehendale, N.Y.; Nagvi, A.S.

1984-01-01

In this work a time-delayed, double resonance technique was used for the study of the state selective photolysis of Cs 2 excited in the yellow range of visible wavelengths. Particular attention being placed on the production of the fine structure components of the 5 2 D and 6 2 P states of Cs and upon the lifetimes of the product populations in the cesium vapor. A quantitative model was constructed to fit the data and rate coefficients were extracted for processes tending to attenuate the product state selectivity. Reported here is what appears to be the first value for the fine-structure mixing cross section for Cs(5 2 D5/2 → 5 2 D 3 /sub 3/2/) of 17 A 2 +-50%, close to the geometric cross section

Gas phase radiolysis and vacuum ultraviolet photolysis of heterocyclic organic compounds. Progress report, February 1, 1974--February 1, 1975

International Nuclear Information System (INIS)

Scala, A.A.; Salomon, D.; Colon, I.; D'Angona, J.

1975-01-01

In the γ radiolysis of tetrahydrofuran there are pronounced density effects in the pressure range from 0 to 50 Torr with the most important ion-pair yields decreasing as the pressure increases. The relative product yields of the radiolysis is compared with that of xenon photolysis. Possible mechanisms to explain the results obtained are discussed. The ion-pair yields from the γ radiolysis of the heterocyclic amines, ethylenimine, azetidine, pyrrolidine, and piperidine, are determined, and the pressure effects are evaluated. Reactions mechanisms are discussed. The vacuum ultraviolet photolysis products of thietane and tetrahydrothiophene are studied and compared with the γ radiolysis products. Reaction mechanisms are discussed. The status of the construction of a photoionization mass spectrometer and the measurement of the ionization efficiencies and extinction coefficients of organic compounds is reported. (U.S.)

Degradation of acetic acid with sulfate radical generated by persulfate ions photolysis.

Science.gov (United States)

Criquet, Justine; Leitner, Nathalie Karpel Vel

2009-09-01

The photolysis of S(2)O(8)(2-) was studied for the removal of acetic acid in aqueous solution and compared with the H(2)O(2)/UV system. The SO(4)(-) radicals generated from the UV irradiation of S(2)O(8)(2-) ions yield a greater mineralization of acetic acid than the ()OH radicals. Acetic acid is oxidized by SO(4)(-) radicals without significant formation of intermediate by-products. Increasing system pH results in the formation of ()OH radicals from SO(4)(-) radicals. Maximum acetic acid degradation occurred at pH 5. The results suggest that above this pH, competitive reactions with the carbon mineralized inhibit the reaction of the solute with SO(4)(-) and also ()OH radicals. Scavenging effects of two naturally occurring ions were tested; in contrast to HCO(3)(-) ions, the presence of Cl(-) ions enhances the efficiency of the S(2)O(8)(2-)/UV process towards the acetate removal. It is attributed to the formation of the Cl() radical and its great reactivity towards acetate.

Interaction of quinones with three pyrimidine bases: A laser flash photolysis study

Energy Technology Data Exchange (ETDEWEB)

Bose, Adity [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700064 (India); Basu, Samita, E-mail: samita.basu@saha.ac.i [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata 700064 (India)

2009-11-15

The interaction between three different pyrimidine bases, uracil (U), cytosine (C) and thymine (T) and two quinones, 2-methyl-1,4-naphthoquinone or menadione (MQ) and 9,10-anthraquinone (AQ) have been studied using laser flash photolysis technique in organic homogeneous medium. The three pyrimidines have revealed a difference in their extent of reactivity towards the quinones, which has been attributed to their structural difference. Our works have revealed that the difference in structural dimension of the quinones is also responsible for affecting the reactivity of these pyrimidines in homogeneous medium.

Interaction of quinones with three pyrimidine bases: A laser flash photolysis study

International Nuclear Information System (INIS)

Bose, Adity; Basu, Samita

2009-01-01

The interaction between three different pyrimidine bases, uracil (U), cytosine (C) and thymine (T) and two quinones, 2-methyl-1,4-naphthoquinone or menadione (MQ) and 9,10-anthraquinone (AQ) have been studied using laser flash photolysis technique in organic homogeneous medium. The three pyrimidines have revealed a difference in their extent of reactivity towards the quinones, which has been attributed to their structural difference. Our works have revealed that the difference in structural dimension of the quinones is also responsible for affecting the reactivity of these pyrimidines in homogeneous medium.

Photolysis of model emerging contaminants in ultra-pure water: kinetics, by-products formation and degradation pathways.

Science.gov (United States)

Benitez, F Javier; Acero, Juan L; Real, Francisco J; Roldan, Gloria; Rodriguez, Elena

2013-02-01

The photolysis of five frequent emerging contaminants (Benzotriazole, Chlorophene, N,N-diethyl-m-toluamide or DEET, Methylindole, and Nortriptyline HCl) was investigated in ultrapure water under monochromatic ultraviolet radiation at 254 nm and by a combination of UV and hydrogen peroxide. The results revealed that the photolysis rates followed first-order kinetics, with rate constant values depending on the nature of the specific compound, the pH, and the presence or absence of the scavenger tert-butanol. Quantum yields were also determined and values in the range of 53.8 × 10⁻³ - 9.4 × 10⁻³ mol E⁻¹ for Benzotriazole, 525 × 10⁻³ - 469 × 10⁻³ mol E⁻¹ for Chlorophene, 2.8 × 10⁻³ - 0.9 × 10⁻³ mol E⁻¹ for DEET, 108 × 10⁻³ - 165 × 10⁻³ mol E⁻¹ for Methylindole, and 13.8 × 10⁻³ - 15.0 × 10⁻³ mol E⁻¹ for Nortriptyline were obtained. The study also found that the UV/H₂O₂ process enhanced the oxidation rate in comparison to direct photolysis. High-performance liquid chromatography coupled to electrospray ionization quadrupole time-of-flight mass spectrometry (HPLC-ESI-QTOF-MS) technique was applied to the concentrations evaluation and further identification of the parent compounds and their by-products, which allowed the proposal of the degradation pathways for each compound. Finally, in order to assess the aquatic toxicity in the photodegradation of these compounds, the Vibrio fischeri acute toxicity test was used, and the results indicated an initial increase of this parameter in all cases, followed by a decrease in the specific case of Benzotriazole, DEET, Methylindole, and Chlorophene. Copyright © 2012 Elsevier Ltd. All rights reserved.

Efficiencies and Physical Principles of Various Solar Energy Conversion Processes Leading to the Photolysis of Water

Energy Technology Data Exchange (ETDEWEB)

Bergene, T

1996-12-31

In the application of solar energy, hydrogen is likely to be used as an energy carrier and a storage medium. Production of molecular hydrogen and oxygen from water requires energy input, which may come from solar energy in various ways. This thesis begins with a literature survey of the different conversion processes and the efficiencies, which is an introduction to a series of enclosed papers. These papers are: (1) Trapping of Minority Charge Carriers at Irradiated Semiconductor/Electrolyte Heterojunctions, (2) Model Calculations on Flat-Plate Solar Heat Collector With Integrated Solar Cells, and (3) Efficiencies and Physical Principles of Photolysis of Water By Microalgae. In the papers, The qualitative features of the ``illumination-current``-characteristic curve are deduced. The hypothesis is that trapping originates in some specific cases because of confinement, which leads to charge injections into energy states above that corresponding to the band edge. The quantitative features of certain hybrid photovoltaic/thermal configuration are deduced. An analysis of the theoretical and realizable efficiencies of the photolysis of water by micro algae is given. 151 refs., 18 figs., 1 table

Modeling Studies of Inhomogeneity Effects during Laser Flash Photolysis Experiments: A Reaction-Diffusion Approach.

Science.gov (United States)

Dóka, Éva; Lente, Gábor

2017-04-13

This work presents a rigorous mathematical study of the effect of unavoidable inhomogeneities in laser flash photolysis experiments. There are two different kinds of inhomegenities: the first arises from diffusion, whereas the second one has geometric origins (the shapes of the excitation and detection light beams). Both of these are taken into account in our reported model, which gives rise to a set of reaction-diffusion type partial differential equations. These equations are solved by a specially developed finite volume method. As an example, the aqueous reaction between the sulfate ion radical and iodide ion is used, for which sufficiently detailed experimental data are available from an earlier publication. The results showed that diffusion itself is in general too slow to influence the kinetic curves on the usual time scales of laser flash photolysis experiments. However, the use of the absorbances measured (e.g., to calculate the molar absorption coefficients of transient species) requires very detailed mathematical consideration and full knowledge of the geometrical shapes of the excitation laser beam and the separate detection light beam. It is also noted that the usual pseudo-first-order approach to evaluating the kinetic traces can be used successfully even if the usual large excess condition is not rigorously met in the reaction cell locally.

Tolfenamic acid degradation by direct photolysis and the UV-ABC/H2O2 process: factorial design, kinetics, identification of intermediates, and toxicity evaluation.

Science.gov (United States)

de Melo da Silva, Lucas; Pereira Cavalcante, Rodrigo; Fabbro Cunha, Rebeca; Gozzi, Fábio; Falcao Dantas, Renato; de Oliveira, Silvio Cesar; Machulek, Amilcar

2016-12-15

This study employed direct UV-ABC photolysis and the UV-ABC/H 2 O 2 process to investigate the degradation of tolfenamic acid (TA), a common anti-inflammatory drug used in both human and veterinary medicine. A 2 3 factorial design with added center point was used to evaluate the effect of three independent variables-namely, H 2 O 2 concentration ([H 2 O 2 ]), TA concentration ([TA]), and experiment time (time)-on TA degradation and H 2 O 2 photolysis during UV-ABC/H 2 O 2 treatment using a high-pressure mercury vapor lamp (photon flux of 2.6307 × 10 4 J s -1 ) as the UV irradiation source. The responses yielded similar values, revealing a linear behavior, with correlation coefficients R = 0.9968 and R adj = 0.9921 for TA degradation and R = 0.9828 and R adj = 0.9570 for H 2 O 2 photolysis. The most efficient combination of variables was [H 2 O 2 ] = 255 mg L -1 and [TA] = 25 mg L -1 , resulting in 100% TA degradation and 98.87% H 2 O 2 photolysis by 90 min of treatment. Additionally, the second-order kinetic constant of the reaction between TA and HO ● was determined using a competitive kinetic model, employing 2,4-dichlorophenoxyacetic acid (2,4D) as the reference compound. The kinetic constant was 1.9 × 10 10 M -1 s -1 in alkaline medium. TA degradation by direct photolysis generated quinone imines as by-products, responsible for the formation of a dark red "internal filter" that increased the value of acute toxicity to Artemia salina. The UV-ABC/H 2 O 2 process did not promote formation of quinone imines by 90 min of treatment and therefore did not increase acute toxicity values. Several by-products generated during TA degradation were identified and possible degradation pathways for the UV-ABC and UV-ABC/H 2 O 2 processes were proposed. Copyright © 2016 Elsevier B.V. All rights reserved.

The role of spin-orbit coupling in the photolysis of methylcobalamin

Energy Technology Data Exchange (ETDEWEB)

Andruniów, Tadeusz [Department of Chemistry, Advanced Materials Engineering and Modelling Group, Wroclaw University of Technology, 50-370 Wroclaw (Poland); Lodowski, Piotr; Jaworska, Maria [Department of Theoretical Chemistry, Institute of Chemistry, University of Silesia, Szkolna 9, PL-40 006 Katowice (Poland); Garabato, Brady D. [Department of Chemistry, University of Louisville, 2320 South Brook Street, Louisville, Kentucky 40292 (United States); Kozlowski, Pawel M., E-mail: pawel@louisville.edu [Department of Chemistry, University of Louisville, 2320 South Brook Street, Louisville, Kentucky 40292 (United States); Department of Food Sciences, Medical University of Gdansk, Al. Gen. J. Hallera 107, 80-416 Gdansk (Poland)

2016-03-28

The photolysis of the methylcobalamin cofactor (MeCbl) in its base-off form was investigated by considering the extent of spin-orbit coupling (SOC). Triplet Co–C photodissociation pathways previously invoked at the density functional theory level using Landau-Zener theory were further validated with ab initio calculations that combine SOC based on multi-state second order perturbation theory. It was determined that SOC is feasible between singlet and triplet states at elongated Co–C distances, leading to photodissociation from the state having dominant σ(d{sub z}{sup 2}) character, by either direct coupling with the lowest singlet states or by crossing with SOC mixed triplets.

The role of direct photolysis and indirect photochemistry in the environmental fate of ethylhexyl methoxy cinnamate (EHMC) in surface waters.

Science.gov (United States)

Vione, D; Calza, P; Galli, F; Fabbri, D; Santoro, V; Medana, C

2015-12-15

The aquatic environmental fate of ethylhexyl methoxy cinnamate (EHMC), one of the most used UVB filters worldwide, was studied by assessing its environmental persistence and photoinduced transformations. The role of direct and indirect photolysis was evaluated. Direct photolysis was shown to play a key role, and this process is expected to be the main attenuation route of EHMC in sunlit surface waters. In contrast, the reaction with OH radicals would be negligible and that with (3)CDOM* would at most be a secondary process. The measurement of the quantum yield of direct photolysis and of the rate constants of reaction with photogenerated transient species (or, sometimes, the use of reasonable values for the latter) allowed the prediction of the EHMC half-life time in surface waters, by means of a validated photochemical model. The predicted EHMC lifetime is of the order of hours to a few days in fair-weather summertime, and the main factors controlling the EHMC phototransformation in sunlit surface waters would be the water depth and the dissolved organic carbon (DOC) content. The formation of transformation products (TPs) was followed as well via HPLC/HRMS. Three TPs were detected in the samples exposed to UVA radiation, while one additional TP was detected in the samples exposed to UVB radiation. The detected TPs comprised 4-methoxybenzaldehyde, a hydroxylated derivative and dimeric species. Through the use of heterogeneous photocatalysis with TiO2, seven additional TPs were identified, most of them resulting from the further degradation of primary TPs formed through direct photolysis and that might be detected in aquatic systems as well. The photodegradation of EHMC in the presence of TiO2 yielded more toxic TPs than the parent compound (as determined with the Vibrio fischeri Microtox assay). The increased toxicity is partially accounted for by the formation of 4-methoxybenzaldehyde. Copyright © 2015 Elsevier B.V. All rights reserved.

IR Laser-Induced Thermolysis and UV Laser-Induced Photolysis of 1,3-Diethyldisiloxane: Chemical Vapour Deposition of Nanotextured Hydridoalkylsilicones

Czech Academy of Sciences Publication Activity Database

Urbanová, Markéta; Bastl, Zdeněk; Šubrt, Jan; Pola, Josef

2001-01-01

Roč. 11, č. 6 (2001), s. 1557-1562 ISSN 0959-9428 R&D Projects: GA AV ČR IAA4072806 Keywords : thermolysis * UV laser photolysis * composition Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 2.736, year: 2001

Are UV photolysis and UV/H2O2 process efficient to treat estrogens in waters? Chemical and biological assessment at pilot scale.

Science.gov (United States)

Cédat, Bruno; de Brauer, Christine; Métivier, Hélène; Dumont, Nathalie; Tutundjan, Renaud

2016-09-01

In this study, UV based treatments were implemented at pilot scale to assess their ability to remove hormones from treated wastewater, especially with the view to equip small and medium size Wastewater Treatment Plants (WTPs). To this end, the degradation of a mixture of estrogenic hormones (Estrone (E1), β-Estradiol (E2), and 17α-Ethinyl Estradiol (EE2)) in waters by UV photolysis and UV/H2O2 process was investigated in real conditions. A particular attention was paid at designing a well validated laboratory scale pilot in order to optimise oxidant concentrations and UV fluence. A Low pressure lamp (254 nm) was used in a flow through commercial reactor. The effects of water matrices (drinking water and treated wastewater) and H2O2 concentrations (10, 40, and 90 mg/L) on the pilot efficiency were first determined. Only E1 could be partially degraded by UV photolysis whereas hormones were all well removed by UV/H2O2 process in both matrices. The second part of the study focused on a chemical and biological assessment of UV photolysis and UV/H2O2 process (30 and 50 mg/L). Degradation rate constants of hormones as well as changes in estrogenic activity (YES bioassay) and toxicity (Vibrio fischeri) were followed at the same time. UV photolysis could not remove neither estrogens nor estrogenic activity at relevant UV fluence in waters. However 80% of initial estrogenic compounds and estrogenic activity could be removed from treated wastewater by combining UV fluence of 423 and 520 mJ/cm(2) with 50 and 30 mg/L of H2O2, respectively. No high estrogenic or toxic by-products were detected by the two bioassays following UV photolysis or UV/H2O2 process. Operating costs were estimated for a full scale pilot. H2O2 was the major cost. By combining the appropriate concentration of H2O2 and UV fluence, it could be possible to design a cost effective treatment for treating estrogens in small and medium size WTPs. Copyright © 2016 Elsevier Ltd. All rights reserved.

Pressure dependence for the CO quantum yield in the photolysis of acetone at 248 nm: a combined experimental and theoretical study.

Science.gov (United States)

Somnitz, H; Fida, M; Ufer, T; Zellner, R

2005-09-21

The quantum yield of CO in the laser pulse photolysis of acetone at 248 nm and at 298 K in the pressure range 20-900 mbar (N2) has been measured directly using quantitative infrared diode laser absorption of CO. It is found that the quantum yield of CO shows a significant dependence on total pressure with Phi(CO) decreasing with pressure from around 0.45 at 20 mbar to approximately 0.25 at 900 mbar. From a combination of ab initio quantum chemical calculations on the molecular properties of the acetyl (CH3CO) radical and its unimolecular fragmentation as well as the application of statistical (RRKM) and dynamical calculations we show that CO production results from prompt secondary fragmentation (via(2a)) of the internally excited primary CH3CO* photolysis product with an excess energy of approximately 62.8 kJ mol(-1). Hence, our findings are consistent with a consecutive photochemically induced decomposition model, viz. step (1): CH3COCH3+hv--> CH3CO*+ CH3, step (2a): CH3CO*--> CH3+ CO or step (2b) CH3CO*-(+M)--> CH3CO. Formation of CO via a direct and/or concerted channel CH3COCH3+hv--> 2CH(3)+ CO (1') is considered to be unimportant.

Ozonolysis and Subsequent Photolysis of unsaturated organic molecules: Model Systems for Photochemical Aging of Organic Aerosol Particles

Science.gov (United States)

Park, J.; Gomez, A. L.; Walser, M. L.; Lin, A.; Nizkorodov, S. A.

2005-12-01

Chemical and photochemical aging of organic species adsorbed on aerosol particle surfaces is believed to have a significant effect on cloud condensation properties of atmospheric aerosols. Ozone initiated oxidation reactions of thin films of undecylenic acid and alkene-terminated self assembled monolayers (SAMs) on SiO2 surface were investigated using a combination of spectroscopic and mass spectrometric techniques. Photolysis of the oxidized film in the tropospheric actinic region (λ>290 nm) readily produces formaldehyde and formic acid as gas-phase products. Photodissociation action spectra of the oxidized film suggest that organic peroxides are responsible for the enhanced photochemical activity. The presence of peroxides in the oxidized sample was confirmed by mass-spectrometric analysis and by an iodometric test. Significant polymerization resulting from secondary reactions of Criegee radicals during ozonolysis of the film is also observed. The reaction mechanism and its implications for photochemical aging of atmospheric aerosol particles will be discussed.

Photochemistry of CS2/Cl complexes-combined pulse radiolysis-laser flash photolysis studies

International Nuclear Information System (INIS)

Sumiyoshi, Takashi; Nakayama, Masayoshi; Fujiyoshi, Ryoko; Sawamura, Sadashi

2006-01-01

Complexes of chlorine atoms and carbon disulfide (CS 2 ) were produced by pulse radiolysis of CS 2 in halocarbons and photochemical reactions were studied by laser flash photolysis. Excitation of CS 2 /Cl complexes resulted in rapid and permanent photobleaching. The photobleaching of CS 2 /Cl complexes is due to intermolecular chlorine atom abstraction in CCl 4 with a quantum yield of 0.04, while that ascribed to hydrogen atom abstraction in 1,2-dichloroethane has a quantum yield of 0.21. The effects of additives are discussed based on the bond dissociation energy

Chemically Patterned Inverse Opal Created by a Selective Photolysis Modification Process.

Science.gov (United States)

Tian, Tian; Gao, Ning; Gu, Chen; Li, Jian; Wang, Hui; Lan, Yue; Yin, Xianpeng; Li, Guangtao

2015-09-02

Anisotropic photonic crystal materials have long been pursued for their broad applications. A novel method for creating chemically patterned inverse opals is proposed here. The patterning technique is based on selective photolysis of a photolabile polymer together with postmodification on released amine groups. The patterning method allows regioselective modification within an inverse opal structure, taking advantage of selective chemical reaction. Moreover, combined with the unique signal self-reporting feature of the photonic crystal, the fabricated structure is capable of various applications, including gradient photonic bandgap and dynamic chemical patterns. The proposed method provides the ability to extend the structural and chemical complexity of the photonic crystal, as well as its potential applications.

Model of daytime emissions of electronically-vibrationally excited products of O3 and O2 photolysis: application to ozone retrieval

Directory of Open Access Journals (Sweden)

V. A. Yankovsky

2006-11-01

Full Text Available The traditional kinetics of electronically excited products of O3 and O2 photolysis is supplemented with the processes of the energy transfer between electronically-vibrationally excited levels O2(a1Δg, v and O2(b1Σ+g, v, excited atomic oxygen O(1D, and the O2 molecules in the ground electronic state O2(X3Σg−, v. In contrast to the previous models of kinetics of O2(a1Δg and O2 (b1Σ+g, our model takes into consideration the following basic facts: first, photolysis of O3 and O2 and the processes of energy exchange between the metastable products of photolysis involve generation of oxygen molecules on highly excited vibrational levels in all considered electronic states – b1Σ+g, a1Δg and X3Σg−; second, the absorption of solar radiation not only leads to populating the electronic states on vibrational levels with vibrational quantum number v equal to 0 – O2(b1Σ+g, v=0 (at 762 nm and O2(a1Δg, v=0 (at 1.27 µm, but also leads to populating the excited electronic–vibrational states O2(b1Σ+g, v=1 and O2(b1Σ+g, v=2 (at 689 nm and 629 nm. The proposed model allows one to calculate not only the vertical profiles of the O2(a1Δg, v=0 and O2(b1Σg, v=0 concentrations, but also the profiles of [O2(a1Δg, v≤5], [O2 (b1Σ+g , v=1, 2] and O2(X3Σg−, v=1–35. In the altitude range 60–125 km, consideration of the electronic-vibrational kinetics significantly changes the calculated concentrations of the metastable oxygen molecules and reduces the discrepancy between the altitude profiles of ozone concentrations retrieved from the 762-nm and 1.27-µm emissions measured simultaneously.

Effective scheme of photolysis of GFP in live cell as revealed with confocal fluorescence microscopy

Science.gov (United States)

Glazachev, Yu I.; Orlova, D. Y.; Řezníčková, P.; Bártová, E.

2018-05-01

We proposed an effective kinetics scheme of photolysis of green fluorescent protein (GFP) observed in live cells with a commercial confocal fluorescence microscope. We investigated the photolysis of GFP-tagged heterochromatin protein, HP1β-GFP, in live nucleus with the pulse position modulation approach, which has several advantages over the classical pump-and-probe method. At the basis of the proposed scheme lies a process of photoswitching from the native fluorescence state to the intermediate fluorescence state, which has a lower fluorescence yield and recovers back to native state in the dark. This kinetics scheme includes four effective parameters (photoswitching, reverse switching, photodegradation rate constants, and relative brightness of the intermediate state) and covers the time scale from dozens of milliseconds to minutes of the experimental fluorescence kinetics. Additionally, the applicability of the scheme was demonstrated in the cases of continuous irradiation and the classical pump-and-probe approach using numerical calculations and analytical solutions. An interesting finding of experimental data analysis was that the overall photodegradation of GFP proceeds dominantly from the intermediate state, and demonstrated approximately the second-order reaction versus irradiation power. As a practical example, the proposed scheme elucidates the artifacts of fluorescence recovery after the photobleaching method, and allows us to propose some suggestions on how to diminish them.

Topical treatment of oral cavity and wounded skin with a new disinfection system utilizing photolysis of hydrogen peroxide in rats.

Science.gov (United States)

Yamada, Yasutomo; Mokudai, Takayuki; Nakamura, Keisuke; Hayashi, Eisei; Kawana, Yoshiko; Kanno, Taro; Sasaki, Keiichi; Niwano, Yoshimi

2012-01-01

The present study aimed to evaluate the acute locally injurious property of hydroxyl radical generation system by photolysis of H(2)O(2), which is a new disinfection system for the treatment of periodontitis developed in our laboratory. Firstly, generation of the hydroxyl radical by a test device utilizing the photolysis of H(2)O(2) was confirmed by applying an electron spin resonance (ESR)-spin trapping technique. Secondly, the bactericidal effect of the device was examined under a simulant condition in which Staphylococcus aureus suspended in 1 M H(2)O(2) was irradiated with laser light emitted from the test device, resulting in substantial reduction of the colony forming unit of the bacteria within a short time as 2 min. Finally, acute topical effect of the disinfection system on rat oral mucosa and wounded skin was evaluated by histological examination. No abnormal findings were observed in the buccal mucosal region treated three times with 1 M H(2)O(2) and irradiation. Similarly, no abnormal findings were observed during the healing of skin treated with 1 M H(2)O(2) and irradiation immediately after wounding. Since topical treatment with the novel disinfection technique utilizing the photolysis of H(2)O(2) had no detrimental effect on the oral mucosa and the healing of full thickness skin wounds in rats, it is expected that the acute locally injurious property of the disinfection technique is low.

Investigation of ultraviolet photolysis vapor generation with in-atomizer trapping graphite furnace atomic absorption spectrometry for the determination of mercury

Energy Technology Data Exchange (ETDEWEB)

Madden, Jeremy T. [Department of Chemistry, Biochemistry, and Physics, Marist College, 3399 North Road, Poughkeepsie, NY 12601 (United States); Fitzgerald, Neil [Department of Chemistry, Biochemistry, and Physics, Marist College, 3399 North Road, Poughkeepsie, NY 12601 (United States)], E-mail: neil.fitzgerald@marist.edu

2009-09-15

Generation of mercury vapor by ultraviolet irradiation of mercury solutions in low molecular weight organic acid solutions prior to measurement by Atomic Absorption Spectrometry is a cheap, simple and green method for determination of trace concentrations of mercury. In this work mercury vapor generated by ultraviolet photolysis was trapped onto a palladium coated graphite furnace significantly improving the detection limit of the method. The system was optimized and a detection limit of 0.12 {mu}g L{sup - 1} (compared to 2.1 {mu}g L{sup - 1} for a previously reported system in the absence of trapping) with a precision of 11% for a 10 {mu}g L{sup - 1} mercury standard (RSD, N = 5)

Ecotoxicological effect of ketamine: Evidence of acute, chronic and photolysis toxicity to Daphnia magna.

Science.gov (United States)

Li, Shih-Wei; Wang, Yu-Hsiang; Lin, Angela Yu-Chen

2017-09-01

Ketamine has been increasingly used in medicine and has the potential for abuse or illicit use around the world. Ketamine cannot be removed by conventional wastewater treatment plants. Although ketamine and its metabolite norketamine have been detected to a significant degree in effluents and aquatic environments, their ecotoxicity effects in aquatic organisms remain undefined. In this study, we investigated the acute toxicity of ketamine and its metabolite, along with the chronic reproductive toxicity of ketamine (5-100μg/L) to Daphnia magna. Multiple environmental scenarios were also evaluated, including drug mixtures and sunlight irradiation toxicity. Ketamine and norketamine caused acute toxicity to D. magna, with half lethal concentration (LC 50 ) values of 30.93 and 25.35mg/L, respectively, after 48h of exposure. Irradiated solutions of ketamine (20mg/L) significantly increased the mortality of D. magna; pre-irradiation durations up to 2h rapidly increased the death rate to 100%. A new photolysis byproduct (M.W. 241) of norketamine that accumulates during irradiation was identified for the first time. The relevant environmental concentration of ketamine produced significant reproductive toxicity effects in D. magna, as revealed by the reduction of the number of total live offspring by 33.6-49.8% (p ketamine concentration cannot be ignored and warrant further examination. Copyright © 2017 Elsevier Inc. All rights reserved.

Hydrogen Production from Water by Photolysis, Sonolysis and Sonophotolysis with Solid Solutions of Rare Earth, Gallium and Indium Oxides as Heterogeneous Catalysts

Directory of Open Access Journals (Sweden)

Marta Penconi

2015-07-01

Full Text Available In this work, we present the hydrogen production by photolysis, sonolysis and sonophotolysis of water in the presence of newly synthesized solid solutions of rare earth, gallium and indium oxides playing as catalysts. From the experiments of photolysis, we found that the best photocatalyst is the solid solution Y0.8Ga0.2InO3 doped by sulphur atoms. In experiments of sonolysis, we optimized the rate of hydrogen production by changing the amount of water, adding ethanol and tuning the power of our piezoelectric transducer. Finally, we performed sonolysis and sonophotolysis experiments in the presence of S:Y0.8Ga0.2InO3 finding a promising synergistic effect of UV-visible electromagnetic waves and 38 kHz ultrasound waves in producing H2.

Interactions between 9,10-anthraquinone and aromatic amines in homogeneous and micellar media: A laser flash photolysis and magnetic field effect study

International Nuclear Information System (INIS)

Chowdhury, Adity; Basu, Samita

2006-01-01

The interactions between 9,10-anthraquinone (AQ) and different aromatic amines, N,N-dimethylaniline and 4,4'-bis (dimethylamino) diphenylmethane (DMDPM), have been studied using absorption, steady-state fluorescence, and laser flash photolysis techniques in organic homogeneous and heterogeneous micellar media. In polar organic homogeneous medium, electron transfer (ET) occurs from amines to excited AQ. In micellar medium, similar intermolecular ET is observed. However, in latter medium, ET predominates over hydrogen abstraction from micelles by excited AQ itself. The occurrence of ET has been further supported by the application of an external magnetic field during laser flash photolysis experiments, which modulates the yield of radical ion pairs formed through ET. Another novel feature, which has also been discussed here, is the abnormal behavior of DMDPM in micellar medium pertaining to energy transfer

Flash photolysis of rhodopsin in the cat retina

International Nuclear Information System (INIS)

Ripps, H.; Mehaffey, L.; Siegel, I.M.; Ernst, W.; Kemp, C.M.

1981-01-01

The bleaching of rhodopsin by short-duration flashes of a xenon discharge lamp was studied in vivo in the cat retina with the aid of a rapid, spectral-scan fundus reflectometer. Difference spectra recorded over a broad range of intensities showed that the bleaching efficacy of high-intensity flashes was less than that of longer duration, steady lights delivering the same amount of energy. Both the empirical results and those derived from a theoretical analysis of flash photolysis indicate that, under the conditions of these experiments, the upper limit of the flash bleaching of rhodopsin in cat is approximately 90%. Although the fact that a full bleach could not be attained is attributable to photoreversal, i.e., the photic regeneration of rhodopsin from its light-sensitive intermediates, the 90% limit is considerably higher than the 50% (or lower) value obtained under other experimental circumstances. Thus, it appears that the duration (approximately 1 ms) and spectral composition of the flash, coupled with the kinetic parameters of the thermal and photic reactions in the cat retina, reduce the light-induced regeneration of rhodopsin to approximately 10%

Estudo da degradação do fármaco Nabumetona por fotólise direta Study of Nabumetone degradation through direct photolysis

Directory of Open Access Journals (Sweden)

Florangela Maionchi

2002-03-01

Full Text Available O presente trabalho teve por objetivo estudar a degradação do fármaco Nabumetona por fotólise direta. Soluções etanólicas de amostras (20 mg/mL foram preparadas e divididas em cubetas de quartzo com tampas de teflon. Estas foram colocadas em uma câmara de fotólise à temperatura de 35ºC. As quantificações das fotodegradações foram analisadas por Cromatografia Líquida de Alta Eficiência (CLAE; após 47 dias de fotólise, a degradação da amostra foi de 67%, após 73 dias 88,5% e após 111 dias 89,5%. Determinações espectrofotométricas (240 a 360 nm foram realizadas após 28, 47 e 73 dias de fotólise. Os fotoprodutos foram separados por CLAE e analisados por Cromatografia Gasosa Acoplada ao Espectro de Massa de Baixa Resolução (CG-EM. A análise em CG-EM da Nabumetona fotolisada durante 111 dias permitiu a sugestão de duas substâncias.The present work aims to study the degradation of Nabumetone through direct photolysis. Solutions of Nabumetone in ethanol (20 mg/mL were prepared and divided in quartz cuvettes with teflon lids. These were placed in the photolysis cabinet at 35ºC. The photodegradation quantifications were analyzed in High Performance Liquid Cromatography (HPLC; after 47 days of photolysis the sample degradation was 67%, after 73 days 88.5% and after 111 days 89.5%. Spectrophotometers determinations (240 to 360 nm were accomplished after 28, 47 and 73 days of photolysis. The photoproducts were separate for HPLC and analyzed by Gas Cromatograph coupled to Mass Spectrometer (GC-MS. The analysis in GC-MS of the Nabumetona photolyseded for 111 days allowed the suggestion of two substances.

DEUTERIUM FRACTIONATION DURING AMINO ACID FORMATION BY PHOTOLYSIS OF INTERSTELLAR ICE ANALOGS CONTAINING DEUTERATED METHANOL

Energy Technology Data Exchange (ETDEWEB)

Oba, Yasuhiro; Watanabe, Naoki; Kouchi, Akira [Institute of Low Temperature Science, Hokkaido University, N19W8, Kita-ku, Sapporo, Hokkaido 060-0819 (Japan); Takano, Yoshinori, E-mail: oba@lowtem.hokudai.ac.jp [Department of Biogeochemistry, Japan Agency for Marine-Earth Science and Technology (JAMSTEC), 2-15 Natsushima, Yokosuka, Kanagawa 237-0061 (Japan)

2016-08-10

Deuterium (D) atoms in interstellar deuterated methanol might be distributed into complex organic molecules through molecular evolution by photochemical reactions in interstellar grains. In this study, we use a state-of-the-art high-resolution mass spectrometer coupled with a high-performance liquid chromatography system to quantitatively analyze amino acids and their deuterated isotopologues formed by the photolysis of interstellar ice analogs containing singly deuterated methanol CH{sub 2}DOH at 10 K. Five amino acids (glycine, α -alanine, β -alanine, sarcosine, and serine) and their deuterated isotopologues whose D atoms are bound to carbon atoms are detected in organic residues formed by photolysis followed by warming up to room temperature. The abundances of singly deuterated amino acids are in the range of 0.3–1.1 relative to each nondeuterated counterpart, and the relative abundances of doubly and triply deuterated species decrease with an increasing number of D atoms in a molecule. The abundances of amino acids increase by a factor of more than five upon the hydrolysis of the organic residues, leading to decreases in the relative abundances of deuterated species for α -alanine and β -alanine. On the other hand, the relative abundances of the deuterated isotopologues of the other three amino acids did not decrease upon hydrolysis, indicating different formation mechanisms of these two groups upon hydrolysis. The present study facilitates both qualitative and quantitative evaluations of D fractionation during molecular evolution in the interstellar medium.

DEUTERIUM FRACTIONATION DURING AMINO ACID FORMATION BY PHOTOLYSIS OF INTERSTELLAR ICE ANALOGS CONTAINING DEUTERATED METHANOL

International Nuclear Information System (INIS)

Oba, Yasuhiro; Watanabe, Naoki; Kouchi, Akira; Takano, Yoshinori

2016-01-01

Deuterium (D) atoms in interstellar deuterated methanol might be distributed into complex organic molecules through molecular evolution by photochemical reactions in interstellar grains. In this study, we use a state-of-the-art high-resolution mass spectrometer coupled with a high-performance liquid chromatography system to quantitatively analyze amino acids and their deuterated isotopologues formed by the photolysis of interstellar ice analogs containing singly deuterated methanol CH 2 DOH at 10 K. Five amino acids (glycine, α -alanine, β -alanine, sarcosine, and serine) and their deuterated isotopologues whose D atoms are bound to carbon atoms are detected in organic residues formed by photolysis followed by warming up to room temperature. The abundances of singly deuterated amino acids are in the range of 0.3–1.1 relative to each nondeuterated counterpart, and the relative abundances of doubly and triply deuterated species decrease with an increasing number of D atoms in a molecule. The abundances of amino acids increase by a factor of more than five upon the hydrolysis of the organic residues, leading to decreases in the relative abundances of deuterated species for α -alanine and β -alanine. On the other hand, the relative abundances of the deuterated isotopologues of the other three amino acids did not decrease upon hydrolysis, indicating different formation mechanisms of these two groups upon hydrolysis. The present study facilitates both qualitative and quantitative evaluations of D fractionation during molecular evolution in the interstellar medium.

Photolysis of low concentration H2S under UV/VUV irradiation emitted from microwave discharge electrodeless lamps.

Science.gov (United States)

Xia, Lan-Yan; Gu, Ding-Hong; Tan, Jing; Dong, Wen-Bo; Hou, Hui-Qi

2008-04-01

The photolysis of simulating low concentration of hydrogen sulfide malodorous gas was studied under UV irradiation emitted by self-made microwave discharge electrodeless lamps (i.e. microwave UV electrodeless mercury lamp (185/253.7 nm) and iodine lamp (178.3/180.1/183/184.4/187.6/206.2 nm)). Experiments results showed that the removal efficiency (eta H2S) of hydrogen sulfide was decreased with increasing initial H2S concentration and increased slightly with gas residence time; H2S removal efficiency was decreased dramatically with enlarged pipe diameter. Under the experimental conditions with pipe diameter of 36 mm, gas flow rate of 0.42 standard l s(-1), eta H2S was 52% with initial H2S concentration of 19.5 mg m(-3) by microwave mercury lamp, the absolute removal amount (ARA) was 4.30 microg s(-1), and energy yield (EY) was 77.3 mg kW h(-1); eta H2S was 56% with initial H2S concentration of 18.9 mg m(-3) by microwave iodine lamp, the ARA was 4.48 microg s(-1), and the EY was 80.5mg kW h(-1). The main photolysis product was confirmed to be SO4(2-) with IC.

PET: which radionuclides can be used?; TEP: quels sont les radionucleides utilisables?

Energy Technology Data Exchange (ETDEWEB)

Pasqualini, R. [CEA Saclay, CIS bio international, Schering, 91 - Gif-sur-Yvette (France)

2005-04-15

Almost the totality of positron imaging procedures are performed with {sup 18}F, mainly after administration of {sup 18}F-FDG. The reason of this hegemonic role in TEP is not only due to the favourable nuclear properties of {sup 18}F (97% of positron yield, low energy positron, no parasitic gamma-ray) but also to the relatively simple manufacturing process (use of low energy cyclotron, high irradiation yield). Only the short value of {sup 18}F half-life and the relatively poor labelling chemistry might be considered a disadvantage to a wider use of this radionuclide. The success of {sup 18}F has stimulated the search for new positron emitters, leading to a list of a large number of potential candidates. However, it is known that the pharmaceutical development leading to the approval of a new radioactive tracer is a long and costly process. Therefore, it is necessary to adopt selecting criteria able to identify the best candidate undergoing the pharmaceutical development with potentiality of success. The selection criteria used in this presentation are based on both the impact of nuclear properties on image quality and dosimetry and on the data related to the manufacturing process (irradiation and purification yields, half-life value etc). These criteria have been applied to the most frequently cited positron emitters, namely {sup 64}Cu, {sup 68}Ga, {sup 72}As, {sup 76}Br, {sup 86}Y, and {sup 124}I. {sup 82}Rb, a radionuclide currently approved in US has also been included in this analysis. Amongst the above radionuclides, only {sup 64}Cu, {sup 68}Ga, {sup 82}Rb and, to a less extent, {sup 124}I can be considered acceptable candidates for an industrial development. (author)

Influence of Humic Acid on 1-Aminopyrene Ecotoxicity During Solar Photolysis Process

Directory of Open Access Journals (Sweden)

Huey-Min Hwang

2002-11-01

Full Text Available Abstract: 1-Aminopyrene (1-AP, a polycyclic aromatic hydrocarbons (PAH compound, is a major metabolite during biotransformation of 1-nitropyrene by microflora in natural environment and in the guts of animals and humans. Under UV-A irradiation, 1-AP has been shown to cause light-induced DNA single strand cleavage. Humic acids (HA in aquatic ecosystems can influence the bioavailability, toxicity, and fate of organic xenobiotics. Therefore, photochemical fate and effect of PAH in natural aquatic environment may differ significantly across sites. The objectives of this study are to assess the time course (TC; 18 and 90 minutes influence of HA (0, 20, and 60 ppm on microbial ecotoxicity of 1-AP (0 and 10 μM during solar photolysis process (PP. Microbial ecotoxicity of 1-AP during different time courses in the presence and absence of HA was measured with spread plate counting and microbial mineralization of 14C-D-glucose. The experimental results were analyzed as factorial arrangements of treatment in a complete randomized design using General Linear Model by SAS. LSMEANS was used to separate means or combination of means. Significant effect on glucose mineralization was found by the following treatment interactions 1-AP*TC, 1-AP*PP, TC*PP, HA*1-AP*TC, HA*1-AP*PP, and HA*1-AP*TC*PP. The treatment interaction HA*1-AP was the only one affecting spread plate counting. In the groups exposed to 1-AP (10 μM, microbial heterotrophic mineralization of 14C-D-glucose was significantly inhibited in the presence of HA in light and in darkness. Exposure to HA in light and darkness, however, did not necessarily inhibit bacterial viability at the HA concentration range assayed. Therefore, inhibition on microbial activity could have been caused by multiple factors, instead of toxicity of HA alone.

Flash and Continuous Photolysis Studies of the Thionitrosyl Complex Cr(CH3CN)5(NS)2+ and the Nitric Oxide Analogs. Reactions of Nitrogen Monosulfide in Solution

DEFF Research Database (Denmark)

Dethlefsen, Johannes Wied; Hedegård, Erik; Rimmer, R. Dale

2009-01-01

Photolysis of the thionitrosyl complex Cr(CH3CN)5(NS)2+ (1) in acetonitrile solution leads to the dissociation of nitrogen monosulfide (NS).  In deaerated solution, this reaction is reversible, and flash photolysis studies demonstrate that NS reacts with Cr(CH3CN)62+ according to the rate law d[1...... dependent quantum yields of 0.3-1.0 mol/Einstein. Mass spectroscopic studies of the product solutions demonstrate formation of S8, presumably from the decomposition of NS. The quantitative photochemical behaviors of 1 and the nitrosyl analog 2 are compared. Udgivelsesdato: Jan....

Dynamics of phytoplankton productivity and exopolysaccharides (EPS and TEP) pools in the Seine Estuary (France, Normandy) over tidal cycles and over two contrasting seasons.

Science.gov (United States)

Morelle, Jérôme; Schapira, Mathilde; Claquin, Pascal

2017-10-01

Exopolysaccharides (EPS) play an important role in the carbon flux and may be directly linked to phytoplankton and microphytobenthos production, most notably in estuarine systems. However the temporal and spatial dynamics of estuarine EPS are still not well understood, nor how primary productivity triggers this variability at these different scales. The aim of this study was to investigate the primary productivity of phytoplankton and EPS dynamics in the Seine estuary over a tidal cycle in three different haline zones over two contrasted seasons. The other objectives was to investigate the origin of pools of soluble carbohydrates (S-EPS) and transparent exopolymeric particles (TEP) in phytoplankton, microphytobenthos or other compartments. High frequency measurements of productivity were made in winter and summer 2015. Physical and chemical parameters, biomass and EPS were measured at hourly intervals in sub-surface waters and just above the water sediment-interface. Our results confirmed that high frequency measurements improve the accuracy of primary productivity estimations and associated carbon fluxes in estuaries. The photosynthetic parameters were shown to be strongly controlled by salinity and by the concentrations of suspended particle matter at the smallest temporal and at spatial scales. At these scales, our results showed an inverse relationship between EPS concentrations and biomass and productivity, and a positive relationship with sediment resuspension. Additionally, the distribution of EPS appears to be linked to hydrodynamics with the tide at daily scale and with the winter at seasonal scale. At spatial scale, the maximum turbidity zone played an important role in the distribution of TEP. Our results suggest that, in the Seine estuary, between 9% and 33% of the S-EPS pool in the water column can be attributed to phytoplankton excretion, while only 0.4%-1.6% (up to 6.14% in exceptional conditions) originates from the microphytobenthos compartments

Assignment and analysis of the A3Πi-X3Σ- transition of the CCO molecule. Formation and disappearance of the CCO's X3Σ- state during flash photolysis of the carbon suboxide

International Nuclear Information System (INIS)

Devillers, Claude

1971-01-01

As the C 2 O radical appeared to be the necessary intermediate compound which could lead from atomic carbon to carbon suboxide by a chain of elementary reactions for the study of the effect of radiations on CO, this research thesis, after a recall on the nature of primary compounds of carbon suboxide photolysis, presents experimental techniques aimed at the investigation of C 2 O: flash photolysis to observe it with low resolution, experimental set-up to record its spectrum with a high resolution, experimental set-up to observe it by pulse radiolysis of carbon oxide. The author reports the identification and analysis of the C 2 O spectrum, and discusses the formation and disappearance of the CCO's X 3 Σ - state with or without the presence of sensors during flash photolysis of the carbon suboxide [fr

Pressure dependent isotopic fractionation in the photolysis of formaldehyde-d2

DEFF Research Database (Denmark)

Nilsson, E.J.K.; Schmidt, Johan Albrecht; Johnson, Matthew Stanley

2014-01-01

role in the observed pressure dependent photolytic fractionation of deuterium. The model shows that part of the fractionation is a result of competition between the isotopologue dependent rates of unimolecular dissociation and collisional relaxation. We suggest that the remaining fractionation is due......The isotope effects in formaldehyde photolysis are the key link between the δD of methane emissions and the δD of atmospheric in situ hydrogen production. A few recent studies have suggested that a pressure dependence in the isotopic fractionation can partly explain enrichment of deuterium...... with altitude in the atmosphere. The mechanism and the extent of this pressure dependency is, however, not adequately described. In the present work D2CO and H2CO were photolyzed in a static reaction chamber at bath gas pressures of 50, 200, 400, 600 and 1000 mbar; these experiments compliment and extend our...

Investigation of molecular mechanisms in photodynamic action and radiobiology with nanosecond flash photolysis and pulse radiolysis. Progress report, July 1, 1974--June 30, 1975

International Nuclear Information System (INIS)

Grossweiner, L.I.

1975-01-01

Initial mechanisms in the UV photooxidation of aromatic amino acids are being investigated with laser flash photolysis at 265 nm in connection with enzyme inactivation. Aqueous tryptophan (Trp) is photoionized by an efficient monophotonic process, followed by a hitherto unreported pseudo-first order recombination competing with bimolecular e - /sub aq/ decay and electron scavengers. Measurements of the photoionization quantum efficiency, the aromatic radical extinction coefficients, and the electron decay kinetics are reported. The flash photolysis of N-formylkynurenine (FK) has been studied in connection with its role in ''internal'' photodynamic action in bovine carbonic anhydrase (BCA). The triplet state of FK oxidizes Trp to the radical formed also by UV photolysis, leading to the FK semiquinone which reacts with oxygen to produce O 2 - . The same FK semiquinone species is formed by radiolytic reduction by e - /sub aq/ and CO 2 - . A parallel radiolysis study on BCA using radical anions as probes of specific residues has shown that the zinc atom protects against the inactivating attack of e - /sub aq/ and CO 2 - . Evidence for sensitive aromatic residues in BCA has been found with this technique. Photodynamic damage to biological membranes is being studied with spin label ESR methods. New work is reported on damage to unsaturated lipids sensitized by Eosin based on changes in the temperature-dependence of the spin label rotational correlation time. Preliminary results with diploid yeast membranes (Saccharomyces cerevisiae) show a loosening of the structure accompanying photodynamic inactivation. (U.S.)

Investigations on the photoelectrochemical decomposition of water using solar radiation (photolysis). Final report. Untersuchung zur photoelektrochemischen Wasserzersetzung mit Hilfe von Sonnenenergie (Photolyse). Schlussbericht

Energy Technology Data Exchange (ETDEWEB)

Schindler, R N

1985-01-01

Laboratory experiments were carried out on illuminated TiO/sub 2/-electrodes to examine the possibility of conversion and storage of solar radiation in a chemical system especially as hydrogen from the photolysis of water. Methods of preparation of new photosensitive semiconducting electrodes were studied. For the preparation of the electrodes various technique of vapour deposition and surface treatment including ion implantation were employed. The thin-layered electrodes were characterized by absorption spectroscopy and by electrochemical methods. The results of the investigations are published in 29 original contributions quoted as references and in 3 PhD thesis of co-workers. Using solar radiation only small yields of hydrogen were obtained in the photolysis of water on TiO/sub 2/ electrodes. Nevertheless it is concluded that photoelectrochemistry possesses a high potential in photocatalysis and in investigations of photooxidation processes occurring in the atmosphere. (orig.) With 36 refs., 2 tabs., 56 figs.

UV Photolysis of Chloramine and Persulfate for 1,4-Dioxane Removal in Reverse-Osmosis Permeate for Potable Water Reuse.

Science.gov (United States)

Li, Wei; Patton, Samuel; Gleason, Jamie M; Mezyk, Stephen P; Ishida, Kenneth P; Liu, Haizhou

2018-06-05

A sequential combination of membrane treatment and UV-based advanced oxidation processes (UV/AOP) has become the industry standard for potable water reuse. Chloramines are used as membrane antifouling agents and therefore carried over into the UV/AOP. In addition, persulfate (S 2 O 8 2- ) is an emerging oxidant that can be added into a UV/AOP, thus creating radicals generated from both chloramines and persulfate for water treatment. This study investigated the simultaneous photolysis of S 2 O 8 2- and monochloramine (NH 2 Cl) on the removal of 1,4-dioxane (1,4-D) for potable-water reuse. The dual oxidant effects of NH 2 Cl and S 2 O 8 2- on 1,4-D degradation were examined at various levels of oxidant dosage, chloride, and solution pH. Results showed that a NH 2 Cl-to-S 2 O 8 2- molar ratio of 0.1 was optimal, beyond which the scavenging by NH 2 Cl of HO • , SO 4 •- , and Cl 2 •- radicals decreased the 1,4-D degradation rate. At the optimal ratio, the degradation rate of 1,4-D increased linearly with the total oxidant dose up to 6 mM. The combined photolysis of NH 2 Cl and S 2 O 8 2- was sensitive to the solution pH due to a disproportionation of NH 2 Cl at pH lower than 6 into less-photoreactive dichloramine (NHCl 2 ) and radical scavenging by NH 4 + . The presence of chloride transformed HO • and SO 4 •- to Cl 2 •- that is less-reactive with 1,4-D, while the presence of dissolved O 2 promoted gaseous nitrogen production. Results from this study suggest that the presence of chloramines can be beneficial to persulfate photolysis in the removal of 1,4-D; however, the treatment efficiency depends on a careful control of an optimal NH 2 Cl dosage and a minimal chloride residue.

Selective hydrogen atom abstraction by hydrogen atoms in photolysis of cyclohexane-normal pentane mixtures at 77 K

International Nuclear Information System (INIS)

Miyazaky, T.; Guedes, S.M.L.; Andrade e Silva, L.G. de; Fernandes, L.

1977-01-01

The reaction of H atoms, produced by the photolysis of HI, has been studied in c-C 6 H 12 -n-C 5 H 12 mixtures at 77K. H atoms in c-C 6 H 12 matrix react more effectively with solute n-C 5 H 12 than solvent c-C 6 H 12 , while H atoms in n-C 5 H 12 matrix react more effectively with solute c-C 6 H 12 than solvent n-C 5 H 12 [pt

The effect of temperature and wavelength on production and photolysis of a UV-induced photosensitive DNA lesion which is not repaired in xeroderma pigmentosum variant cells

International Nuclear Information System (INIS)

Francis, A.A.; Carrier, W.L.; Regan, J.D.

1988-01-01

Ultraviolet light causes a type of damage to the DNA of human cells that results in a DNA strand break upon subsequent irradiation with wavelengths around 300 nm. This DNA damage disappears from normal human fibroblasts within 5 h, but not from pyrimidine dimer excision repair deficient xeroderma pigmentosum group A cells or from excision proficient xeroderma pigmentosum variant cells. The apparent lack of repair of the ultraviolet light DNA damage described here may contribute to the cancer prone nature of xeroderma pigmentosum variant individuals. These experiments show that the same amount of damage was produced at 0 0 C and 37 0 C indicating a photodynamic effect and not an enzymatic reaction. The disappearance of the photosensitive lesions from the DNA is probably enzymatic since none of the damage was removed at 0 0 C. Both the formation of the lesion and its photolysis by near ultraviolet light were wavelength dependent. An action spectrum for the formation of photosensitive lesions was similar to that for the formation of pyrimidine dimers and (6-4) photoproducts and included wavelengths found in sunlight. The DNA containing the lesions was sensitive to wavelengths from 304 to 340 nm with a maximum at 313 to 317 nm. This wavelength dependence of photolysis is similar to the absorption and photolysis spectra of the pyrimidine (6-4) photoproducts. (author)

Characterization of reactive intermediates in laser photolysis of nucleoside using of sodium salt anthraquinone-2-sulfonic acid as photosensitizer

International Nuclear Information System (INIS)

Ma Jianhua; Lin Weizhen; Wang Wenfeng; Han Zhenhui; Yao Side; Lin Nianyun

1999-01-01

The interaction of triplet state of sodium salt of anthraquinone-2-sulfonic acid (AQS) with nucleosides has been investigated in CH 3 CN using KrF(248 nm) laser flash photolysis. The transient absorption spectra and kinetics obtained from the interaction of triplet AQS and nucleoside demonstrated that the primary ionic radical pair, radical cation of nucleosides and radical anion of AQS has been detected simultaneously for the first time

Degradation of 4-chloro 2-aminophenol using a novel combined process based on hydrodynamic cavitation, UV photolysis and ozone.

Science.gov (United States)

Barik, Arati J; Gogate, Parag R

2016-05-01

The degradation of 4-chloro 2-aminophenol (4C2AP), an acute toxic organic compound, has been studied using different approaches based on the hydrodynamic cavitation (HC) with orifice plate as cavitating device, photolysis (UV) and ozonation (O3). The dependency of extent of degradation on operating parameters like operating pressure (2-5 bar), initial pH (3-8) and temperature (30-38 °C) have been established initially to maximize the efficacy of hydrodynamic cavitation. Subsequently the degradation has been studied using combined treatment strategies as HC+UV, HC+O3, UV+O3 and HC+UV+O3 at the established optimum parameters of operating temperature as 30 °C, initial pH of 6 and inlet pressure of 4 bar. The maximum extent of degradation as 96.85% and 73.6% reduction in TOC has been obtained using hydrodynamic cavitation in combination with UV photolysis and ozonation under the optimized operating conditions. The degradation products of 4C2AP have been identified using GC-MS. The present work has clearly established the efficacy of combined treatment approach (HC+UV+O3) for the removal of organic pollutant for the first time. Copyright © 2015 Elsevier B.V. All rights reserved.

The energy dependence of selective hydrogen atom abstraction by H(D) atoms in the photolysis of neopentane - ethane mixtures at 77 K

International Nuclear Information System (INIS)

Miyazaki, T.; Fueki, K.

1980-01-01

Selective hydrogen - atom - abstraction reaction by H or D atom has been studied in a neo C 5 H 12 - C 2 H 6 (less than 1 mol %) mixture at 77 K by ESR spectroscopy. The H (or D) atom produced by the photolysis of HI (or DI) reacts with neo - C 2 H 12 and C 2 H 6 to form neo - C 5 H 11 and C 2 H 5 radicals. In order to obtain H atoms with different kinetic energies, the photolysis was performed with different lights of 313, 254 and 229 nm. The selective formation of the C 2 H 5 radical by the reaction of the H (or D) atom with C 2 H 6 becomes more effective with the decrease in the energy of the H (or D) atom. The formation of the neo - C 5 H 11 radical by the reaction of the H (or D) atom with neo - C 2 H 12 becomes more effective with the increase in the energy of the H (or D) atom. (A.R.H.) [pt

Photolysis frequency measurement techniques: results of a comparison within the ACCENT project

Directory of Open Access Journals (Sweden)

K. C. Clemitshaw

2008-09-01

Full Text Available An intercomparison of different radiometric techniques measuring atmospheric photolysis frequencies j(NO₂, j(HCHO and j(O¹D was carried out in a two-week field campaign in June 2005 at Jülich, Germany. Three double-monochromator based spectroradiometers (DM-SR, three single-monochromator based spectroradiometers with diode-array detectors (SM-SR and seventeen filter radiometers (FR (ten j(NO₂-FR, seven j(O¹D-FR took part in this comparison. For j(NO₂, all spectroradiometer results agreed within ±3%. For j(HCHO, agreement was slightly poorer between −8% and +4% of the DM-SR reference result. For the SM-SR deviations were explained by poorer spectral resolutions and lower accuracies caused by decreased sensitivities of the photodiode arrays in a wavelength range below 350 nm. For j(O¹D, the results were more complex within +8% and −4% with increasing deviations towards larger solar zenith angles for the SM-SR. The direction and the magnitude of the deviations were dependent on the technique of background determination. All j(NO₂-FR showed good linearity with single calibration factors being sufficient to convert from output voltages to j(NO₂. Measurements were feasible until sunset and comparison with previous calibrations showed good long-term stability. For the j(O¹D-FR, conversion from output voltages to j(O¹D needed calibration factors and correction functions considering the influences of total ozone column and elevation of the sun. All instruments showed good linearity at photolysis frequencies exceeding about 10% of maximum values. At larger solar zenith angles, the agreement was non-uniform with deviations explainable by insufficient correction functions. Comparison with previous calibrations for some j(O¹D-FR indicated

Relationship between the NO2 photolysis frequency and the solar global irradiance

Directory of Open Access Journals (Sweden)

S. Fan

2009-11-01

Full Text Available Representative values of the atmospheric NO2 photolysis frequency j(NO2 are required for the adequate calculation and interpretation of NO and NO2 concentrations and exchange fluxes near the surface. Direct measurements of j(NO2 at ground level are often not available in field studies. In most cases, modeling approaches involving complex radiative transfer calculations are used to estimate j(NO2 and other photolysis frequencies for air chemistry studies. However, important input parameters for accurate modeling are often missing, most importantly with regard to the radiative effects of clouds. On the other hand, solar global irradiance ("global radiation", G is nowadays measured as a standard parameter in most field experiments and in many meteorological observation networks around the world. Previous studies mainly reported linear relationships between j(NO2 and G. We have measured j(NO2 using spectro- or filter radiometers and G using pyranometers side-by-side at several field sites. Our results cover a solar zenith angle range of 0–90°, and are based on nine field campaigns in temperate, subtropical and tropical environments during the period 1994–2008. We show that a second-order polynomial function (intercept = 0: j(NO2=(1+α× (B1×G+B2×G2, with α defined as the site-dependent UV-A surface albedo and the polynomial coefficients: B1=(1.47± 0.03×10-5 W−1 m2 s−1 and B2=(-4.84±0.31×10-9 W−2 m4 s−1 can be used to estimate ground-level j(NO2 directly from G, independent of solar zenith angle under all atmospheric conditions. The absolute j(NO2 residual of the empirical function is ±6×10-4 s−1(2σ. The relationship is valid for sites below 800 m a.s.l. and with low surface albedo (α<0.2. It is not valid in high mountains, above snow or ice and sandy or dry soil surfaces.

Synergism between anodic oxidation with diamond anodes and heterogeneous catalytic photolysis for the treatment of pharmaceutical pollutants

Directory of Open Access Journals (Sweden)

Juan M. Peralta-Hernández

2016-03-01

Full Text Available The mineralization of diclofenac and acetaminophen has been studied by single anodic oxidation with boron-doped diamond (AO-BDD using an undivided electrolysis cell, by single heterogeneous catalytic photolysis with titanium dioxide (HCP-TiO2 and by the combination of both advanced oxidation processes. The results show that mineralization can be obtained with either single technology. The type of functional groups of the pollutant does not influence the results of the single AO-BDD process, but it has a significant influence on the results obtained with HCP-TiO2. A clear synergistic effect appears when both processes are combined showing improvements in the oxidation rate of more than 50% for diclofenac and nearly 200% for acetaminophen at the highest current exerted. Results obtained are explained in terms of the production of oxidants on the surface of BDD (primarily peroxodisulfate and the later homogeneous catalytic light decomposition of these oxidants in the bulk. This mechanism is consistent with the larger improvement observed at higher current densities, for which the production of oxidants is promoted.

248-NM Laser Photolysis of CHBr3/O-Atom Mixtures: Kinetic Evidence for UV CO(A)-Chemiluminescence in the Reaction of Methylidyne Radicals With Atomic Oxygen

National Research Council Canada - National Science Library

Vaghjiani, Ghanshyam L

2005-01-01

4TH Positive and Cameron band emissions from electronically excited CO have been observed for the first time in 248-nm pulsed laser photolysis of a trace amount of CHBr3 vapor in an excess of O-atoms...

Is laparoscopic inguinal hernia repair more effective than open repair

International Nuclear Information System (INIS)

Aly, O.; Green, A.; Joy, M.; Wong, C.H.; Malik, M

2011-01-01

To systematically review randomized controlled trials, (RCT) evidence comparing Lichtenstein to total extraperitoneal (TEP) hernia repair in terms of clinical and cost effectiveness. Study Design: Case series. Place and Duration of Study: The study was conducted at University of Abderdeen, U.K. Methodology: A comprehensive online literature search was undertaken using databases such as MEDLINE, PubMed, EMBASE and Springerlink. Studies were then short listed according to the selection criteria (RCT with over 100 subject and English language publications from 1995 onwards) and appraised using the SIGN Methodology Checklist. A meta analysis of the data was also performed using RevMan software. Results: Analysis of reported data shows that TEP has less postoperative pain and return to work than Lichtenstein method. Operation time is shown to be longer in the TEP but this difference is shortened with increasing surgeon experience. The meta-analysis of the data on complications shows that there are no significant differences between the two types of procedures. TEP causes more short-term recurrences which are attributed to the learning curve effect. Long term recurrence rates on the other hand show no significant differences. At present TEP is slightly more expensive than Lichtenstein repair. Conclusion: Both TEP and Lichtenstein repair are clinically effective procedures. The choice between them should be made on a case-by-case basis; which depends on the patient's preference and characteristics such as age, work and health status. (author)

Organic carbon movement through two SWRO facilities from source water to pretreatment to product with relevance to membrane biofouling

KAUST Repository

Alshahri, Abdullah Hassan Mohammed

2016-12-29

The presence of algae, bacteria, various fractions of natural organic matter (NOM), and transparent exopolymer particles (TEP) in the raw water, after each pretreatment process and in the permeate and concentrate streams, were measured at two SWRO plants to assess biofouling potential. It was found that the most significant process controlling the concentration of algae, bacteria, and the biopolymer and humic substances was the intake type with the subsurface intake discharge showing significant reductions. The mixed media filtration process was marginally useful in removing some TOC and NOM, but had little effect on TEP removal. Some bacterial regrowth may be occurring in the cartridge filters, but the evidence is inconsistent. Significant quantities of the biopolymer and humic substance concentrations were found to be retained in the membranes, but the concentrations were significantly greater in the facility using an open-ocean intake. Bacteria and TEP were found in the permeate stream, which may document bacterial regrowth and TEP production downstream of the membrane process. Measurements of the organic carbon passage through SWRO facilities can be successfully used to evaluate pretreatment process effectiveness and to make SWRO plant operational improvements.

Flash photolysis of carbon dioxide in the far ultra-violet; Photolyse-eclair de l'anhydride carbonique dans l'ultra-violet lointain

Energy Technology Data Exchange (ETDEWEB)

Barat, F [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1970-07-01

The flash photolysis of CO{sub 2} (3 torr) in the far ultra-violet, down to the transparency limit of lithium fluoride, produces vibrationally excited CO in its {chi}{sup 1}{sigma} electronic ground state and an electronically excited oxygen atom O({sup 1}D). After photolysis, the changes in the concentration of vibrationally de-excited CO in the 0 to 200 {mu}sec, time range are followed using absorption spectroscopy. These changes can be explained on the basis of three main competing reactions: CO({chi}{sup 1}{sigma}, {nu}'' = 0) + O({sup 1}D) {yields} CO{sub 2}({sup 1}{sigma}{sub g}{sup +}), O({sup 1}D) + CO{sub 2} {yields} O({sup 3}P) + CO{sub 2} and CO{sub 3}, CO(X{sup 1}{sigma}, {nu}'' = 1,2) + CO{sub 2} {yields} CO({chi}{sup 1}{sigma}, {nu}'' = 0) + CO{sub 2}. The values of the rate constants for these three reactions are determined by analog calculations. The effect of O({sup 1}D) scavenging or quenching gases on the oxidation reaction of CO by O({sup 1}D) is examined. A study of the flash photolysis of O{sub 2} in the presence of CO in the far ultra-violet makes it possible to eliminate the hypothesis that CO{sub 3} is involved in the reaction leading to the disappearance of CO after photolysis. (author) [French] La photolyse eclair de CO{sub 2} (3 torrs) dans l'ultraviolet lointain, jusqu'a la limite de transparence du fluorure de lithium, produit CO vibrationnellement excite dans son etat electronique fondamental X et un atome d'oxygene electroniquement excite O({sup 1}D). Apres photolyse, on suit par spectroscopie d'absorption l'evolution de la concentration de CO vibrationnellement desexcite dans la gamme de temps s'etendant de 0 a 200 {mu}s. Cette evolution s'explique en admettant trois reactions concurrentes principales: CO({chi}{sup 1}{sigma}, {nu}'' = 0) + O({sup 1}D) {yields} CO{sub 2}({sup 1}{sigma}{sub g}{sup +}), O({sup 1}D) + CO{sub 2} {yields} O({sup 3}P) + CO{sub 2} et CO{sub 3}, CO(X{sup 1}{sigma}, {nu}'' = 1,2) + CO{sub 2} {yields} CO

Magnetic Field Effect: An Efficient Tool To Investigate The Mechanism Of Reactions Using Laser Flash Photolysis Technique

International Nuclear Information System (INIS)

Basu, Samita; Bose, Adity; Dey, Debarati

2008-01-01

Magnetic field effect combined with laser flash photolysis technique have been used to study the mechanism of interactions between two drug-like quinone molecules, Menadione (1,4-naphthoquinone, MQ) and 9, 10 Anthraquinone (AQ) with one of the DNA bases, Adenine in homogeneous acetonitrile/water and heterogeneous micellar media. A switchover in reaction mode from electron transfer to hydrogen abstraction is observed with MQ on changing the solvent from acetonitrile/water to micelle; whereas, AQ retains its mode of interaction towards Adenine as electron transfer in both the media due to its bulky structure compared to MQ

Intermittent theta-burst stimulation induces correlated changes in cortical and corticospinal excitability in healthy older subjects.

Science.gov (United States)

Gedankien, Tamara; Fried, Peter J; Pascual-Leone, Alvaro; Shafi, Mouhsin M

2017-12-01

We studied the correlation between motor evoked potentials (MEPs) and early TMS-evoked EEG potentials (TEPs) from single-pulse TMS before and after intermittent Theta Burst Stimulation (iTBS) to the left primary motor cortex (M1) in 17 healthy older participants. TMS was targeted to the hand region of M1 using a MRI-guided navigated brain stimulation system and a figure-of-eight biphasic coil. MEPs were recorded from the right first dorsal interosseous muscle using surface EMG. TEPs were extracted from a 61-channel EEG recording. Participants received 90 single TMS pulses at 120% of resting motor threshold before and after iTBS. Across all participants, the change in N15-P30 TEP and MEP amplitudes were significantly correlated (r=0.69; piTBS, whereas MEP amplitudes showed a significant increase. Changes in corticospinal reactivity and cortical reactivity induced by iTBS are related. However, the effect of iTBS on TEPs, unlike MEPs, is not straightforward. Our findings help elucidate the relationship between changes in cortical and corticospinal excitability in healthy older individuals. Going forward, TEPs may be used to evaluate the effects of theta-burst stimulation in non-motor brain regions. Copyright © 2017 International Federation of Clinical Neurophysiology. Published by Elsevier B.V. All rights reserved.

The use of self-gripping (Progrip™) mesh during laparoscopic total extraperitoneal (TEP) inguinal hernia repair: a prospective feasibility and long-term outcomes study.

Science.gov (United States)

Bresnahan, Erin; Bates, Andrew; Wu, Andrew; Reiner, Mark; Jacob, Brian

2015-09-01

The use of self-gripping mesh during laparoscopic TEP inguinal hernia repairs may eliminate the need for any additional fixation, and thus reduce post-operative pain without the added concern for mesh migration. Long-term outcomes are not yet prospectively studied in a controlled fashion. Under IRB approval, from January 2011-April 2013, 91 hernias were repaired laparoscopically with self-gripping mesh without additional fixation. Patients were followed for at least 1 year. Demographics and intraoperative data (defect location, size, and mesh deployment time) are recorded. VAS is used in the recovery room (RR) to score pain, and the Carolinas Comfort Scale ™ (CCS), a validated 0-5 pain/quality of life (QoL) score where a mean score of >1.0 means symptomatic pain, is employed at 2 weeks and at 1 year. Morbidities, narcotic usage, days to full activity and return to work, and CCS scores are reported. Sixty two patients, with 91 hernias repaired with self-gripping mesh, completed follow-up at a mean time period of 14.8 months. Seventeen hernias were direct defects (average size 3.0 cm). Mesh deployment time was 193.7 s. RR pain was 1.1/10 using a VAS. Total average oxycodone/acetaminophen (5 mg/325 mg) usage = 5.0 tablets, days to full activity was 1.6, and return to work was 4.2 days. Thirteen small asymptomatic seromas were palpated without any recurrences or groin tenderness, and all seromas resolved by the 6 month visit. Transient testis discomfort was reported in five patients. Urinary retention was 3.2%. Mean CCS™ scores at the first visit for groin pain laying, bending, sitting, walking, and step-climbing were 0.2, 0.5, 0.4, 0.3, and 0.3, respectively. At the first post op visit, 4.8% had symptomatic pain (CCS > 1). At 14.8 months, no patients reported symptomatic pain with CCS scores for all 62 patients averaging 0.02, (range 0-0.43). There are no recurrences thus far. Self-gripping mesh can be safely used during laparoscopic TEP inguinal hernia repairs

Seagrass as major source of transparent exopolymer particles in the oligotrophic Mediterranean coast

KAUST Repository

Iuculano, Francesca; Duarte, Carlos M.; Marbà , Nú ria; Agusti, Susana

2017-01-01

rates of TEP production by P. oceanica litter, allowing calculations of the associated TEP yield. We demonstrated that P. oceanica is an important source of TEP to the Mediterranean Sea, contributing an estimated 0.10 Tg C as TEP annually. TEP release

Primary processes in photolysis of octopus rhodopsin.

Science.gov (United States)

Ohtani, H; Kobayashi, T; Tsuda, M; Ebrey, T G

1988-01-01

The photolysis of octopus rhodopsin was studied by picosecond time-resolved spectroscopy at physiological temperature (8 degrees C) and by steady-state spectroscopy at very low temperature (10 K). Both hypsorhodopsin and bathorhodopsin were formed from a bathorhodopsin-like red-shifted intermediate "primerhodopsin," which was the primary photoproduct with our time resolution (36 ps). Though it was proposed that hypsorhodopsin is formed solely by a multiphoton process, the present results obtained by using blue light pulses (461 nm) of low intensity showed that hypsorhodopsin is formed by a single photon mechanism via thermal decay from primerhodopsin. When the excitation intensity is increased, a channel for the photochemical formation of hypsorhodopsin from primerhodopsin is opened. There are two thermal pathways leading from primerhodopsin. One process is the formation of hypsorhodopsin, which is later thermally converted to bathorhodopsin, and the other is the direct formation of bathorhodopsin from primerhodopsin. The formation efficiencies at room temperature of hypsorhodopsin and bathorhodopsin at very low excitation intensity were estimated to be larger than 0.6 and smaller than 0.4, respectively. The formation of hypsorhodopsin was also found in the early stages of the irradiation of octopus rhodopsin with weak continuous light at 10 K. However bathorhodopsin is formed three times more efficiently than hypsorhodopsin at 10 K.At physiological temperatures the formation of hypsorhodopsin in D(2)O takes place more slowly than in H(2)O. This indicates that the lifetime of primerhodopsin is decreased by H(2)O/D(2)O exchange. The rate constant for the primerhodopsin --> bathorhodopsin conversion is more sensitive than that for the primerhodopsin --> hypsorhodopsin conversion. The transformation of hypsorhodopsin to bathorhodopsin shows no deuterium effect at low temperature.

Analysis of Thioester-Containing Proteins during the Innate Immune Response of Drosophila melanogaster

Science.gov (United States)

Bou Aoun, Richard; Hetru, Charles; Troxler, Laurent; Doucet, Daniel; Ferrandon, Dominique; Matt, Nicolas

2010-01-01

Thioester-containing proteins (TEPs) are conserved proteins among insects that are thought to be involved in innate immunity. In Drosophila, the Tep family is composed of 6 genes named Tep1–Tep6. In this study, we investigated the phylogeny, expression pattern and roles of these genes in the host defense of Drosophila. Protostomian Tep genes are clustered in 3 distinct branches, 1 of which is specific to mosquitoes. Most D. melanogaster Tep genes are expressed in hemocytes, can be induced in the fat body, and are expressed in specific regions of the hypodermis. This expression pattern is consistent with a role in innate immunity. However, we find that TEP1, TEP2, and TEP4 are not strictly required in the body cavity to fight several bacterial and fungal infections. One possibility is that Drosophila TEPs act redundantly or that their absence can be compensated by other components of the immune response. TEPs may thus provide a subtle selective advantage during evolution. Alternatively, they may be required in host defense against specific as yet unidentified natural pathogens of Drosophila. PMID:21063077

Formation of tryptophan radicals in irradiated aqueous solutions of hexachloroplatinate(IV): a flash photolysis study.

Science.gov (United States)

Zang, L; Rodgers, M A

1999-10-01

The oxidation of tryptophan photosensitized by PtCl6(2-) has been investigated in aqueous solutions at different pH using nanosecond laser flash photolysis. Cationic and neutral radicals of tryptophan were detected at pH 2.8 and 8.5, respectively. The generation of the radical was attributed to oxidation by Cl2- that was formed from the homolytic bond cleavage in the excited state of PtCl6(2-). The bimolecular rate constant derived from the kinetics analysis, 2.8 +/- 0.2 x 10(9) M-1 s-1, is in good agreement with the value obtained in earlier pulse radiolysis studies. Both the cationic and neutral radicals decayed by second-order kinetics, consistent with the dimerization process.

Flash photolysis and pulse radiolysis of the Co(sep)3+-X- (sep = sepulchrate; X = I, Br) systems in aqueous solution

International Nuclear Information System (INIS)

Pina, F.; Maestri, M.; Ballardini, R.; Mulazzani, Q.G.; D'Angelantonio, M.; Balzani, V.

1986-01-01

The Co(sep) 3+ complex (sep = sepulchrate = 1,3,6,8,10,13,16,19-octaazabicyclo[6.6.6]eicosane) in aqueous solution forms ion pairs with the I - and Br - anions, which exhibit a relatively intense charge-transfer absorption. In deoxygenated aqueous solution no net reaction is obtained upon continuous light excitation in the ion-pair charge-transfer bands, but formation of transient species is observed in flash photolysis experiments. For the Co(sep) 3+ -I - system, I 2 - ions are formed that decay in the 50-μs time scale to give I 3 - . The latter species disappears in a time scale of seconds, leading the system back to the preexcitation conditions. For the Co(sep) 3+ -Br - system, only formation of the Br 2 - transient is observed, followed by regeneration of the preexcitation conditions in the 20-μs time scale. In order to elucidate the kinetic aspects of the transient formation and disappearance, pulse radiolysis experiments on the Co(sep) 3+ -I - and Co(sep) 3+ -Br - systems have been carried out. The rate constants of the reactions of Co(sep) 2+ with I 2 - , I 3 - , and Br 2 - have been measured, and a complete picture of the redox processes that follow flash photolysis and pulse radiolysis excitations has been obtained. 5 figures

Effects of blue or violet light on the inactivation of Staphylococcus aureus by riboflavin-5'-phosphate photolysis.

Science.gov (United States)

Wong, Tak-Wah; Cheng, Chien-Wei; Hsieh, Zong-Jhe; Liang, Ji-Yuan

2017-08-01

The light sensitive compound riboflavin-5'-phosphate (or flavin mononucleotide, FMN) generates reactive oxygen species (ROS) upon photo-irradiation. FMN is required by all flavoproteins because it is a cofactor of biological blue-light receptors. The photochemical effects of FMN after irradiation by blue or violet light on the inactivation of Staphylococcus aureus strains, including a methicillin-resistant strain (MRSA), were investigated in this study. Upon blue- or violet-light photo-treatment, FMN was shown to inactivate S. aureus due to the generated ROS. Effective bacterial inactivation can be achieved by FMN photolysis without an exogenous electron provider. Inactivation rates of 94.9 and 95.2% in S. aureus and MRSA, respectively, can be reached by blue light irradiation (2.0mW/cm 2 ) with 120μM FMN for 120min. A lower FMN concentration and a shorter time are required to reach similar effects by violet light irradiation. Inactivation rates of 96.3 and 97.0% in S. aureus and MRSA, respectively, can be reached by violet light irradiation (1.0mW/cm 2 ) with 30μM FMN for 30min. The sensitivity of the inherent photosensitizers is lower under blue-light irradiation. A long exposure photolytic treatment of FMN by blue light is required to inactivate S. aureus. Violet light was found to be more efficient in S. aureus inactivation at the same radiant intensity. FMN photolysis with blue or violet light irradiation enhanced the inactivation rates of S. aureus and MRSA. FMN photochemical treatment could be a supplemental technique in hygienic decontamination processes. Copyright © 2017 Elsevier B.V. All rights reserved.

Study of the spectra of silica colloidal crystals with assembled silver obtained from a photolysis method

Science.gov (United States)

Li, Wenjiang; He, Jinglong; He, Sailing

2005-02-01

The colorful artificial 3D silica colloidal crystals (opal) were prepared through self-assembly of silica spheres in the visible frequency range. We directly synthesized nano silver particles in the void of the silica artificial opal film using the photolysis of silver nitrate under UV light, nano silver particles were self-deposited around the surface of silica sphere. The shifts of the stop band of the artificial crystals after exposing different time under UV light were studied. Synthetic silica opal with three-dimensional (3D) structure is potentially useful for the development of diffractive optical devices, micro mechanical systems, and sensory elements because photonic band gaps obtained from self-assembled closely packed periodic structures.

FORMATION OF N{sub 3}, CH{sub 3}, HCN, AND HNC FROM THE FAR-UV PHOTOLYSIS OF CH{sub 4} IN NITROGEN ICE

Energy Technology Data Exchange (ETDEWEB)

Lo, Jen-Iu; Chou, Sheng-Lung; Peng, Yu-Chain; Lin, Meng-Yeh; Lu, Hsiao-Chi; Cheng, Bing-Ming, E-mail: bmcheng@nsrrc.org.tw [National Synchrotron Radiation Research Center, No. 101, Hsin-Ann Road, Hsinchu Science Park, Hsinchu 30076, Taiwan (China)

2015-11-15

The irradiation of pure solid N{sub 2} at 3 K with far-ultraviolet light from a synchrotron produced infrared absorption lines at 1657.7, 1655.6, and 1652.4 cm{sup −1} and an ultraviolet absorption line at 272.0 nm, which are characteristic of the product N{sub 3}. The threshold wavelength at which N{sub 3} was generated was 145.6 ± 2.9 nm, corresponding to an energy of 8.52 ± 0.17 eV. The photolysis of isotopically labeled {sup 15}N{sub 2} at 3 K consistently led to the formation of {sup 15}N{sub 3} with the same threshold wavelength of 145.6 ± 2.9 nm for its formation. The photolysis of CH{sub 4} in nitrogen ice in low concentrations also led to the formation of N{sub 3}, together with CH{sub 3}, HCN, and HNC, with the same threshold wavelength of 145.6 ± 2.9 nm. These results indicate that N{sub 3} radicals may play an important role in the photochemistry of nitrogen ices in astronomical environments.

Ultraviolet and chemical induced DNA repair in human cells assayed by bromodeoxyuridine photolysis or cytosine arabinoside arrest

International Nuclear Information System (INIS)

Regan, J.D.; Dunn, W.C.

1979-01-01

The bromodeoxyuridine photolysis assay of DNA damage in human cells permits an estimate of both the number of repaired regions in the DNA and the size of the average repaired region - the patch size. The antineoplastic agent arabinofuranosyl cytosine (ara-C) can also be employed to assay the magnitude of repair since this agent appears to block rejoining of single-strand incisions made in the DNA during the initial step of repair. Thus, the number of incisions can be accumulated. The ara-C effect is dependent on the presence of hydroxyurea. Both assays can be employed for the study of physical or chemical DNA damages. Results comparing these assays are presented

Theoretical study on the photolysis mechanism of 2,3-diazabicyclo[2.2.2]oct-2-ene.

Science.gov (United States)

Chen, Hui; Li, Shuhua

2005-09-28

A CASPT2/CASSCF study has been carried out to investigate the mechanism of the photolysis of 2,3-diazabicyclo[2.2.2]oct-2-ene (DBO) under direct and triplet-sensitized irradiation. By exploring the detailed potential energy surfaces including intermediates, transition states, conical intersections, and singlet/triplet crossing points, for the first excited singlet (S(1)) and the low-lying triplet states (T(1), T(2), and T(3)), we provide satisfactory explanations of many experimental findings associated with the photophysical and photochemical processes of DBO. A key finding of this work is the existence of a significantly twisted S(1) minimum, which can satisfactorily explain the envelope of the broad emission band of DBO. It is demonstrated that the S(1) (n-pi*) intermediate can decay to the T(1) (n-pi*) state by undergoing intersystem crossing (rather inefficient) to the T(2) (pi-pi*) state followed by internal conversion to the T(1) state. The high fluorescence yield and the extraordinarily long lifetime of the singlet excited DBO are due to the presence of relatively high barriers, both for intersystem crossing and for C-N cleavage. The short lifetime of the triplet DBO is caused by fast radiationless decay to the ground state.

UV and VUV photolysis vs. UV/H2O2 and VUV/H2O2, treatment for removal of clofibric acid from aqueous solution.

Science.gov (United States)

Li, Wenzhen; Lu, Shuguang; Qiu, Zhaofu; Lin, Kuangfei

2011-07-01

Clofibric acid (CA), a metabolite of lipid regulators, was investigated in ultra-pure water and sewage treatment plant (STP) effluent at 10 degrees C under UV, vacuum UV (VUV), UV/H2O2 and VUV/H2O2 processes. The influences of NO3-, HCO3- and humic acid (HA) on CA photolysis in all processes were examined. The results showed that all the experimental data well fitted the pseudo-first-order kinetic model, and the apparent rate constant (k(ap)) and half-life time (t(1/2)) were calculated accordingly. Direct photolysis of CA through UV irradiation was the main process, compared with the indirect oxidation of CA due to the slight generation of hydroxyl radicals dissociated from water molecules under UV irradiation below 200 nm monochromatic wavelength emission. In contrast, indirect oxidation was the main CA degradation mechanism in UV/H2O2 and VUV/H2O2, and VUV/H2O2 was the most effective process for CA degradation. The addition of 20 mg L(-1) HA could significantly inhibit CA degradation, whereas, except for UV irradiation, the inhibitive effects of NO3- and HCO3- (1.0 x 10(-3) and 0.1 mol L(-1), respectively) on CA degradation were observed in all processes, and their adverse effects were more significant in UV/H2O2 and VUV/H2O2 processes, particularly at the high NO3- and HCO3- concentrations. The degradation rate decreased 1.8-4.9-fold when these processes were applied to a real STP effluent owing to the presence of complex constituents. Of the four processes, VUV/H2O2 was the most effective, and the CA removal efficiency reached over 99% after 40 min in contrast to 80 min in both the UV/H2O2 and VUV processes and 240 min in the UV process.

Combined photolysis and catalytic ozonation of dimethyl phthalate in a high-gravity rotating packed bed

Energy Technology Data Exchange (ETDEWEB)

Chang, C.-C. [Graduate Institute of Environmental Engineering, National Taiwan University, Taipei 106, Taiwan (China); Chiu, C.-Y. [Department of Cosmetic Science and Application, Lan-Yang Institute of Technology, I-Lan 261, Taiwan (China); Chang, C.-Y. [Graduate Institute of Environmental Engineering, National Taiwan University, Taipei 106, Taiwan (China)], E-mail: cychang3@ntu.edu.tw; Chang, C.-F. [Department of Environmental Science and Engineering, Tunghai University, Taichung 407, Taiwan (China); Chen, Y.-H. [Department of Chemical and Material Engineering, National Kaohsiung University of Applied Science, Kaohsiung City 807, Taiwan (China); Ji, D.-R.; Yu, Y.-H.; Chiang, P.-C. [Graduate Institute of Environmental Engineering, National Taiwan University, Taipei 106, Taiwan (China)

2009-01-15

In this study, a high-gravity rotating packed bed (HGRPB) was used as a catalytic ozonation reactor to decompose dimethyl phthalate (DMP), an endocrine disrupting chemical commonly encountered. The HGRPB is an effective gas-liquid mixing equipment which can enhance the ozone mass transfer coefficient. Platinum-containing catalyst (Pt/-Al{sub 2}O{sub 3}) of Dash 220N and ultra violet (UV) lamp were combined in the high-gravity ozonation (HG-OZ) system to enhance the self-decomposition of molecular ozone in liquid to form highly reactive radical species. Different combinations of HG-OZ with Dash 220N and UV for the degradation of DMP were tested. These include HG-OZ, HG catalytic OZ (HG-Pt-OZ), HG photolysis OZ (HG-UV-OZ) and HG-UV-Pt-OZ. The result indicated that all the above four ozonation processes result in significant decomposition of DMP and mineralization of total organic carbon (TOC) at the applied ozone dosage per volume of liquid sample of 1.2 g L{sup -1}. The UV and Pt/{gamma}-Al{sub 2}O{sub 3} combined in HG-OZ can enhance the TOC mineralization efficiency ({eta}{sub TOC}) to 56% (via HG-UV-OZ) and 57% (via HG-Pt-OZ), respectively, while only 45% with ozone only. The process of HG-UV-Pt-OZ offers the highest {eta}{sub TOC} of about 68%.

Synthesis and Evaluation of Porous Semiconductor Hexaniobate Nanotubes for Photolysis of Organic Dyes in Wastewater

Directory of Open Access Journals (Sweden)

Maryam Zarei-Chaleshtori

2014-10-01

Full Text Available We present the chemical synthesis of hexaniobate nanotubes using two routes, (1 starting material K4Nb6O17 and (2 parent material of H4Nb6O17 via ion exchange. The as-synthesized materials were exfoliated by adjusting the pH to 9–10 using tetra-n-butylammonioum hydroxide (TBA+OH−, leading to a formation of hexaniobate nanotubes. In order to understand morphology a full characterization was conducted using SEM, HRTEM, BET and powder-XRD. The photocatalytic activity was evaluated using photolysis method using Bromocresol Green (BG and Methyl Orange (MO as model contaminants. Results indicate a nanotube porous oxide with large porous and surface area; the photocatalytic activity is about 95% efficient when comparing with commercial TiO2.

Short-interval and long-interval intracortical inhibition of TMS-evoked EEG potentials.

Science.gov (United States)

Premoli, Isabella; Király, Julia; Müller-Dahlhaus, Florian; Zipser, Carl M; Rossini, Pierre; Zrenner, Christoph; Ziemann, Ulf; Belardinelli, Paolo

2018-03-15

Inhibition in the human motor cortex can be probed by means of paired-pulse transcranial magnetic stimulation (ppTMS) at interstimulus intervals of 2-3 ms (short-interval intracortical inhibition, SICI) or ∼100 ms (long-interval intracortical inhibition, LICI). Conventionally, SICI and LICI are recorded as motor evoked potential (MEP) inhibition in the hand muscle. Pharmacological experiments indicate that they are mediated by GABAA and GABAB receptors, respectively. SICI and LICI of TMS-evoked EEG potentials (TEPs) and their pharmacological properties have not been systematically studied. Here, we sought to examine SICI by ppTMS-evoked compared to single-pulse TMS-evoked TEPs, to investigate its pharmacological manipulation and to compare SICI with our previous results on LICI. PpTMS-EEG was applied to the left motor cortex in 16 healthy subjects in a randomized, double-blind placebo-controlled crossover design, testing the effects of a single oral dose 20 mg of diazepam, a positive modulator at the GABAA receptor, vs. 50 mg of the GABAB receptor agonist baclofen on SICI of TEPs. We found significant SICI of the N100 and P180 TEPs prior to drug intake. Diazepam reduced SICI of the N100 TEP, while baclofen enhanced it. Compared to our previous ppTMS-EEG results on LICI, the SICI effects on TEPs, including their drug modulation, were largely analogous. Findings suggest a similar interaction of paired-pulse effects on TEPs irrespective of the interstimulus interval. Therefore, SICI and LICI as measured with TEPs cannot be directly derived from SICI and LICI measured with MEPs, but may offer novel insight into paired-pulse responses recorded directly from the brain rather than muscle. Copyright © 2018 Elsevier Inc. All rights reserved.

Degradation study of pesticides by direct photolysis - Structural characterization and potential toxicity of photo products

International Nuclear Information System (INIS)

Rifai, A.

2013-01-01

Pesticides belong to the large family of organic pollutants. In general, they are intended to fight against crop pests. Distribution of pesticides in nature creates pollution in DIFFERENT compartments of the biosphere (water, soil and air) and can induce acute toxic effects on human beings of the terrestrial and aquatic living biomass. It is now shown that some pesticides are endocrine disruptors and are particularly carcinogenic and mutagenic effects in humans. Pesticides can undergo various processes of transformation in the natural life cycle (biodegradation, volatilization, solar radiation ...) or following applied in the sectors of natural water purification and treatment stations sewage treatment. The presence of degradation products of pesticides in our environment is even more alarming that their structures and potential toxicities generally unknown. Molecules belonging to two families of pesticides were selected for this study: herbicides, represented by metolachlor, and fungicides represented by procymidone, pyrimethanil and boscalid. The first part of the thesis focused on the development of an analytical strategy to characterize the structures of compounds from degradation by photolysis of pesticides. The second part focused on estimating the toxicity of degradation products using a test database in silico. Identification of degradation products was achieved through two complementary analysis techniques: the gas chromatography coupled to a mass spectrometer ''multi-stage'' (GC-MSn) and liquid chromatography coupled to a tandem mass spectrometer (LC-MS/MS). The estimation of the toxicity of the degradation products was performed using the TEST program QSAR recently developed to try to predict the toxicity of molecules. The strategy of the structural elucidation of degradation products of pesticides studied is based on studying of the mechanisms of fragmentation of parent molecules of the degradation products. The molar mass of parent

Seagrass as major source of transparent exopolymer particles in the oligotrophic Mediterranean coast

KAUST Repository

Iuculano, Francesca

2017-01-09

The role of seagrass, Posidonia oceanica, meadows as a source of transparent exopolymer particles (TEP) to Mediterranean coastal waters was tested by comparing the TEP dynamics in two adjacent coastal waters in the oligotrophic NW Mediterranean Sea, one characterized by oligotrophic open-sea waters and the other accumulating seagrass leaf litter, together with an experimental examination of TEP release by seagrass litter. TEP concentrations ranged from 4.6 µg XG Eq L−1 to 90.6 µg XG Eq L−1, with mean (±SE) values of 38.7 (±2.02) µg XG Eq L−1 in the site devoid of seagrass litter, whereas the coastal beach site accumulating leaf litter had > 10-fold mean TEP concentrations of 487.02 (±72.8) µg XG Eq L−1 . Experimental evaluation confirmed high rates of TEP production by P. oceanica litter, allowing calculations of the associated TEP yield. We demonstrated that P. oceanica is an important source of TEP to the Mediterranean Sea, contributing an estimated 0.10 Tg C as TEP annually. TEP release by P. oceanica seagrass explains the elevated TEP concentration relative to the low chlorophyll a concentration in the Mediterranean Sea.

Photolysis of polycyclic aromatic hydrocarbons (PAHs) on Fe3+-montmorillonite surface under visible light: Degradation kinetics, mechanism, and toxicity assessments.

Science.gov (United States)

Zhao, Song; Jia, Hanzhong; Nulaji, Gulimire; Gao, Hongwei; Wang, Fu; Wang, Chuanyi

2017-10-01

Photochemical behavior of various polycyclic aromatic hydrocarbons (PAHs) on Fe 3+ -modified montmorillonite was explored to determine their potential kinetics, pathways, and mechanism under visible light. Depending on the type of PAH molecules, the transformation rate follows the order of benzo[a]pyrene ≈ anthracene > benzo[a]anthracene > phenanthrene. Quantum simulation results confirm the crucial role of "cation-π" interaction between Fe 3+ and PAHs on their transformation kinetics. Primary intermediates, including quinones, ring-opening products and benzene derivatives, were identified by gas chromatography-mass spectrometer (GC-MS), and the possible photodegradation pathway of benzo[a]pyrene was proposed. Meanwhile, radical intermediates, such as reactive oxygen species (ROS) and free organic radicals, were detected by electron paramagnetic resonance (EPR) technique. The photolysis of selected PAHs, such as anthracene and benzo[a]pyrene, on clay surface firstly occurs by electron transfer from PAHs to Fe 3+ -montmorillonite, followed by degradation involving photo-induced ROS such as ·OH and ·O 2 - . To investigate the acute toxicity of photolysis products, the Microtox ® toxicity test was performed during the photodegradation processes of various PAHs. As a result, the photo-irradiation initially induces increased toxicity by generating reactive intermediates, such as free organic radicals, and then the toxicity gradually decreases with increasing of reaction time. Overall, the present study provides useful information to understand the fate and photo-transformation of PAHs in contaminated soils. Copyright © 2017 Elsevier Ltd. All rights reserved.

3D-printed tracheoesophageal puncture and prosthesis placement simulator.

Science.gov (United States)

Barber, Samuel R; Kozin, Elliott D; Naunheim, Matthew R; Sethi, Rosh; Remenschneider, Aaron K; Deschler, Daniel G

A tracheoesophageal prosthesis (TEP) allows for speech after total laryngectomy. However, TEP placement is technically challenging, requiring a coordinated series of steps. Surgical simulators improve technical skills and reduce operative time. We hypothesize that a reusable 3-dimensional (3D)-printed TEP simulator will facilitate comprehension and rehearsal prior to actual procedures. The simulator was designed using Fusion360 (Autodesk, San Rafael, CA). Components were 3D-printed in-house using an Ultimaker 2+ (Ultimaker, Netherlands). Squid simulated the common tracheoesophageal wall. A Blom-Singer TEP (InHealth Technologies, Carpinteria, CA) replicated placement. Subjects watched an instructional video and completed pre- and post-simulation surveys. The simulator comprised 3D-printed parts: the esophageal lumen and superficial stoma. Squid was placed between components. Ten trainees participated. Significant differences existed between junior and senior residents with surveys regarding anatomy knowledge(p<0.05), technical details(p<0.01), and equipment setup(p<0.01). Subjects agreed that simulation felt accurate, and rehearsal raised confidence in future procedures. A 3D-printed TEP simulator is feasible for surgical training. Simulation involving multiple steps may accelerate technical skills and improve education. Copyright © 2017 Elsevier Inc. All rights reserved.

Optimization of Nano-TiO Photocatalytic Reactor for Organophosphorus Degradation

Directory of Open Access Journals (Sweden)

Ilin Sadeghi

2012-01-01

Full Text Available The photocatalytic decontamination of triethyl phosphate (TEP is studied by the UV/nano-TiO2 process. The nano-TiO2 concentration and pH value for the complete oxidation of TEP were investigated in different concentrations of TEP. The kinetic reaction was calculated for TEP as a function of initial concentration of TEP. Results of adsorptions showed that TEP was adsorbed better in alkalinity pH, and the natural pH had the highest reaction rate for complete degradation. Also, the zero-kinetic order with the lag time as a function of initial concentration of TEP and TiO2 was suggested for oxidation of TEP. The optimized concentration of nano-TiO2 was 400 mg/lit which had the best conversion and the lowest lag time in the reaction.

Vacuum ultraviolet photolysis of diclofenac and the effects of its treated aqueous solutions on the proliferation and migratory responses of Tetrahymena pyriformis

International Nuclear Information System (INIS)

Arany, Eszter; Láng, Júlia; Somogyvári, Dávid; Láng, Orsolya; Alapi, Tünde; Ilisz, István

2014-01-01

The effects of dissolved O 2 , phosphate buffer and the initial concentration of diclofenac on the vacuum ultraviolet photolysis of this contaminant molecule were studied. Besides kinetic measurements, the irradiated, multicomponent samples were characterized via the proliferation and migratory responses (in sublethal concentrations) of the bioindicator eukaryotic ciliate Tetrahymena pyriformis. The results suggest that hydroxyl radicals, hydrogen atoms and hydroperoxyl radicals may all contribute to the degradation of diclofenac. The aromatic by-products of diclofenac were presumed to include a hydroxylated derivative, 1-(8-chlorocarbazolyl)acetic acid and 1-(8-hydroxycarbazolyl)acetic acid. The biological activity of photoexposed samples reflected the chemical transformation of diclofenac and was also dependent on the level of dissolved O 2 . The increase in toxicity of samples taken after different irradiation times did not exceed a factor of two. Our results suggest that the combination of vacuum ultraviolet photolysis with toxicity and chemotactic measurements can be a valuable method for the investigation of the elimination of micropollutants. - Highlights: • The radical-scavenging effect of phosphates seems to be negligible. • Only higher concentrations of HO 2 · contribute to the degradation of diclofenac. • Toxicity of VUV-treated samples decreases with increasing rate of mineralization. • Dissolved O 2 enhances the mineralization of diclofenac by affecting the radical set. • Treated samples retain the chemorepellent character of the parent compound

Vacuum ultraviolet photolysis of diclofenac and the effects of its treated aqueous solutions on the proliferation and migratory responses of Tetrahymena pyriformis

Energy Technology Data Exchange (ETDEWEB)

Arany, Eszter [Research Group of Environmental Chemistry, Institute of Chemistry, University of Szeged, H-6720 Szeged, Rerrich Béla tér 1 (Hungary); Láng, Júlia [Department of Genetics, Cell- and Immunobiology, Semmelweis University, H-1089 Budapest, Nagyvárad tér 4 (Hungary); Somogyvári, Dávid [Research Group of Environmental Chemistry, Institute of Chemistry, University of Szeged, H-6720 Szeged, Rerrich Béla tér 1 (Hungary); Láng, Orsolya [Department of Genetics, Cell- and Immunobiology, Semmelweis University, H-1089 Budapest, Nagyvárad tér 4 (Hungary); Alapi, Tünde [Research Group of Environmental Chemistry, Institute of Chemistry, University of Szeged, H-6720 Szeged, Rerrich Béla tér 1 (Hungary); Department of Inorganic and Analytical Chemistry, University of Szeged, H-6720 Szeged, Dóm tér 7 (Hungary); Ilisz, István [Department of Inorganic and Analytical Chemistry, University of Szeged, H-6720 Szeged, Dóm tér 7 (Hungary); and others

2014-01-01

The effects of dissolved O{sub 2}, phosphate buffer and the initial concentration of diclofenac on the vacuum ultraviolet photolysis of this contaminant molecule were studied. Besides kinetic measurements, the irradiated, multicomponent samples were characterized via the proliferation and migratory responses (in sublethal concentrations) of the bioindicator eukaryotic ciliate Tetrahymena pyriformis. The results suggest that hydroxyl radicals, hydrogen atoms and hydroperoxyl radicals may all contribute to the degradation of diclofenac. The aromatic by-products of diclofenac were presumed to include a hydroxylated derivative, 1-(8-chlorocarbazolyl)acetic acid and 1-(8-hydroxycarbazolyl)acetic acid. The biological activity of photoexposed samples reflected the chemical transformation of diclofenac and was also dependent on the level of dissolved O{sub 2}. The increase in toxicity of samples taken after different irradiation times did not exceed a factor of two. Our results suggest that the combination of vacuum ultraviolet photolysis with toxicity and chemotactic measurements can be a valuable method for the investigation of the elimination of micropollutants. - Highlights: • The radical-scavenging effect of phosphates seems to be negligible. • Only higher concentrations of HO{sub 2}{sup ·} contribute to the degradation of diclofenac. • Toxicity of VUV-treated samples decreases with increasing rate of mineralization. • Dissolved O{sub 2} enhances the mineralization of diclofenac by affecting the radical set. • Treated samples retain the chemorepellent character of the parent compound.

Exopolymer Particles in the Sea Surface Microlayer (SML) of the Coastal Pacific Ocean

Science.gov (United States)

Thornton, D. C.; Brooks, S. D.; Chen, J.

2015-12-01

Exchanges of matter and energy between the ocean and atmosphere occur through the sea surface microlayer (SML). The SML is biogeochemically distinct from the underlying water and overlying atmosphere in terms of physical environment, chemical composition, and biological community. We sampled the Pacific Ocean in coastal waters off the state of Oregon (United States) along a seaward transect out from the mouth of the Columbia River (3 stations) and in deeper waters beyond the shelf break (2 stations) in July 2011. SML samples were collected using the glass plate method and the underlying water was sampled using a peristaltic pump from 1, 5 and 10 m depth. The samples were analyzed for carbohydrates and exopolymer particles. Carbohydrates were significantly enriched in the SML compared with the underlying water. The concentration of polysaccharides was higher than monosaccharides at all depths. We enumerated two classes of exopolymer particles: transparent exopolymer particles (TEP) and Coomassie staining particles (CSP). TEP are composed of acid polysaccharides and CSP are formed from proteins. While TEP have been widely studied, CSP are generally overlooked, despite the biogeochemical significance of proteins. Our data showed that TEP and CSP concentrations were enriched in the SML compared with the underlying waters in most cases. The ubiquitous presence of empty diatom frustules in the samples indicates that the collapse of a diatom bloom was the source of the exopolymers. Further, we conducted image analysis of particle size and abundance, which indicated that TEP and CSP are not the same particles and form distinct populations in the ocean. Our data confirm recent observations indicating that TEP are an important component of the SML. In addition, these data show that CSP are also important components of the SML.

A structured, extended training program to facilitate adoption of new techniques for practicing surgeons.

Science.gov (United States)

Greenberg, Jacob A; Jolles, Sally; Sullivan, Sarah; Quamme, Sudha Pavuluri; Funk, Luke M; Lidor, Anne O; Greenberg, Caprice; Pugh, Carla M

2018-01-01

Laparoscopic inguinal hernia repair has been shown to have significant benefits when compared to open inguinal hernia repair, yet remains underutilized in the United States. The traditional model of short, hands-on, cognitive courses to enhance the adoption of new techniques fails to lead to significant levels of practice implementation for most surgeons. We hypothesized that a comprehensive program would facilitate the adoption of laparoscopic inguinal hernia repair (TEP) for practicing surgeons. A team of experts in simulation, coaching, and hernia care created a comprehensive training program to facilitate the adoption of TEP. Three surgeons who routinely performed open inguinal hernia repair with greater than 50 cases annually were recruited to participate in the program. Coaches were selected based on their procedural expertise and underwent formal training in surgical coaching. Participants were required to evaluate all aspects of the educational program and were surveyed out to one year following completion of the program to assess for sustained adoption of TEP. All three participants successfully completed the first three steps of the seven-step program. Two participants completed the full course, while the third dropped out of the program due to time constraints and low case volume. Participant surgeons rated Orientation (4.7/5), GlovesOn training (5/5), and Preceptored Cases (5/5) as highly important training activities that contributed to advancing their knowledge and technical performance of the TEP procedure. At one year, both participants were performing TEPs for "most of their cases" and were confident in their ability to perform the procedure. The total cost of the program including all travel, personal coaching, and simulation was $8638.60 per participant. Our comprehensive educational program led to full and sustained adoption of TEP for those who completed the course. Time constraints, travel costs, and case volume are major considerations for

Community-Based Global Health Program for Maltreated Children and Adolescents in Brazil: The Equilibrium Program (TEP

Directory of Open Access Journals (Sweden)

Andrea Horvath Marques

2015-07-01

Full Text Available The maltreatment of children and adolescents is a global public health problem that affects high and low-middle income countries (LMICs. In the United States, around 1.2 million children suffer from abuse, while in LMICs such as Brazil these rates are much higher (an estimated 28 million children. Exposition to early environmental stress has been associated with suboptimal physical and brain development, persistent cognitive impairment and behavioral problems. Studies have reported that children exposed to maltreatment are at high risk of behavioral problems, learning disabilities, communication and psychiatric disorders and general clinical conditions such as obesity and systemic inflammation later in life. The aim of this paper is to describe The Equilibrium Program (TEP, a community-based global health program implemented in São Paulo, Brazil to serve traumatized and neglected children and adolescents. We will describe and discuss TEP’s implementation, highlighting its innovation aspects, research projects developed within the program as well as its population profile. Finally, we will discuss TEP’s social impact, challenges and limitations. The program’s goal is to promote the social and family reintegration of maltreated children and adolescents through an interdisciplinary intervention program that provides multi-dimensional bio-psycho-social treatment integrated with the diverse services needed to meet the unique demands of this population. The program’s cost-effectiveness is being evaluated to support the development of more effective treatments and to expand similar programs in other areas of Brazil. Policy makers should encourage early evidence-based interventions for disadvantaged children to promote healthier psychosocial environments and provide them opportunities to become healthy and productive adults. This approach has already shown itself to be a cost-effective strategy to prevent disease and promote health.

Protein and carbohydrate exopolymer particles in the sea surface microlayer (SML

Directory of Open Access Journals (Sweden)

Daniel Conrad Ogilvie Thornton

2016-08-01

Full Text Available Exchanges of matter and energy between ocean and atmosphere occur through the sea surface microlayer (SML. The SML is the thin surface layer of the ocean at the ocean-atmosphere interface that has distinctive physical, chemical and biological properties compared with the underlying water. We measured the concentration of two types of exopolymer particles in the SML and underlying water in the Pacific Ocean off the coast of Oregon (United States during July 2011. Transparent exopolymer particles (TEP are defined by their acidic polysaccharide content, whereas Coomassie staining particles (CSP are composed of protein. TEP and CSP were ubiquitous in the SML. TEP were not significantly enriched in the SML compared with the underlying water. CSP were significantly enriched in the SML, with an enrichment factor (EF of 1.4 to 2.4. The distribution of exopolymer particles in the water and microscopic imaging indicated that TEP and CSP are distinct populations of particles rather than different chemical components of the same particles. Dissolved polysaccharides were not enriched in the SML, whereas monosaccharides had an EF of 1.2 to 1.8. Sampling occurred during the collapse of a diatom bloom, and diatoms were found both in the water column and SML. While there were living diatoms in the samples, most of the diatoms were dead and there were abundant empty frustules covered in layer of TEP. The collapsing diatom bloom was probably the source of exopolymer particles to both the SML and underlying water. Exopolymer particles are a component of the SML that may play a significant role in the marine carbon and nitrogen cycles, and the exchange of material between ocean and atmosphere.

Photolysis of CH₃CHO at 248 nm: evidence of triple fragmentation from primary quantum yield of CH₃ and HCO radicals and H atoms.

Science.gov (United States)

Morajkar, Pranay; Bossolasco, Adriana; Schoemaecker, Coralie; Fittschen, Christa

2014-06-07

Radical quantum yields have been measured following the 248 nm photolysis of acetaldehyde, CH3CHO. HCO radical and H atom yields have been quantified by time resolved continuous wave Cavity Ring Down Spectroscopy in the near infrared following their conversion to HO2 radicals by reaction with O2. The CH3 radical yield has been determined using the same technique following their conversion into CH3O2. Absolute yields have been deduced for HCO radicals and H atoms through fitting of time resolved HO2 profiles, obtained under various O2 concentrations, to a complex model, while the CH3 yield has been determined relative to the CH3 yield from 248 nm photolysis of CH3I. Time resolved HO2 profiles under very low O2 concentrations suggest that another unknown HO2 forming reaction path exists in this reaction system besides the conversion of HCO radicals and H atoms by reaction with O2. HO2 profiles can be well reproduced under a large range of experimental conditions with the following quantum yields: CH3CHO + hν(248nm) → CH3CHO*, CH3CHO* → CH3 + HCO ϕ(1a) = 0.125 ± 0.03, CH3CHO* → CH3 + H + CO ϕ(1e) = 0.205 ± 0.04, CH3CHO*[Formula: see text]CH3CO + HO2 ϕ(1f) = 0.07 ± 0.01. The CH3O2 quantum yield has been determined in separate experiments as ϕ(CH₃) = 0.33 ± 0.03 and is in excellent agreement with the CH3 yields derived from the HO2 measurements considering that the triple fragmentation (R1e) is an important reaction path in the 248 nm photolysis of CH3CHO. From arithmetic considerations taking into account the HO2 and CH3 measurements we deduce a remaining quantum yield for the molecular pathway: CH3CHO* → CH4 + CO ϕ(1b) = 0.6. All experiments can be consistently explained with absence of the formerly considered pathway: CH3CHO* → CH3CO + H ϕ(1c) = 0.

Non-linear Isotope Effects

DEFF Research Database (Denmark)

Schmidt, Johan Albrecht

’s stratosphere is nearly mass dependent, and only a small fraction of the observed anomalous oxygen-17 excess can be attributed to N2O photolysis. In contrast, stratospheric photolysis produces a significant inverse clumped isotope effect.(ii) Stratospheric OCS photolysis significantly enrich the remaining OCS...

Impact of a new wavelength-dependent representation of methane photolysis branching ratios on the modeling of Titan’s atmospheric photochemistry

Science.gov (United States)

Gans, B.; Peng, Z.; Carrasco, N.; Gauyacq, D.; Lebonnois, S.; Pernot, P.

2013-03-01

A new wavelength-dependent model for CH4 photolysis branching ratios is proposed, based on the values measured recently by Gans et al. (Gans, B. et al. [2011]. Phys. Chem. Chem. Phys. 13, 8140-8152). We quantify the impact of this representation on the predictions of a photochemical model of Titan’s atmosphere, on their precision, and compare to earlier representations. Although the observed effects on the mole fraction of the species are small (never larger than 50%), it is possible to draw some recommendations for further studies: (i) the Ly-α branching ratios of Wang et al. (Wang, J.H. et al. [2000]. J. Chem. Phys. 113, 4146-4152) used in recent models overestimate the CH2:CH3 ratio, a factor to which a lot of species are sensitive; (ii) the description of out-of-Ly-α branching ratios by the “100% CH3” scenario has to be avoided, as it can bias significantly the mole fractions of some important species (C3H8); and (iii) complementary experimental data in the 130-140 nm range would be useful to constrain the models in the Ly-α deprived 500-700 km altitude range.

A top-five list for emergency medicine: a pilot project to improve the value of emergency care.

Science.gov (United States)

Schuur, Jeremiah D; Carney, Dylan P; Lyn, Everett T; Raja, Ali S; Michael, John A; Ross, Nicholas G; Venkatesh, Arjun K

2014-04-01

IMPORTANCE The mean cost of medical care in the United States is growing at an unsustainable rate; from 2003 through 2011, the cost for an emergency department (ED) visit rose 240%, from $560 to $1354. The diagnostic tests, treatments, and hospitalizations that emergency clinicians order result in significant costs. OBJECTIVE To create a "top-five" list of tests, treatments, and disposition decisions that are of little value, are amenable to standardization, and are actionable by emergency medicine clinicians. DESIGN, SETTING, AND PARTICIPANTS Modified Delphi consensus process and survey of 283 emergency medicine clinicians (physicians, physician assistants, and nurse practitioners) from 6 EDs. INTERVENTION We assembled a technical expert panel (TEP) and conducted a modified Delphi process to identify a top-five list using a 4-step process. In phase 1, we generated a list of low-value clinical decisions from TEP brainstorming and e-mail solicitation of clinicians. In phase 2, the TEP ranked items on contribution to cost, benefit to patients, and actionability by clinicians. In phase 3, we surveyed all ordering clinicians from the 6 EDs regarding distinct aspects of each item. In phase 4, the TEP voted for a final top-five list based on survey results and discussion. MAIN OUTCOMES AND MEASURES A top-five list for emergency medicine. The TEP ranked items on contribution to cost, benefit to patients, and actionability by clinicians. The survey asked clinicians to score items on the potential benefit or harm to patients and the provider actionability of each item. Voting and surveys used 5-point Likert scales. A Pearson interdomain correlation was used. RESULTS Phase 1 identified 64 low-value items. Phase 2 narrowed this list to 7 laboratory tests, 3 medications, 4 imaging studies, and 3 disposition decisions included in the phase 3 survey (71.0% response rate). All 17 items showed a significant positive correlation between benefit and actionability (r, 0.19-0.37 [P�

Unit for the nanosecond, laser, pulse photolysis in the ultraviolet region for a combination of photochemical studies

Energy Technology Data Exchange (ETDEWEB)

Pikel' ni, V F; Kolosov, V A; Kiryukhin, Yu I; Kondrat' ev, V A; Borovkova, V A; Tarasov, E N

1976-06-01

A description is given of a nanosecond laser unit for pulse photolysis in the ultraviolet region, by means of which it is possible to investigate the kinetics of the death of interstitial particles, their optical absorption and luminescence spectra, and also the photoconductivity induced by the laser radiation, at a time resolution of about 15 ns. As a source of powerful, stable uv-radiation, use is made of the fourth harmonic (266 nm) of radiation from an aluminum-yttrium garnet containing neodymium. The radiation power of the fourth harmonic attained 2 MW. The time of bringing the unit into the operating mode is considerably shortened because of the possibility of operating in a frequency mode. Absorption spectra of carbazole in hexane were obtained at 20/sup 0/C. (SJR)

Isotope fractionation associated with the direct photolysis of 4-chloroaniline.

Science.gov (United States)

Ratti, Marco; Canonica, Silvio; McNeill, Kristopher; Erickson, Paul R; Bolotin, Jakov; Hofstetter, Thomas B

2015-04-07

Compound-specific isotope analysis is a useful approach to track transformations of many organic soil and water pollutants. Applications of CSIA to characterize photochemical processes, however, have hardly been explored. In this work, we systematically studied C and N isotope fractionation associated with the direct photolysis of 4-Cl-aniline used as a model compound for organic micropollutants that are known to degrade via photochemical processes. Laboratory experiments were carried out at an irradiation wavelength of 254 nm over the pH range 2.0 to 9.0 as well as in the presence of Cs(+) as a quencher of excited singlet 4-Cl-aniline at pH 7.0 and 9.0. We observed considerable variation of C and N isotope enrichment factors, ϵC and ϵN, between -1.2 ± 0.2‰ to -2.7 ± 0.2‰ for C and -0.6 ± 0.2‰ to -9.1 ± 1.6‰ for N, respectively, which could not be explained by the speciation of 4-Cl-aniline alone. In the presence of 1 M Cs(+), we found a marked increase of apparent (13)C-kinetic isotope effects ((13)C-AKIE) and decrease of 4-Cl-aniline fluorescence lifetimes. Our data suggest that variations of C and N isotope fractionation originate from heterolytic dechlorination of excited triplet and singlet states of 4-Cl-aniline. Linear correlations of (13)C-AKIE vs (15)N-AKIE were distinctly different for these two reaction pathways and may be explored further for the identification of photolytic aromatic dechlorination reactions.

Photolysis of CH3CHO at 248 nm: Evidence of triple fragmentation from primary quantum yield of CH3 and HCO radicals and H atoms

Science.gov (United States)

Morajkar, Pranay; Bossolasco, Adriana; Schoemaecker, Coralie; Fittschen, Christa

2014-06-01

Radical quantum yields have been measured following the 248 nm photolysis of acetaldehyde, CH3CHO. HCO radical and H atom yields have been quantified by time resolved continuous wave Cavity Ring Down Spectroscopy in the near infrared following their conversion to HO2 radicals by reaction with O2. The CH3 radical yield has been determined using the same technique following their conversion into CH3O2. Absolute yields have been deduced for HCO radicals and H atoms through fitting of time resolved HO2 profiles, obtained under various O2 concentrations, to a complex model, while the CH3 yield has been determined relative to the CH3 yield from 248 nm photolysis of CH3I. Time resolved HO2 profiles under very low O2 concentrations suggest that another unknown HO2 forming reaction path exists in this reaction system besides the conversion of HCO radicals and H atoms by reaction with O2. HO2 profiles can be well reproduced under a large range of experimental conditions with the following quantum yields: CH3CHO + hν248nm → CH3CHO*, CH3CHO* → CH3 + HCO ϕ1a = 0.125 ± 0.03, CH3CHO* → CH3 + H + CO ϕ1e = 0.205 ± 0.04, CH3CHO*{to 2pc{rArrfill}}limits^{o2}CH3CO + HO2 ϕ1f = 0.07 ± 0.01. The CH3O2 quantum yield has been determined in separate experiments as φ_{CH3} = 0.33 ± 0.03 and is in excellent agreement with the CH3 yields derived from the HO2 measurements considering that the triple fragmentation (R1e) is an important reaction path in the 248 nm photolysis of CH3CHO. From arithmetic considerations taking into account the HO2 and CH3 measurements we deduce a remaining quantum yield for the molecular pathway: CH3CHO* → CH4 + CO ϕ1b = 0.6. All experiments can be consistently explained with absence of the formerly considered pathway: CH3CHO* → CH3CO + H ϕ1c = 0.

Regulatory challenges for autologous tissue engineered products on their way from bench to bedside in Europe.

Science.gov (United States)

Ram-Liebig, Gouya; Bednarz, Juergen; Stuerzebecher, Burkard; Fahlenkamp, Dirk; Barbagli, Guido; Romano, Giuseppe; Balsmeyer, Ulf; Spiegeler, Maria-Elsa; Liebig, Soeren; Knispel, Helmut

2015-03-01

Since the late eighties of last century the high potential of tissue engineered products (TEP)s has been shown for the treatment of various diseases and many scientific publications appeared in this field. However, only few products reached the market since. Development of TEPs is a promising but owing to its novelty a very challenging task that requires experts in this still developing field as well as ample financial resources. This paper summarises relevant regulatory challenges during quality, preclinical and clinical development of autologous TEPs in Europe. Selected strategies on how to manage major issues are presented, together with some examples from the development of an autologous TEP for urethroplasty. Considering these aspects may help other investigators with potential strategies during the development of novel TEPs. Copyright © 2014 Elsevier B.V. All rights reserved.

Improved final predicted height with the injection of leuprolide in children with earlier puberty: A retrospective cohort study.

Directory of Open Access Journals (Sweden)

Yi-Chun Lin

Full Text Available The adult height of children with early onset puberty is limited by the premature maturation of hypothalamic-pituitary-gonadal axis. To evaluate the effects of gonadotropin-releasing hormone analog (GnRHa treatment on the final height (FH and bone maturation rate (BMR in girls with early puberty (EP or idiopathic central precocious puberty (ICPP, we examined data from girls who were diagnosed with EP or ICPP and underwent GnRHa (Leuplin Depot: 3.75 mg/month at China Medical University Hospital, in Taiwan, between 2006 and 2015. Patients were observed until the achievement of FH and divided into an "EP group" (T-ep and "ICPP group" (T-icpp according to the age of onset of puberty. Eighty-seven patients were enrolled (T-ep, N = 44, puberty onset at 8-10 years; T-icpp, N = 43, puberty onset before 8 years. The demographic data of girls with EP or IPP was characterized. BMR, change in predicted final height (PFH after GnRHa treatment, target height (TH and FH were measured. After GnRHa treatment, the study groups (T-ep: 160.24±6.18 cm, T-icpp: 158.99±5.92 cm both had higher PFH than at initiation (T-ep: 159.83±7.19 cm, T-icpp: 158.58±5.93 cm. There was deceleration of BMR in both groups (T-ep: 0.57±0.39; T-icpp: 0.97±0.97 and a significant difference between the groups (p = 0.027. The gap in FH standard deviation scores (SDS and TH SDS had a significant difference in T-ep (p = 0.045 but not in T-icpp. Moreover, there was no difference in the gap of PFH SDS between the 1st and final treatment in both groups. We concluded that GnRHa decelerated BMR in girls with earlier puberty. Further prospective clinical studies are warranted.

Evaluation of immunocompatibility of tissue-engineered periosteum

Energy Technology Data Exchange (ETDEWEB)

Zhao Lin; Wang Shuanke; Xia Yayi; Liu Jia; He Jing; Wang Xin [Orthopaedic Institute of the 2nd Hospital of Lanzhou University, 80 CuiYingMen, ChengGuan District, Lanzhou City, 730030 (China); Zhao Junli, E-mail: bonezl@qq.com [Department of Nephrology, the 2nd Hospital of Lanzhou University, 80 CuiYingMen, ChengGuan District, Lanzhou City, 730030 (China)

2011-02-15

Tissue-engineered periosteum (TEP) and 'intramembranous ossification' may be an alternative approach to bone tissue engineering. In the previous study we attained successful bone defect reparation with homemade TEP in an allogenic rabbit model. But its allogenic immunocompatibility remained unknown. In this study TEP was constructed by seeding osteogenically induced mesenchymal stem cells of rabbit onto porcine small intestinal submucosa (SIS). A mixed lymphocyte reaction (MLR) was applied to evaluate the in vitro immunogenicity. The ratio of CD4{sup +}/CD8{sup +} T-lymphocytes was tested kinetically to evaluate the systematic reaction of the TEP allograft, and a histological examination was performed to investigate local inflammation and ectopic osteogenesis. MLR indicated that TEP had a higher in vitro immunostimulation than SIS (p < 0.05). The ratios of CD4{sup +}/CD8{sup +} lymphocytes increased in both TEP and SIS implanted groups in 2 weeks, followed by a decrease to a normal level from 2 to 4 weeks. Histological examination revealed modest lymphocyte infiltration for no more than 2 weeks. Moreover, subcutaneous ectopic ossification was observed in TEP allograft animals (8/12). Our findings imply that TEP has a certain immune reaction for the allograft, but it is not severe enough to impact osteogenesis in the allogenic rabbit model.

Laser photolysis study of anthraquinone in binary mixtures ofionic liquid [bmim][PF6] and organic solvent

Directory of Open Access Journals (Sweden)

Side Yao

2006-12-01

Full Text Available Photochemical properties of the ionic liquid (RTIL 1-butyl-3-methylimidazoliumhexafluorophosphate [bmim][PF6] and its binary mixed solutions with organic solvent(DMF and MeCN were investigated by laser photolysis at an excitation wavelength of 355nm, using anthraquinone (AQ as a probe molecule. It was indicated that the triplet excitedstate of AQ (3AQ* can abstract hydrogen from [bmim][PF6]. Moreover, along with thechange of the ratio of RTIL and organic solvent, the reaction rate constant changes regularly.Critical points were observed at volume fraction VRTIL = 0.2 for RTIL/MeCN and VRTIL =0.05 for RTIL/DMF. For both systems, before the critical point, the rate constant increasesrapidly with increasing VRTIL; however, it decreases obviously with VRTIL after the criticalpoint. We conclude that the concentration dependence is dominant at lower VRTIL, while theviscosity and phase transformation are dominant at higher VRTIL for the effect of ionic liquidon the decay of rate constant.

Selective hydrogen atom abstraction by hydrogen atoms in photolysis and radiolysis of alkane mixtures at 770 K

International Nuclear Information System (INIS)

Miyazaki, T.; Kinugawa, K.; Eguchi, M.; Guedes, S.M.L.

1977-01-01

Selective hydrogen atom abstraction reaction by H atoms, has been found in Isobutane, 2,2,3,3-tetramethylbutane(TMB), cyclopropane matrices besides neopentane matrix. The selective hydrogen atom abstraction reaction in neopentane-isobutane mixture is affected by the difference of kinetic energies of H atoms. The reaction occurs more favorably with decreasing the kinetic energy of H atoms. Competitive reaction between c-C 6 H 12 and Hi for H atoms has been studied in the radiolysis and photolysis of neo-C 5 H 12 HI mixture at 77 K. The rate constants of these reactions in neopentane matrix are quite different from these of thermal H atom reaction, but similar to those of hot H atom reaction. Importance of the selective hydrogen atom abstraction reaction by H atoms is pointed out in the radical formation in the radiolysis of pure TMB at 77 K [pt

Thermoelectric power measurements in liquid quenched amorphous alloys for FeZr and (FeCo)B

International Nuclear Information System (INIS)

Raza, S.M.; Naqvi, S.M.M.R.; Rizvi, S.; Hussain, A.; Rahman, F.

1999-01-01

Thermoelectric power (TEP) measurements have been carried out on six samples of LQA alloys from two different series, namely FeZr and Fe(Co)B, at relatively low temperatures. Thermoelectric power shows an overall Gaussian trend. The scattering centers are the major contributors to the residual TEP. Ziman theoretical model was used to estimate TEP. It was found that Ziman theory fails to account for quantitative TEP measurements at relatively low temperatures (77K< T<300K). (author)

Matrix isolation and computational study of isodifluorodibromomethane (F2CBr-Br): a route to Br2 formation in CF2Br2 photolysis.

Science.gov (United States)

George, Lisa; Kalume, Aimable; El-Khoury, Patrick Z; Tarnovsky, Alexander; Reid, Scott A

2010-02-28

The photolysis products of dibromodifluoromethane (CF(2)Br(2)) were characterized by matrix isolation infrared and UV/Visible spectroscopy, supported by ab initio calculations. Photolysis at wavelengths of 240 and 266 nm of CF(2)Br(2):Ar samples (approximately 1:5000) held at approximately 5 K yielded iso-CF(2)Br(2) (F(2)CBrBr), a weakly bound isomer of CF(2)Br(2), which is characterized here for the first time. The observed infrared and UV/Visible absorptions of iso-CF(2)Br(2) are in excellent agreement with computational predictions at the B3LYP/aug-cc-pVTZ level. Single point energy calculations at the CCSD(T)/aug-cc-pVDZ level on the B3LYP optimized geometries suggest that the isoform is a minimum on the CF(2)Br(2) potential energy surface, lying some 55 kcal/mol above the CF(2)Br(2) ground state. The energies of various stationary points on the CF(2)Br(2) potential energy surface were characterized computationally; taken with our experimental results, these show that iso-CF(2)Br(2) is an intermediate in the Br+CF(2)Br-->CF(2)+Br(2) reaction. The photochemistry of the isoform was also investigated; excitation into the intense 359 nm absorption band resulted in isomerization to CF(2)Br(2). Our results are discussed in view of the rich literature on the gas-phase photochemistry of CF(2)Br(2), particularly with respect to the existence of a roaming atom pathway leading to molecular products.

Matrix isolation and computational study of isodifluorodibromomethane (F2CBr-Br): A route to Br2 formation in CF2Br2 photolysis

International Nuclear Information System (INIS)

George, Lisa; Kalume, Aimable; Reid, Scott A.; El-Khoury, Patrick Z.; Tarnovsky, Alexander

2010-01-01

The photolysis products of dibromodifluoromethane (CF 2 Br 2 ) were characterized by matrix isolation infrared and UV/Visible spectroscopy, supported by ab initio calculations. Photolysis at wavelengths of 240 and 266 nm of CF 2 Br 2 :Ar samples (∼1:5000) held at ∼5 K yielded iso-CF 2 Br 2 (F 2 CBrBr), a weakly bound isomer of CF 2 Br 2 , which is characterized here for the first time. The observed infrared and UV/Visible absorptions of iso-CF 2 Br 2 are in excellent agreement with computational predictions at the B3LYP/aug-cc-pVTZ level. Single point energy calculations at the CCSD(T)/aug-cc-pVDZ level on the B3LYP optimized geometries suggest that the isoform is a minimum on the CF 2 Br 2 potential energy surface, lying some 55 kcal/mol above the CF 2 Br 2 ground state. The energies of various stationary points on the CF 2 Br 2 potential energy surface were characterized computationally; taken with our experimental results, these show that iso-CF 2 Br 2 is an intermediate in the Br+CF 2 Br→CF 2 +Br 2 reaction. The photochemistry of the isoform was also investigated; excitation into the intense 359 nm absorption band resulted in isomerization to CF 2 Br 2 . Our results are discussed in view of the rich literature on the gas-phase photochemistry of CF 2 Br 2 , particularly with respect to the existence of a roaming atom pathway leading to molecular products.

Geometric phase and quantum interference in photosynthetic reaction center: Regulation of electron transfer

Energy Technology Data Exchange (ETDEWEB)

Sun, Yuming, E-mail: ymsun@ytu.edu.cn; Su, Yuehua; Dai, Zhenhong; Wang, WeiTian

2016-10-20

Photosynthesis is driven by electron transfer in reaction centers in which the functional unit is composed of several simple molecules C{sub 2}-symmetrically arranged into two branches. In view of quantum mechanism, both branches are possible pathways traversed by the transferred electron. Due to different evolution of spin state along two pathways in transmembrane electric potential (TEP), quantum state of the transferred electron at the bridged site acquires a geometric phase difference dependent on TEP, the most efficient electron transport takes place in a specific range of TEP beyond which electron transfer is dramatically suppressed. What’s more, reaction center acts like elaborately designed quantum device preparing polarized spin dependent on TEP for the transferred electron to regulate the reduction potential at bridged site. In brief, electron transfer generates the TEP, reversely, TEP modulates the efficiency of electron transfer. This may be an important approach to maintaining an appreciable pH environment in photosynthesis.

Software for automated evaluation of technical and economic performance factors of nuclear power plant units

International Nuclear Information System (INIS)

Cvan, M.; Zadrazil, J.; Barnak, M.

1989-01-01

Computer codes TEP V2, TEP EDU and TEP V1 are used especially in real-time evaluation of technical and economic performance factors of the power unit. Their basic functions include filtration of credibility of input data obtained by measurement, simultaneous calculation of flows of various types of energy, calculation of technical and economic factors, listings and filing of the results. Code ZMEK is designed for executing changes in the calculation constants file for codes TEP V2 and TEP EDU. Code TEP DEN is used in processing the complete daily report on the technical and economic performance factors of the unit. Briefly described are the basic algorithms of credibility filtration for the measured quantities, the methodology of fundamental balances and the method of guaranteeing the continuity of measurement. Experiences are given with the use of the codes, and the trends are outlined of their future development. (J.B.). 5 refs

Crystal structure of a photolysis product of vitamin B6: A pyridodihydrofuran-condensed skeleton compound of pyridoxal 5‧-phosphate

Science.gov (United States)

Aoki, Katsuyuki; Nakamura, Hideyuki; Hattori, Toshiaki; Hu, Ning-Hai; Onishi, Masayoshi

2017-11-01

An aqueous solution dissolving pyridoxal 5‧-phosphate (PLP) was exposed to sun-light at room temperature to yield a photolysis product, 4b,9b-dihydro-4b,9b-dihydroxy-1,6-dimethyl-4,9-bis(phosphonooxymethyl){pyrido[3‧,4‧:2,3]furo[4,5-b]}pyrido[4,3-d]furan (1), whose structure was crystallographically determined. The product 1 was found to be a novel C(sp3)-C(sp3) side-sharing pyridodihydrofuran-condensed skeleton compound with the two pyridodihydrofuran planes taking a 'V-shape'-like molecular configuration. Hydrogen bonding patterns of molecules of 1 in the crystal lattice are analyzed by the graph set approach. The most probable mechanism for the formation of 1 is described.

Paradox-Proof Utility Functions for Heavy-Tailed Payoffs: Two Instructive Two-Envelope Problems

Directory of Open Access Journals (Sweden)

Michael R. Powers

2015-01-01

Full Text Available We identify restrictions on a decision maker’s utility function that are both necessary and sufficient to preserve dominance reasoning in each of two versions of the Two-Envelope Paradox (TEP. For the classical TEP, the utility function must satisfy a certain recurrence inequality. For the St. Petersburg TEP, the utility function must be bounded above asymptotically by a power function, which can be tightened to a constant. By determining the weakest conditions for dominance reasoning to hold, the article settles an open question in the research literature. Remarkably, neither constant-bounded utility nor finite expected utility is necessary for resolving the classical TEP; instead, finite expected utility is both necessary and sufficient for resolving the St. Petersburg TEP.

Minilaparoscopic technique for inguinal hernia repair combining transabdominal pre-peritoneal and totally extraperitoneal approaches.

Science.gov (United States)

Carvalho, Gustavo L; Loureiro, Marcelo P; Bonin, Eduardo A; Claus, Christiano P; Silva, Frederico W; Cury, Antonio M; Fernandes, Flavio A M

2012-01-01

Endoscopic surgical repair of inguinal hernia is currently conducted using 2 techniques: the totally extraperitoneal (TEP) and the transabdominal (TAPP) hernia repair. The TEP procedure is technically advantageous, because of the use of no mesh fixation and the elimination of the peritoneal flap, leading to less postoperative pain and faster recovery. The drawback is that TEP is not performed as frequently, because of its complexity and longer learning curve. In this study, we propose a hybrid technique that could potentially become the gold standard of minimally invasive inguinal hernia surgery. This will be achieved by combining established advantages of TEP and TAPP associated with the precision and cosmetics of minilaparoscopy (MINI). Between January and July 2011, 22 patients were admitted for endoscopic inguinal hernia repair. The combined technique was initiated with TAPP inspection and direct visualization of a minilaparoscopic trocar dissection of the preperitoneum space. A10-mm trocar was then placed inside the previously dissected preperitoneal space, using the same umbilical TAPP skin incision. Minilaparoscopic retroperitoneal dissection was completed by TEP, and the surgical procedure was finalized with intraperitoneal review and correction of the preperitoneal work. The minilaparoscopic TEP-TAPP combined approach for inguinal hernia is feasible, safe, and allows a simple endoscopic repair. This is achieved by combining features and advantages of both TAPP and TEP techniques using precise and sophisticated MINI instruments. Minilaparoscopic preperitoneal dissection allows a faster and easier creation of the preperitoneal space for the TEP component of the procedure.

Measurement of thermoelectric power of Fe-Cu binary alloys

International Nuclear Information System (INIS)

Joubouji, Katsuo

2007-01-01

In INSS, non-destructive evaluation (NDE) of irradiation embrittlement of low alloy steel using thermoelectric power (TEP) measurement has been considered, as well as NDE of thermal aging of cast duplex stainless steel which has been studied in recent years. Material degradation is evaluated based on a relation between progress of the degradation and change in TEP due to change in material structure caused by the degradation event. So it is necessary for NDE of irradiation embrittlement to measure the change in TEP due to precipitation of Cu contained as an impurity, which is known as one of the reasons for the embrittlement. In this study, TEP of Fe-Cu binary alloys with different Cu content was measured for investigation of the relationship between TEP of the alloys and Cu content. In addition, appropriateness of measuring TEP of Fe-Cu binary alloy in the same way to measure TEP of duplex stainless steel was examined. It was found that increment of Cu contained in the alloys changed TEP in a negative direction and the rate was evaluated as -6.6μV/K/wt%Cu. There were the cases that it took 20 minutes for measurement values to become stable in measurement of Fe-Cu binary alloys. It was much longer than the time taken in measurement of duplex stainless steel. So the measurement time per a point was extended to 60 minutes in case of Fe-Cu binary alloys. (author)

In vitro residual anti-bacterial activity of difloxacin, sarafloxacin and their photoproducts after photolysis in water

International Nuclear Information System (INIS)

Kusari, Souvik; Prabhakaran, Deivasigamani; Lamshoeft, Marc; Spiteller, Michael

2009-01-01

Fluoroquinolones like difloxacin (DIF) and sarafloxacin (SARA) are adsorbed in soil and enter the aquatic environment wherein they are subjected to photolytic degradation. To evaluate the fate of DIF and SARA, their photolysis was performed in water under stimulated natural sunlight conditions. DIF primarily degrades to SARA. On prolonged photodegradation, seven photoproducts were elucidated by HR-LC-MS/MS, three of which were entirely novel. The residual anti-bacterial activities of DIF, SARA and their photoproducts were studied against a group of pathogenic strains. DIF and SARA revealed potency against both Gram-positive and -negative bacteria. The photoproducts also exhibited varying degrees of efficacies against the tested bacteria. Even without isolating the individual photoproducts, their impact on the aquatic environment could be assessed. Therefore, the present results call for prudence in estimating the fate of these compounds in water and in avoiding emergence of resistance in bacteria caused by the photoproducts of DIF and SARA. - Assessment of the residual anti-bacterial efficacies of difloxacin, sarafloxacin and their photoproducts in water, and estimating their impact on the aquatic environment in inducing resistance to microorganisms.

265 nm laser flash photolysis of some ortho-substituted anilides and related N-formylkynurenine derivatives

Energy Technology Data Exchange (ETDEWEB)

Pileni, M P; Santus, R [Museum National d' Histoire Naturelle, 75 - Paris (France); Land, E J

1978-06-01

The physical and chemical properties of the triplet state of eight ortho-substituted anilides including N-formylkynurenine(FK), the major trp UV-photooxidation product and a remarkable photodynamic agent, have been investigated using both pulse radiolysis and 265 nm laser flash photolysis techniques. The molar extinction coefficient, the inter-system-crossing quantum yield and the oscillator strength of the T/sub 1/..-->..Tsub(n) absorption band (lambdasub(max)approximately equal 450nm) have been determined. It is shown that anilides having n..pi..* triplets readily react with most solvents whereas those having ..pi..,..pi..* triplets slowly react with alcohols. In both cases, the semi-reduced species are formed. In water, the formation of the semi-reduced species most probably involves the first excited singlet state. The triplet state properties of the FK derivatives (i.e. ortho-substituted anilides having a side chain bearing charged groups such as carboxylic or amino groups) are strongly modified by the ionization state of the charged side chain. In the case of the FK derivatives possessing an uncharged amino group, quenching of the triplet state occurs via a fast reversible electron transfer reaction from the NH/sub 2/ to the triplet anilide.

Laser induced transient absorptions of the excited triplet state of 9,10-anthraquinone-2-sulfonate. A further study by 248 nm laser photolysis

International Nuclear Information System (INIS)

Ma Jianhua; Lin Weizheng; Wang Wenfen; Yao Side; Lin Nianyun

1999-01-01

Transient absorption spectrum of triplet state of 9,10-anthraquinone-2-sulfonate (AQS) in aqueous solution has been investigated using 248 nm (KrF) laser photolysis. A whole transient absorption spectrum with absorption maxim at 380 nm and 580 nm has been assigned to triple AQS from detailed kinetic analysis of decay of 380 nm and 580 nm signals, which is the neat characteristic absorption of triplet AQS reported for the first time. In addition, the difference in feature of the spectrum of triplet AQS in H 2 O and that in CH 3 CN was eliminated by further study using 248 nm laser pulses

Influence of triethyl phosphate on phosphatase activity in shooting range soil: Isolation of a zinc-resistant bacterium with an acid phosphatase.

Science.gov (United States)

Story, Sandra; Brigmon, Robin L

2017-03-01

Phosphatase-mediated hydrolysis of organic phosphate may be a viable means of stabilizing heavy metals via precipitation as a metal phosphate in bioremediation applications. We investigated the effect of triethyl phosphate (TEP) on soil microbial-phosphatase activity in a heavy-metal contaminated soil. Gaseous TEP has been used at subsurface sites for bioremediation of organic contaminants but not applied in heavy-metal contaminated areas. Little is known about how TEP affects microbial activity in soils and it is postulated that TEP can serve as a phosphate source in nutrient-poor groundwater and soil/sediments. Over a 3-week period, TEP amendment to microcosms containing heavy-metal contaminated soil resulted in increased activity of soil acid-phosphatase and repression of alkaline phosphatase, indicating a stimulatory effect on the microbial population. A soil-free enrichment of microorganisms adapted to heavy-metal and acidic conditions was derived from the TEP-amended soil microcosms using TEP as the sole phosphate source and the selected microbial consortium maintained a high acid-phosphatase activity with repression of alkaline phosphatase. Addition of 5mM zinc to soil-free microcosms had little effect on acid phosphatase but inhibited alkaline phosphatase. One bacterial member from the consortium, identified as Burkholderia cepacia sp., expressed an acid-phosphatase activity uninhibited by high concentrations of zinc and produced a soluble, indigo pigment under phosphate limitation. The pigment was produced in a phosphate-free medium and was not produced in the presence of TEP or phosphate ion, indicative of purple acid-phosphatase types that are pressed by bioavailable phosphate. These results demonstrate that TEP amendment was bioavailable and increased overall phosphatase activity in both soil and soil-free microcosms supporting the possibility of positive outcomes in bioremediation applications. Copyright © 2016. Published by Elsevier Inc.

Organic Compounds Produced by Photolysis of Realistic Interstellar and Cometary Ice Analogs Containing Methanol

Science.gov (United States)

Bernstein, Max P.; Sandford, Scott A.; Allamandola, Louis J.; Chang, Sherwood; Scharberg, Maureen A.

1995-01-01

The InfraRed (IR) spectra of UltraViolet (UV) and thermally processed, methanol-containing interstellar / cometary ice analogs at temperatures from 12 to 300 K are presented. Infrared spectroscopy, H-1 and C-13 Nuclear Magnetic Resonance (NMR) spectroscopy, and gas chromatography-mass spectrometry indicate that CO (carbon monoxide), CO2 (carbon dioxide), CH4 (methane), HCO (the formyl radical), H2CO (formaldehyde), CH3CH2OH (ethanol), HC([double bond]O)NH2 (formamide), CH3C([double bond]O)NH2 (acetamide), and R[single bond]C[triple bond]N (nitriles) are formed. In addition, the organic materials remaining after photolyzed ice analogs have been warmed to room temperature contain (in rough order of decreasing abundance), (1) hexamethylenetetramine (HMT, C6H12N4), (2) ethers, alcohols, and compounds related to PolyOxyMethylene (POM, ([single bond]CH2O[single bond](sub n)), and (3) ketones (R[single bond]C([double bond]O)[single bond]R') and amides (H2NC([double bond]O)[single bond]R). Most of the carbon in these residues is thought to come from the methanol in the original ice. Deuterium and C-13 isotopic labeling demonstrates that methanol is definitely the source of carbon in HMT. High concentrations of HMT in interstellar and cometary ices could have important astrophysical consequences. The ultraviolet photolysis of HMT frozen in H2O ice readily produces the 'XCN' band observed in the spectra of protostellar objects and laboratory ices, as well as other nitriles. Thus, HMT may be a precursor of XCN and a source of CN in comets and the interstellar medium. Also, HMT is known to hydrolyze under acidic conditions to yield ammonia, formaldehyde, and amino acids. Thus, HMT may be a significant source of prebiogenic compounds on asteroidal parent bodies. A potential mechanism for the radiative formation of HMT in cosmic ices is outlined.

Thermoelectric power of Bi and Bi{sub 1{minus}x}Sb{sub x} alloy thin films and superlattices grown by MBE

Energy Technology Data Exchange (ETDEWEB)

Cho, S; DiVenere, A; Wong, G K; Ketterson, J B; Meyer, J R; Hoffman, C A

1997-07-01

The authors have measured the thermoelectric power (TEP) of MBE-grown epitaxial Bi and Bi{sub 1{minus}x} alloy thin films and superlattices as a function of temperature in the range 20--300 K. They have observed that the TEP of a Bi thin film of 1 {micro}m thickness is in good agreement with the bulk single crystal value and that the TEPs for superlattices with 400 {angstrom} and 800 {angstrom} Bi well thicknesses are enhanced over the bulk values. For x = 0.072 and 0.088 in Bi{sub 1{minus}x}Sb{sub x} thin films showing semiconducting behavior, TEP enhancement was observed by a factor of two. However as Bi or Bi{sub 1{minus}x}Sb{sub x} well thickness decreases in superlattice geometry, the TEP decreases, which may be due to unintentional p-type doping.

40 CFR 158.660 - Nontarget plant protection data requirements table.

Science.gov (United States)

2010-07-01

... vigor R R R TEP 1, 2, 3, 7 850.4400850.5400 Aquatic plant growth (algal and aquatic vascular plant... CR CR TEP 1, 4, 5, 7 850.4150 Vegetative vigor CR CR CR TEP 1, 3, 4, 5, 7 850.4400850.5400 Aquatic... methods used to generate data must include the results of a successful confirmatory method trial by an...

Apoptosis induced by pyrimidine dimer produced by ultraviolet irradiation in cultured cyprinodont cells. Analysis utilizing the evasion from photolysis

International Nuclear Information System (INIS)

Nishigaki, Reiko

2000-01-01

This is the review of author's investigations on the mechanism of apoptosis induced by UV irradiation in cultured cyprinodont cells highly expressing photolyases of cyclobutane pyrimidine dimer (CPD). Authors found out the evasion from photolysis by UV-induced apoptosis of which cascade had been thought irreversible: the cascade was reversible until the process of DNA fragmentation. In controlling the process, a mechanism to recognize CPD was found concerned. In those cells, morphological changes by UVC were reversible ones in apoptosis from which they evaded if CPD was repaired. Investigations on caspase, which playing important roles in apoptosis, revealed that the DEVD-cleaving enzyme activities were regulated by CPD quantity. However, differing from mammalian cells, elevation of caspase (-7, -3A and -3B) activities did not always induce the morphologic changes and DNA fragmentation. Further studies were thought necessary to elucidate the mechanism of apoptosis in those fish cells. (K.H.)

Accounting for dissociation and photolysis: a review of the algal toxicity of triclosan.

Science.gov (United States)

Roberts, Jayne; Price, Oliver R; Bettles, Nicola; Rendal, Cecilie; van Egmond, Roger

2014-11-01

Triclosan, an antimicrobial agent commonly used in down-the-drain consumer products, is toxic to freshwater microalgae. However, the rapid photolysis and pH-dependent dissociation of this compound may give rise to uncertainty in growth inhibition tests with freshwater microalgae, if these are not well characterized. Methods are presented to minimize these uncertainties by stabilizing pH with an organic buffering agent (Bis-Tris) and by the application of ultraviolet (UV) covers to remove UV wavelengths. Toxicity tests with these methods were in compliance with the validity criteria of the Organisation for Economic Co-operation and Development test 201, and no negative effects were seen in controls relative to the unmodified method. The methods were used for toxicity tests with triclosan at pH levels of 7.0, 8.0, and 8.5, yielding effective concentration, 10% values of 0.5 µg/L, 0.6 µg/L, and 12.1 µg/L, respectively. The observed change in toxicity with pH was proportional to the change in bioconcentration factor (BCF) as calculated using the cell model (a dynamic flux model based on the Fick-Nernst-Planck equations, in this case parameterized for an algal cell). Effect concentrations produced with the methods presented in the present study offer robust data on which to base risk assessment, and it is suggested that similar approaches be used to minimize uncertainty when other compounds that dissociate and photolyse are tested. © 2014 SETAC.

Direct and indirect photolysis of triclocarban in the presence of dissolved organic matter

Directory of Open Access Journals (Sweden)

Tamara D. Trouts

2015-05-01

Full Text Available Abstract Photolysis is an important attenuation pathway for the removal of wastewater effluent organic micropollutants from surface waters. In this work, direct and indirect processes leading to the degradation of the disinfectant, triclocarban were studied. Photo-irradiation experiments were conducted in water collected from Old Woman Creek (OWC a tributary of Lake Erie near Huron, OH, USA and in solutions of fulvic acids isolated from the Suwannee River, Georgia, USA (SRFA, Old Woman Creek (OWCFA and Pony Lake, Antarctica (PLFA. Photodegradation of triclocarban proceeded faster in the presence of all three fulvic acids relative to deionized water. PLFA, an autochthonous dissolved organic matter (DOM was found to be more reactive than the other fulvic acids, while the mostly allochthonous SRFA exhibited the lowest reactivity toward triclocarban. The later observation can be in part explained by anti-oxidant moieties present in SRFA. Photosensitized triclocarban degradation in whole water DOM from OWC was entirely attributable to the fulvic acid fraction and suggests that this component is the most photo-reactive fraction of the DOM. Anoxic and methanol-quenched experiments revealed unexpected results whereby the former suggests oxidation through reaction with triplet DOM, while the later is indicative of reaction with photo-generated hydroxyl radicals. It is possible that methanol can quench excited DOM species, which would shut down the triplet oxidation pathway. Finally, we observed no enhancement of triclocarban-photosensitized degradation through the addition of iron.

Aquifer Treatment of Sea Water to Remove Natural Organic Matter Before Desalination

KAUST Repository

Dehwah, Abdullah

2016-10-18

An investigation of a sea water reverse osmosis desalination facility located in western Saudi Arabia has shown that aquifer treatment of the raw sea water provides a high degree of removal of natural organic matter (NOM) that causes membrane biofouling. The aquifer is a carbonate system that has a good hydraulic connection to the sea and 14 wells are used to induce sea water movement 400 to 450 m from the sea to the wells. During aquifer transport virtually all of the algae, over 90% of the bacteria, over 90% of the biopolymer fraction of NOM, and high percentages of the humic substance, building blocks, and some of the low molecular weight fractions of NOM are removed. Between 44 and over 90% of the transparent exopolymer particles (TEP) are removed with a corresponding significant reduction in concentration of the colloidal fraction of TEP. The removal rate for TEP appears to be greater in carbonate aquifers compared to siliciclastic systems. Although the production wells range in age from 4 months to 14 years, no significant difference in the degree of water treatment provided by the aquifer was found.

Aquifer Treatment of Sea Water to Remove Natural Organic Matter Before Desalination

KAUST Repository

Dehwah, Abdullah; Almashharawi, Samir; Ng, Kim Choon; Missimer, Thomas M.

2016-01-01

An investigation of a sea water reverse osmosis desalination facility located in western Saudi Arabia has shown that aquifer treatment of the raw sea water provides a high degree of removal of natural organic matter (NOM) that causes membrane biofouling. The aquifer is a carbonate system that has a good hydraulic connection to the sea and 14 wells are used to induce sea water movement 400 to 450 m from the sea to the wells. During aquifer transport virtually all of the algae, over 90% of the bacteria, over 90% of the biopolymer fraction of NOM, and high percentages of the humic substance, building blocks, and some of the low molecular weight fractions of NOM are removed. Between 44 and over 90% of the transparent exopolymer particles (TEP) are removed with a corresponding significant reduction in concentration of the colloidal fraction of TEP. The removal rate for TEP appears to be greater in carbonate aquifers compared to siliciclastic systems. Although the production wells range in age from 4 months to 14 years, no significant difference in the degree of water treatment provided by the aquifer was found.

Investigations of riboflavin photolysis via coloured light in the nitro blue tetrazolium assay for superoxide dismutase activity.

Science.gov (United States)

Cheng, Chien-Wei; Chen, Liang-Yü; Chou, Chan-Wei; Liang, Ji-Yuan

2015-07-01

Determination of the superoxide dismutase activity is an important issue in the fields of biochemistry and the medical sciences. In the riboflavin/nitro blue tetrazolium (B2/NBT) method, the light sources used for generating superoxide anion radicals from light-excited riboflavin are normally fluorescent lamps. However, the conditions of B2/NBT experiments vary. This study investigated the effect of the light source on the light-excitation of riboflavin. The effectiveness of the photolysis was controlled by the wavelength of the light source. The spectra of fluorescent lamps are composed of multiple colour lights, and the emission spectra of fluorescent lamps made by different manufacturers may vary. Blue light was determined to be the most efficient for the photochemical reaction of riboflavin in visible region. The quality of the blue light in fluorescent lamps is critical to the photo-decomposition of riboflavin. A blue light is better than a fluorescent lamp for the photo-decomposition of riboflavin. The performance of the B2/NBT method is thereby optimized. Copyright © 2015 Elsevier B.V. All rights reserved.

Photolysis of H2O-H2O2 Mixtures: The Destruction of H2O2

Science.gov (United States)

Loeffler, M. J.; Fama, M.; Baragiola, R. A.; Carlson, R. W.

2013-01-01

We present laboratory results on the loss of H2O2 in solid H2O + H2O2 mixtures at temperatures between 21 and 145 K initiated by UV photolysis (193 nm). Using infrared spectroscopy and microbalance gravimetry, we measured the decrease of the 3.5 micrometer infrared absorption band during UV irradiation and obtained a photodestruction cross section that varies with temperature, being lowest at 70 K. We use our results, along with our previously measured H2O2 production rates via ionizing radiation and ion energy fluxes from the spacecraft to compare H2O2 creation and destruction at icy satellites by ions from their planetary magnetosphere and from solar UV photons. We conclude that, in many cases, H2O2 is not observed on icy satellite surfaces because the H2O2 photodestruction rate is much higher than the production rate via energetic particles, effectively keeping the H2O2 infrared signature at or below the noise level.

Tris(2-butoxyethyl)phosphate and triethyl phosphate alter embryonic development, hepatic mRNA expression, thyroid hormone levels, and circulating bile acid concentrations in chicken embryos

Energy Technology Data Exchange (ETDEWEB)

Egloff, Caroline [National Wildlife Research Centre, Environment Canada, Ottawa, ON K1A 0H3 (Canada); Crump, Doug, E-mail: doug.crump@ec.gc.ca [National Wildlife Research Centre, Environment Canada, Ottawa, ON K1A 0H3 (Canada); Porter, Emily; Williams, Kim L.; Letcher, Robert J.; Gauthier, Lewis T. [National Wildlife Research Centre, Environment Canada, Ottawa, ON K1A 0H3 (Canada); Kennedy, Sean W. [National Wildlife Research Centre, Environment Canada, Ottawa, ON K1A 0H3 (Canada); Department of Biology, University of Ottawa, Ottawa, ON K1N 6N5 (Canada)

2014-09-15

The organophosphate flame retardants tris(2-butoxyethyl) phosphate (TBOEP) and triethyl phosphate (TEP) are used in a wide range of applications to suppress or delay the ignition and spread of fire. Both compounds have been detected in the environment and TBOEP was recently measured in free-living avian species. In this study, TBOEP and TEP were injected into the air cell of chicken embryos at concentrations ranging from 0 to 45,400 ng/g and 0 to 241,500 ng/g egg, respectively. Pipping success, development, hepatic mRNA expression of 9 target genes, thyroid hormone levels, and circulating bile acid concentrations were determined. Exposure to the highest doses of TBOEP and TEP resulted in negligible detection of the parent compounds in embryonic contents at pipping indicating their complete metabolic degradation. TBOEP exposure had limited effects on chicken embryos, with the exception of hepatic CYP3A37 mRNA induction. TEP exposure decreased pipping success to 68%, altered growth, increased liver somatic index (LSI) and plasma bile acids, and modulated genes associated with xenobiotic and lipid metabolism and the thyroid hormone pathway. Plasma thyroxine levels were decreased at all TEP doses, including an environmentally-relevant concentration (8 ng/g), and gallbladder hypotrophy was evident at ≥ 43,200 ng/g. Tarsus length and circulating thyroxine concentration emerged as potential phenotypic anchors for the modulation of transthyretin mRNA. The increase in plasma bile acids and LSI, gallbladder hypotrophy, and discoloration of liver tissue represented potential phenotypic outcomes associated with modulation of hepatic genes involved with xenobiotic and lipid metabolism. - Highlights: • TBOEP is not embryolethal to chicken embryos. • TEP affected embryonic viability, morphometric endpoints, and thyroid hormone levels. • TEP altered mRNA levels of xenobiotic and lipid metabolism genes. • TEP increased plasma bile acids and caused gallbladder hypotrophy

miR-380-5p-mediated repression of TEP1 and TSPYL5 interferes with telomerase activity and favours the emergence of an “ALT-like” phenotype in diffuse malignant peritoneal mesothelioma cells

Directory of Open Access Journals (Sweden)

Graziella Cimino-Reale

2017-07-01

Full Text Available Abstract Background Understanding the molecular/cellular underpinnings of diffuse malignant peritoneal mesothelioma (DMPM, a fatal malignancy with limited therapeutic options, is of utmost importance for the fruitful management of the disease. In this context, we previously found that telomerase activity (TA, which accounts for the limitless proliferative potential of cancer cells, is prognostic for disease relapse and cancer-related death in DMPM patients. Consequently, the identification of factors involved in telomerase activation/regulation may pave the way towards the development of novel therapeutic interventions for the disease. Here, the capability of miR-380-5p, a microRNA negligibly expressed in telomerase-positive DMPM clinical specimens, to interfere with telomerase-mediated telomere maintenance and, hence, with cancer cell growth was assessed on preclinical models of DMPM. Methods DMPM cells were transfected with a miR-380-5p synthetic precursor, and the effects of miRNA replacement were evaluated in terms of growing capability, induction of apoptosis and interference with TA. Reiterated weekly transfections were also performed in order to analyse the phenotype arising upon prolonged miR-380-5p reconstitution in DMPM cells. Results The ectopic expression of miR-380-5p elicited a remarkable inhibition of TA and resulted in DMPM cell growth impairment and apoptosis induction. In particular, we demonstrated for the first time that these effects were the result of a molecular circuitry converging on telomerase associated protein 1 (TEP1, where the miRNA was able to target the gene both directly in unconventional targeting modality and indirectly via p53 accumulation consequent to miRNA-mediated downregulation of testis-specific protein, Y-encoded-like 5 gene. Moreover, miR-380-5p did not cause telomere attrition and cell growth arrest in long-term DMPM transfectants, which in turn showed slightly elongated telomeres and molecular

Photochemical Degradation of Composition B and Its Components

National Research Council Canada - National Science Library

Pennington, Judith C; Thorn, Kevin A; Cox, Larry G; MacMillan, Denise K; Yost, Sally; Laubscher, Randy D

2007-01-01

.... The significance of photolysis of explosive formulations on training ranges is unknown. Therefore, photolysis of a common explosive formulation, Composition B, and its components in a soil matrix were evaluated...

Kinetic of the gas-phase reactions of OH radicals and Cl atoms with Diethyl Ethylphosphonate and Triethyl Phosphate

KAUST Repository

Laversin, H.

2015-11-30

In this paper, the relative-rate technique has been used to obtain rate coefficients for the reaction of two organophosphorus compounds: Triethyl phosphate (TEP) and Diethyl ethylphosphonate (DEEP) with OH radicals and Cl atoms at atmospheric pressure and at different temperatures. The calculated rate constants were fitted to the Arrhenius expression over the temperature range 298 – 352 K. The following expressions (in cm3molecule-1s-1) were obtained for the reactions of OH and CL with DEEP and TEP: kOH+DEEP= (7.84±0.65)x10-14exp((1866±824)/T), kOH+TEP = (6.54±0.42)x10-14exp((1897±626)/T), kCl+DEEP = (5.27± 0.80)x10−11exp(765±140/T) and kCl+TEP = (5.23± 0.80)x10−11exp(736± 110/T). These results show that the reaction of the studied compounds with Cl atoms proceeds more rapidly than that with OH radicals. The related tropospheric lifetimes suggest that once emitted into the atmosphere, TEP and DEEP can be removed within a few hours in areas close to their emission sources. TEP and DEEP are principally removed by OH radicals. However, in coastal areas where the Cl atoms’ concentration is higher, TEP and DEEP removal by reaction with Cl atoms could be a competitive process.

Analysis of mebendazole binding to its target biomolecule by laser flash photolysis.

Science.gov (United States)

Jornet, Dolors; Bosca, Francisco; Andreu, Jose M; Domingo, Luis R; Tormos, Rosa; Miranda, Miguel A

2016-02-01

Mebendazole (MBZ) and related anticancer benzimidazoles act binding the β-subunit of Tubulin (TU) before dimerization with α-TU with subsequent blocking microtubule formation. Laser flash photolysis (LFP) is a new tool to investigate drug-albumin interactions and to determine binding parameters such as affinity constant or population of binding sites. The aim of this study was to evaluate the interactions between the nonfluorescent mebendazole (MBZ) and its target biomolecule TU using this technique. Before analyzing the MBZ@TU complex it was needed to determine the photophysical properties of MBZ triplet excited state ((3)MBZ(⁎)) in different media. Hence, (3)MBZ(⁎) showed a transient absorption spectrum with maxima at 520 and 375 nm and a lifetime much longer in acetonitrile (12.5 μs) than in water (260 ns). The binding of MBZ to TU produces a greater increase of the lifetime of (3)MBZ(⁎) (25 μs). This fact and the strong electron acceptor capability observed for (3)MBZ* evidence that MBZ must not be located close to any electron donor amino acid of TU such as its tryptophan or cysteine residues. Adding increasing amounts of MBZ to aqueous TU was determined the MBZ-TU binding constant (2.0 ± 0.5 × 10(5)M(-1) at 298K) which decreased with increasing temperature. The LFP technique has proven to be a powerful tool to analyze the binding of drug-TU systems when the drug has a detectable triplet excited state. Results indicate that LFP could be the technique of choice to study the interactions of non-fluorescent drugs with their target biomolecules. Copyright © 2015 Elsevier B.V. All rights reserved.

Effects of transparent exopolymer particles and suspended particles on the survival of Salmonella enterica serovar Typhimurium in seawater.

Science.gov (United States)

Davidson, Marion C F; Berardi, Terra; Aguilar, Beatriz; Byrne, Barbara A; Shapiro, Karen

2015-03-01

The bacterium Salmonella enterica can infect marine mammals and has been increasingly implicated in seafood-borne disease outbreaks in humans. Despite the risk this zoonotic agent poses to animals and people, little is known regarding the environmental factors that affect its persistence in the sea. The goal of this study was to evaluate the impact of two constituents on the survival of Salmonella in the marine environment: transparent exopolymer particles (TEP) and suspended particles. A decay experiment was conducted by spiking Salmonella into bottles containing seawater, seawater with alginic acid as a source of TEP, filtered seawater or filtered seawater with alginic acid. Survival of Salmonella was monitored using culture followed by enrichment assays to evaluate if the bacteria entered a viable but non-cultivable (VBNC) state. Salmonella cell counts dropped significantly faster (P ≤ 0.05) in the unfiltered seawater samples with and without TEP. The slowest decay occurred in filtered seawater containing alginic acid, with VBNC Salmonella persisting for 17 months. These findings suggest that TEP may favor Salmonella survival while suspended particles facilitate its decay. Insight on the survival of allochthonous, zoonotic pathogens in seawater can guide monitoring, management and policy decisions relevant to wildlife and human public health. © FEMS 2015. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

Radiation Chemistry of Xenon Trioxide, Xenate and Perxenate and Photochemistry of Perxenate - A Pulse Radiolysis and Laser Flash-Photolysis Study

DEFF Research Database (Denmark)

Kläning, U. K.; Sehested, Knud; Wolff, T.

1982-01-01

O2–6 are assumed. HXeO3 and H3XeO2–6 are formed in reactions of the hydrated electron with XeO3 and HXeO3–6, respectively. HXeO4 and H3XeO2–7 are formed in reactions of the hydroxyl radical with XeO3 and HXeO3–6 in which the hydroxyl radical adds to a ligand oxygen atom to form peroxy compounds. HXe......O2–5 is formed in a reaction with the hydroxyl radical anion in which the hydroxyl radical anion adds to the xenon atom and by photolysis of HXeO3–6: HXeO3–6 [graphic omitted] HXeO2–5+ O–. XeV, XeVII and XeIX and corresponding iodine species in the oxidation states four, six and eight have similar...

Photolysis of sulfamethoxypyridazine in various aqueous media: Aerobic biodegradation and identification of photoproducts by LC-UV–MS/MS

Energy Technology Data Exchange (ETDEWEB)

Khaleel, Nareman D.H., E-mail: drndahshan@yahoo.com [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Leuphana University Lüneburg, C13, DE-21335 Lüneburg (Germany); Pharmaceutical Analytical Chemistry Department, Faculty of Pharmacy, Suez Canal University, Ismailia 41522 (Egypt); Mahmoud, Waleed M.M. [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Leuphana University Lüneburg, C13, DE-21335 Lüneburg (Germany); Pharmaceutical Analytical Chemistry Department, Faculty of Pharmacy, Suez Canal University, Ismailia 41522 (Egypt); Hadad, Ghada M.; Abdel-Salam, Randa A. [Pharmaceutical Analytical Chemistry Department, Faculty of Pharmacy, Suez Canal University, Ismailia 41522 (Egypt); Kümmerer, Klaus, E-mail: Klaus.Kuemmerer@uni.leuphana.de [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Leuphana University Lüneburg, C13, DE-21335 Lüneburg (Germany)

2013-01-15

Highlights: ► Sulfonamides are one of the most extensively used antibiotics in human and veterinary medicine. ► Sulfamethoxypyridazine (SMP) underwent photodegradation in three different media. ► SMP was not readily biodegradable. ► SMP and some of its degradation products were identified by LC-UV–MS/MS. -- Abstract: Sulfonamides are one of the most frequently used antibiotics worldwide. Therefore, mitigation processes such as abiotic or biotic degradation are of interest. Photodegradation and biodegradation are the potentially significant removal mechanisms for pharmaceuticals in aquatic environments. The photolysis of sulfamethoxypyridazine (SMP) using a medium pressure Hg-lamp was evaluated in three different media: Millipore water pH 6.1 (MW), effluent from sewage treatment plant pH 7.6 (STP), and buffered demineralized water pH 7.4 (BDW). Identification of transformation products (TPs) was performed by LC-UV–MS/MS. The biodegradation of SMP using two tests from the OECD series was studied: Closed Bottle test (OECD 301 D), and Manometric Respirometry test (OECD 301 F). In biodegradation tests, it was found that SMP was not readily biodegradable so it may pose a risk to the environment. The results showed that SMP was removed completely within 128 min of irradiation in the three media, and the degradation rate was different for each investigated type of water. However, dissolved organic carbon (DOC) was not removed in BDW and only little DOC removal was observed in MW and STP, thus indicating the formation of TPs. Analysis by LC-UV–MS/MS revealed new TPs formed. The hydroxylation of SMP represents the main photodegradation pathway.

Photolysis of sulfamethoxypyridazine in various aqueous media: Aerobic biodegradation and identification of photoproducts by LC-UV–MS/MS

International Nuclear Information System (INIS)

Khaleel, Nareman D.H.; Mahmoud, Waleed M.M.; Hadad, Ghada M.; Abdel-Salam, Randa A.; Kümmerer, Klaus

2013-01-01

Highlights: ► Sulfonamides are one of the most extensively used antibiotics in human and veterinary medicine. ► Sulfamethoxypyridazine (SMP) underwent photodegradation in three different media. ► SMP was not readily biodegradable. ► SMP and some of its degradation products were identified by LC-UV–MS/MS. -- Abstract: Sulfonamides are one of the most frequently used antibiotics worldwide. Therefore, mitigation processes such as abiotic or biotic degradation are of interest. Photodegradation and biodegradation are the potentially significant removal mechanisms for pharmaceuticals in aquatic environments. The photolysis of sulfamethoxypyridazine (SMP) using a medium pressure Hg-lamp was evaluated in three different media: Millipore water pH 6.1 (MW), effluent from sewage treatment plant pH 7.6 (STP), and buffered demineralized water pH 7.4 (BDW). Identification of transformation products (TPs) was performed by LC-UV–MS/MS. The biodegradation of SMP using two tests from the OECD series was studied: Closed Bottle test (OECD 301 D), and Manometric Respirometry test (OECD 301 F). In biodegradation tests, it was found that SMP was not readily biodegradable so it may pose a risk to the environment. The results showed that SMP was removed completely within 128 min of irradiation in the three media, and the degradation rate was different for each investigated type of water. However, dissolved organic carbon (DOC) was not removed in BDW and only little DOC removal was observed in MW and STP, thus indicating the formation of TPs. Analysis by LC-UV–MS/MS revealed new TPs formed. The hydroxylation of SMP represents the main photodegradation pathway

Preperitoneal Surgery Using a Self-Adhesive Mesh for Inguinal Hernia Repair

OpenAIRE

Mangram, Alicia; Oguntodu, Olakunle F.; Rodriguez, Francisco; Rassadi, Roozbeh; Haley, Michael; Shively, Cynthia J.; Dzandu, James K.

2014-01-01

Background and Objectives: Laparoscopic preperitoneal hernia repair with mesh has been reported to result in improved patient outcomes. However, there are few published data on the use of a totally extraperitoneal (TEP) approach. The purpose of this study was to present our experience and evaluate early outcomes of TEP inguinal hernia repair with self-adhesive mesh. Methods: This cohort study was a retrospective review of patients who underwent laparoscopic TEP inguinal hernial repair from Ap...

Synthesis and Characterisation of Tris(1-carboxyl-2-phenyl-1,2-ethyl eno dithiol enic-S,S') Tungsten Complex as Photo catalyst for Photolysis of H2O Molecules

International Nuclear Information System (INIS)

Fadhli Hadana Rahman; Rusli Daik; Mohammad Kassim; Khuzaimah; Wan Ramli Wan Daud

2008-01-01

Tris(1-carboxyl-2-phenyl-1,2-ethylenodithiolenic-S,S ' ) tungsten complex is one of the most promising photo catalyst to be used in photolysis of water to produce hydrogen. The first step of the synthesis involves a metathesis reaction of tetrapropylammonium bromide [((C 3 H 7 ) 4 N)Br] and ammonium tetrathiotungstate [(NH 4 ) 2 WS 4 ] to form a tetrapropylammonium tetrathiotungstate [((C 3 H 7 ) 4 N) 2 WS 4 ] (precursor). Then, the precursor was reacted with phenyl acetylenecarboxylic acid (C 9 H 6 O 2 ) to form tris(1-carboxyl-2-phenyl-1,2-ethylenodithiolenic-S,S ' ) tungsten complex (C 27 H 18 O 2 S 6 W). The infra-red, ultra violet/ visible (UV/ Vis) spectrum, nuclear magnetic resonance (NMR) and elemental micro-analysis of C, H, N and S agreed with the characteristic of the tris(1-carboxyl-2-phenyl-1,2-ethylenodithiolenic-S,S ' ) tungsten complex. The (W-S), (C-S) and (C=O) stretching frequencies were detected at 511, (1470 and 1035) and 1655 cm -1 , respectively. The 1 H NMR spectrum showed six protons in the complex. The 13 C NMR showed only 7 signals for carbon atom in the benzene ring, ethylene groups and carboxylic acid pendant group due to the symmetry of the molecules. The reaction yield was about 50 percent. Photolysis of acetone spiked H 2 O showed that the catalyst was able to produced 1.8 μmol/ h hydrogen. (author)

Temporal variation and interaction of full size spectrum Alcian blue stainable materials and water quality parameters in a reservoir.

Science.gov (United States)

Thuy, Nguyen Thi; Lin, Justin Chun-Te; Juang, Yaju; Huang, Chihpin

2015-07-01

This paper reports on the fate of different fractions of Alcian blue (AB) stainable material in Pao-Shan reservoir, Taiwan, in a one-year study (2013-2014) and an intensive study during phytoplankton bloom (2014). The interactions between the fractions, including AB stained particles, particle and colloidal transparent exopolymer particles (pTEP and cTEP), dissolved acid polysaccharide (dAPS), and their relationship to other water quality parameters were analyzed. The Flow Cytometer and Microscope (FlowCAM) was for first time used to characterize AB stained particles. The results of the one-year study likely showed relationships of pTEP concentration to phytoplankton count and chlorophyll a, while in the intensive study, AB stained particles abundance and pTEP concentration were correlated neither phytoplankton count nor chlorophyll a, but strongly positively correlated with some phytoplankton species' abundance. The difference indicates that sampling frequency and phytoplankton composition should be addressed for studying the links between AB stained fractions and phytoplankton. The interaction between different AB stained fractions further suggests that the majority of AB stained particles and pTEP would be directly generated by some phytoplankton species, whereas their abiotic generation by cTEP or dAPS may only have contributed partly to their formation. This differs from previous studies which generally posited that pTEP are mainly formed abiotically from dissolved precursors. Successful application of FlowCAM for visualization of AB stained particles recommends this technique by which particle morphologies can be conserved and morphological features of particle can be simultaneously elucidated. Copyright © 2015 Elsevier Ltd. All rights reserved.

The Mosquito Melanization Response Is Implicated in Defense against the Entomopathogenic Fungus Beauveria bassiana

Science.gov (United States)

Osta, Mike A.

2012-01-01

Mosquito immunity studies have focused mainly on characterizing immune effector mechanisms elicited against parasites, bacteria and more recently, viruses. However, those elicited against entomopathogenic fungi remain poorly understood, despite the ubiquitous nature of these microorganisms and their unique invasion route that bypasses the midgut epithelium, an important immune tissue and physical barrier. Here, we used the malaria vector Anopheles gambiae as a model to investigate the role of melanization, a potent immune effector mechanism of arthropods, in mosquito defense against the entomopathogenic fungus Beauveria bassiana, using in vivo functional genetic analysis and confocal microscopy. The temporal monitoring of fungal growth in mosquitoes injected with B. bassiana conidia showed that melanin eventually formed on all stages, including conidia, germ tubes and hyphae, except the single cell hyphal bodies. Nevertheless, melanin rarely aborted the growth of any of these stages and the mycelium continued growing despite being melanized. Silencing TEP1 and CLIPA8, key positive regulators of Plasmodium and bacterial melanization in A. gambiae, abolished completely melanin formation on hyphae but not on germinating conidia or germ tubes. The detection of a layer of hemocytes surrounding germinating conidia but not hyphae suggested that melanization of early fungal stages is cell-mediated while that of late stages is a humoral response dependent on TEP1 and CLIPA8. Microscopic analysis revealed specific association of TEP1 with surfaces of hyphae and the requirement of both, TEP1 and CLIPA8, for recruiting phenoloxidase to these surfaces. Finally, fungal proliferation was more rapid in TEP1 and CLIPA8 knockdown mosquitoes which exhibited increased sensitivity to natural B. bassiana infections than controls. In sum, the mosquito melanization response retards significantly B. bassiana growth and dissemination, a finding that may be exploited to design transgenic

Direct photolysis rates and transformation pathways of the lampricides TFM and niclosamide in simulated sunlight

Science.gov (United States)

McConville, Megan B.; Hubert, Terrance D.; Remucal, Christina K.

2016-01-01

The lampricides 3-trifluoromethyl-4-nitrophenol (TFM) and 2′,5-dichloro-4′-nitrosalicylanilide (niclosamide) are directly added to many tributaries of the Great Lakes that harbor the invasive parasitic sea lamprey. Despite their long history of use, the fate of lampricides is not well understood. This study evaluates the rate and pathway of direct photodegradation of both lampricides under simulated sunlight. The estimated half-lives of TFM range from 16.6 ± 0.2 h (pH 9) to 32.9 ± 1.0 h (pH 6), while the half-lives of niclosamide range from 8.88 ± 0.52 days (pH 6) to 382 ± 83 days (pH 9) assuming continuous irradiation over a water depth of 55 cm. Both compounds degrade to form a series of aromatic intermediates, simple organic acids, ring cleavage products, and inorganic ions. Experimental data were used to construct a kinetic model which demonstrates that the aromatic products of TFM undergo rapid photolysis and emphasizes that niclosamide degradation is the rate-limiting step to dehalogenation and mineralization of the lampricide. This study demonstrates that TFM photodegradation is likely to occur on the time scale of lampricide applications (2–5 days), while niclosamide, the less selective lampricide, will undergo minimal direct photodegradation during its passage to the Great Lakes.

Direct Photolysis Rates and Transformation Pathways of the Lampricides TFM and Niclosamide in Simulated Sunlight.

Science.gov (United States)

McConville, Megan B; Hubert, Terrance D; Remucal, Christina K

2016-09-20

The lampricides 3-trifluoromethyl-4-nitrophenol (TFM) and 2',5-dichloro-4'-nitrosalicylanilide (niclosamide) are directly added to many tributaries of the Great Lakes that harbor the invasive parasitic sea lamprey. Despite their long history of use, the fate of lampricides is not well understood. This study evaluates the rate and pathway of direct photodegradation of both lampricides under simulated sunlight. The estimated half-lives of TFM range from 16.6 ± 0.2 h (pH 9) to 32.9 ± 1.0 h (pH 6), while the half-lives of niclosamide range from 8.88 ± 0.52 days (pH 6) to 382 ± 83 days (pH 9) assuming continuous irradiation over a water depth of 55 cm. Both compounds degrade to form a series of aromatic intermediates, simple organic acids, ring cleavage products, and inorganic ions. Experimental data were used to construct a kinetic model which demonstrates that the aromatic products of TFM undergo rapid photolysis and emphasizes that niclosamide degradation is the rate-limiting step to dehalogenation and mineralization of the lampricide. This study demonstrates that TFM photodegradation is likely to occur on the time scale of lampricide applications (2-5 days), while niclosamide, the less selective lampricide, will undergo minimal direct photodegradation during its passage to the Great Lakes.

Reviewer Volume 27, Tahun 2007

OpenAIRE

Volume 27, Tahun 2007, Reviewer

2007-01-01

1. Abdul Rozaq, Dr., Ir., DAA Jurusan Teknik Pertanian (TEP), Fakultas Teknologi Pertanian (FTP), Universitas Gadjah Mada (UGM), Yogyakarta2. Bambang Purwantana, Ir., Dr., M.Agr. Jurusan TEP, FTP-UGM3. Chusnul Hidayat, Ir., Dr. Jurusan Teknologi Pangan dan Hasil Pertanian (TPHP), Fakultas Teknologi Pertanian (FTP), Universitas Gadjah Mada (UGM), Yogyakarta4. Haryadi, Ir., Dr., Prof., M. App. Sc. Jurusan TPHP, FTP-UGM5. Lilik Sutiarso, Ir., Dr., M. Eng. Jurusan TEP, FTP-UGM6. Pudji Hastuti, Ir...

Hoechst 33258 dye generates DNA-protein cross-links during ultraviolet light-induced photolysis of bromodeoxyuridine in replicated and repaired DNA

Energy Technology Data Exchange (ETDEWEB)

Guo Xicang; Morgan, W.F.; Cleaver, J.E.

1986-08-01

Substitution of bromodeoxyuridine for thymidine in the DNA of mammalian cells sensitizes them to a range of wavelengths of ultraviolet light. Cells are also sensitized to photochemical reactions involving dyes such as Hoechst 33258, which is used to produce differential staining of chromatids according to their bromodeoxyuridine content. Irradiation with 313 nm light of human and hamster cells containing bromodeoxyuridine in their DNA produced single-strand breaks but no DNA-protein cross-links. Irradiation with 360 nm light in the presence of Hoechst 33258 produced extensive DNA-protein cross-linkage as well as single-strand breaks. These cross-links were observed in DNA containing bromodeoxyuridine incorporated by either semiconservative or repair replication. When the protein was removed with proteinase K, bromodeoxyuridine in repair patches after irradiation by doses of ultraviolet (254 nm) light as low as 0.26 J/m/sup 2/ could readily be detected. Hoechst 33258-mediated photolysis, therefore, provides a sensitive new technique for measuring repair replication after ultraviolet light irradiation.

Trombose venosa profunda e suspeita de tromboembolismo pulmonar: avaliação simultânea por meio de angiotomografia pulmonar e venotomografia combinadas Deep venous thrombosis with suspected pulmonary embolism: simultaneous evaluation using combined CT venography and pulmonary CT angiography

Directory of Open Access Journals (Sweden)

Laura de Moraes Gomes

2006-02-01

Full Text Available OBJETIVO: Avaliar a ocorrência e a correlação de tromboembolismo pulmonar (TEP e trombose venosa profunda (TVP por meio de um protocolo único de angiotomografia computadorizada. MATERIAIS E MÉTODOS: Estudo prospectivo realizado de julho de 2003 a junho de 2004 no Hospital Copa D'Or, Rio de Janeiro, RJ. Foram analisadas 116 angiotomografias de pacientes com suspeita clínica de TEP. Após o estudo do tórax, com um intervalo de três minutos e sem injeção adicional de contraste, foram obtidos cortes do diafragma até os joelhos, a fim de pesquisar TVP. RESULTADOS: De 116 pacientes, 23 (19,8% cursaram com TEP, 24 com TVP (20,7%, 15 (12,9% apresentaram tanto TEP quanto TVP e 9 (7,8% apresentaram TVP na ausência de TEP. Dos 23 casos positivos de TEP, 15 apresentaram concomitantemente TVP (65,2%, enquanto em 8 (34,8% foi visto apenas TEP. Dos 24 casos positivos de TVP, 15 (62,5% apresentaram TEP associado, enquanto em 9 (37,5% foi encontrada TVP isolada. CONCLUSÃO: Os resultados demonstraram a forte relação entre TEP e TVP, a importância de pesquisar TVP nos casos com suspeita de TEP e a utilidade do uso combinado da angiotomografia de tórax e da venotomografia como alternativa de único exame de investigação de TEP e TVP simultaneamente.OBJECTIVE: To evaluate the occurrence and the correlation between pulmonary embolism (PE and deep venous thrombosis (DVT using a single CT angiography protocol. MATERIALS AND METHODS: This was a prospective study performed at Hospital Copa D'Or, Rio de Janeiro, Brazil from July 2003 to June 2004. We analyzed 116 CT angiography examinations of patients with clinical suspicion of PE. After an interval of approximately three minutes, venous phase images from the diaphragm to the knees were acquired without additional contrast injection in order to determine the presence of DVT. RESULTS: From the 116 patients studied, 23 (19.8% had PE, 24 (20.7% had DVT, 15 (12.9% had both PE and DVT and 9 (7.8% had DVT

Thermoelectric power measurements in Fe doped La sub 0 sub . sub 6 sub 5 Ca sub 0 sub . sub 3 sub 5 MnO sub 3

CERN Document Server

Aslam, A; Zubair, M; Akhtar, M J; Nadeem, M

2002-01-01

We report measurements of the thermoelectric power (TEP) on the La sub 0 sub . sub 6 sub 5 Ca sub 0 sub . sub 3 sub 5 Mn sub 1 sub - sub x Fe sub x O sub 3 system for 0.00 <= x <= 0.07. The ferromagnetic and metallic transition temperatures are lowered and the TEP shows an increasingly positive trend with the addition of Fe. We also observe a clear magnetic contribution that manifests itself as a peak in the TEP close to the critical temperature. The activation energies determined from the TEP are seen to be insensitive to the Fe content. The data are interpreted firstly as showing a decrease in the density of active holes, i.e. holes that can participate in the hopping process, with increasing Fe content. Secondly the data suggest the role of magnetic scattering due to the clusters formed by the antiferromagnetically coupled Fe. Abrupt changes in the variation of the TEP are observed at the concentration region x approx 0.04 consistent with the hole density variation and with previously reported transp...

Application of thermoelectricity to NDE of thermally aged cast duplex stainless steels and neutron irradiated ferritic steels

International Nuclear Information System (INIS)

Coste, J.F.; Leborgne, J.M.; Massoud, J.P.; Grisot, O.; Miloudi, S.

1997-10-01

The thermoelectric power (TEP) of an alloy depends mainly on its temperature, its chemical composition and its atomic arrangement. The TEP measurement technique is used in order to study and follow two degradation phenomena affecting some components of the primary loop of Pressurized Water Reactors (PWR). The first degradation phenomenon is the thermal aging of cast duplex stainless steel components. The de-mixing of the ferritic Fe-Cr-Ni slid solution is responsible for the decreasing of the mechanical characteristics. Laboratory studies have shown the sensitivity of TEP to the de-mixing phenomenon. TEP increases linearly with the ferrite content and with and Arrhenius-type aging parameter depending on time, temperature and activation energy. TEP is also correlated to mechanic characteristics. The second degradation phenomenon is the aging of ferritic steels due to neutron irradiation at about 290 deg C. In this case, the degradation mechanism is the formation of clusters of solute atoms and/or copper rich precipitates that causes the hardening of the material. As a first approach, a study of binary Fe-Cu alloys irradiated by electrons at 288 deg C has revealed the possibility of following the copper depletion of the ferritic matrix. Moreover, the recovery of the mechanical properties of the alloy by annealing can be monitored. Finally, a correlation between Vickers hardness and TEP has been established. (author)

Stochastic modelling of optimum initial body weight, daily weight gain and effect of genetic changes in ovulation rate and age at sexual maturity on total egg production of broiler breeders.

Science.gov (United States)

Alvarez, R; Hocking, P M

2009-01-01

1. A model that simulates the total production of eggs (TEP) in broiler breeders was used to predict the optimum initial (20 week) body weight (IBWexp), daily weight gains from 20 to 30 (DWGexp(20-30)) and 31 to 62 weeks of age (DWGexp(31-62)), age at photostimulation (affecting age at first egg, AFEexp), coefficients of variation of initial body weight (CV-IBWexp) and age at first egg (CV-AFEexp), and the effect of genetically increasing the numbers of yellow follicles at the onset of lay. 2. The results suggest that TEP in broiler breeders is very sensitive to changes in body weight gain during the first 10 weeks of the production period and body weight at the start of egg production, whereas changes in body weight gain after peak rate of lay showed only minor effects on TEP. Increasing CV-IBWexp was associated with a linear decrease in the mean and increased variability of TEP. 3. Decreasing AFEexp was negatively associated with TEP, whereas higher CV-AFEexp increased variability of TEP and had a trivial affect on the mean. 4. Results of the simulation suggested that reducing ovarian yellow follicle numbers by means of genetic selection could reduce the degree of feed restriction currently used in broiler breeder commercial stocks while maintaining total egg production. Higher numbers of yellow follicles associated with selection for higher growth rate would not result in lower egg production if the body weight target was maintained at the currently recommended commercial level and the effect on TEP of increasing the target in proportion to potential body weight may be relatively small.

Transmission expansion in an oligopoly considering generation investment equilibrium

DEFF Research Database (Denmark)

Taheri, S. Saeid; Kazempour, Jalal; Seyedshenava, Seyedjalal

2017-01-01

the future generation investment actions. However, in such an oligopolistic market, each producer makes its own strategic generation investment decisions. This motivates the transmission system planner to consider the generation investment decision-making problem of all producers within its TEP model......Transmission expansion planning (TEP) is a sophisticated decision-making problem, especially in an oligopolistic electricity market in which a number of strategic (price-maker) producers compete together. A transmission system planner, who is in charge of making TEP decisions, requires considering....... This paper proposes a tri-level TEP decision-making model to be solved by the transmission system planner, whose objective is to maximize the social welfare of the market minus the expansion costs, and whose constraints are the transmission expansion limits as well as the generation investment equilibrium...

UV radiation-induced photochemical damage of tryptophan in peptides, proteins and ocular lenses

International Nuclear Information System (INIS)

Hibbard, L.B.

1985-01-01

These studies were undertaken to investigate the possible involvement of the amino acid tryptophan in the near-ultraviolet radiation-induced photochemical alteration of peptides and proteins and the role tryptophan photolysis plays in ocular lens damage. Sample irradiations were performed to determine if tryptophan photolysis occurs with radiation in the UV-A region in comparison to photolysis induced by wavelengths in the normal absorption band of the amino acid (UV-B). Photolysis studies were carried out on free tryptophan and two dipeptides, tryptophyglycine and glycyltryptophan, in aqueous solutions at different pH values in the range 4.5-10.0 under aerated or anaerobic conditions. Rates of photolysis of these 290 nm-irradiated compounds, detected by observing tryptophan fluorescence intensity loss during irradiation, were compared and significant differences were observed for each compound which varied with pH and oxygen environment. Another series of experiments examined the photolysis of tryptophan residues in lens proteins in whole rat lenses induced by 290 nm and 298 nm dye laser radiation. Tryptophan residue photolysis was, once again, monitored by loss in tryptophan fluorescence intensity. A relationship was derived between tryptophan loss and photoproduct buildup during irradiation

Electron spin ressonance of radicals produced by ultra-violet photolysis of KCL dopped with potassium cyanide and potassium cyanate

International Nuclear Information System (INIS)

Duran, J.E.R.

1975-01-01

The production of radicals by ultra-violet photolysis of KCL dopped with potassium cyanide and potassium cyanate is studied by electron spin resonance. Several new paramagnetic species are detected which are identified as HCNO - , NCN - /NCNO - , CNN - /CNON - and CNOsup(=) all giving isotropic spectra at 77 0 K. The temperature dependence of the CNOsup(=) spectrum is investigated down to 1.6 0 K. It is found that two different recrientation motions ocurr which freeze at different temperatures. The effect of this motion on the line width is analized using Anderson's theory of exchange narrowing. The electronic structure of the CNOsup(=) radical is discussed using the measured the carbon and nitrogen hfs constants. It is found that a bonding scheme similar to that accepted for the isoelectronic molecule NO 2 is applicable, and a one electron molecular orbital scheme is given. Within this scheme a negative contribution to the nitrogen isotropic hfs constant is found which is assumed to originate from the polarization of the fully occupied ls orbitals [pt

A randomized placebo-controlled study of noninvasive cortical electrostimulation in the treatment of fibromyalgia patients.

Science.gov (United States)

Hargrove, Jeffrey B; Bennett, Robert M; Simons, David G; Smith, Susan J; Nagpal, Sunil; Deering, Donald E

2012-01-01

The aim of this multicenter study was to evaluate the efficacy, safety, and tolerability of noninvasive cortical electrostimulation in the management of fibromyalgia (FM). A prospective, randomized, double-blind, placebo-controlled design was used. Setting.  Subjects received therapy at two different outpatient clinical locations. There were 77 subjects meeting the American College of Rheumatology 1990 classification criteria for FM. Intervention.  Thirty-nine (39) active treatment (AT) FM patients and 38 placebo controls received 22 applications of either noninvasive cortical electrostimulation or a sham therapy over an 11-week period. The primary outcome measures were the number of tender points (TePs) and pressure pain threshold (PPT). Secondary outcome measures were responses to the Fibromyalgia Impact Questionnaire (FIQ), Symptom Checklist-90 (SCL-90), Beck Depression Inventory-II, and a novel sleep questionnaire, all evaluated at baseline and at the end of treatment. Intervention provided significant improvements in TeP measures: compared with placebo, the AT patients improved in the number of positive TePs (-7.4 vs -0.2, PFIQ score (-15.5 vs -5.6, P=0.03), FIQ pain (-2.0 vs -0.6, P=0.03), FIQ fatigue (-2.0 vs -0.4, P=0.02), and FIQ refreshing sleep (-2.1 vs -0.7, P=0.02); and while FIQ function improved (-1.0 vs -0.2), the between-group change had a 14% likelihood of occurring due to chance (P=0.14). There were no significant side effects observed. Noninvasive cortical electrostimulation in FM patients provided modest improvements in pain, TeP measures, fatigue, and sleep; and the treatment was well tolerated. This form of therapy could potentially provide worthwhile adjunctive symptom relief for FM patients. Wiley Periodicals, Inc.

Development of a non-thermal accelerated pulsed UV photolysis assisted digestion method for fresh and dried food samples

International Nuclear Information System (INIS)

Solis, C.; Lagunas-Solar, M.C.; Perley, B.P.; Pina, C.; Aguilar, L.F.; Flocchini, R.G.

2002-01-01

A simple, fast digestion procedure for fresh and dried foods, using high-power pulsed UV photolysis in the presence of hydrogen peroxide, is being developed. The homogenized food samples were mixed with H 2 O 2 or with a mixture of H 2 O 2 and HNO 3 , and irradiated for short times with a 248-nm UV excimer laser. After centrifugation, a clear, colorless solution was obtained and aliquots were deposited on Teflon filters for XRF and/or PIXE analyses. Standard reference materials (NIST Peach Leaves; Typical Diet) were also analyzed to compare recoveries and detection limits. Improvements in detection limits were observed, but a few trace elements (<1 ppm) were not reproducibly detected (Fe, Sr). This method proved to be practical for the accelerated digestion of food samples and preparing analytes in short-time intervals. In combination with PIXE and XRF, it allows high-sensitivity multi-elemental analyses for screening the nutritional elements and for food safety purposes regarding the potential presence of toxic elements. Further development to optimize and validate this procedure for a broader range of analytes is in progress

A laser flash photolysis and quantum chemical study of the fluorinated derivatives of singlet phenylnitrene.

Science.gov (United States)

Gritsan, N P; Gudmundsdóttir, A D; Tigelaar, D; Zhu, Z; Karney, W L; Hadad, C M; Platz, M S

2001-03-07

Laser flash photolysis (LFP, Nd:YAG laser, 35 ps, 266 nm, 10 mJ or KrF excimer laser, 10 ns, 249 nm, 50 mJ) of 2-fluoro, 4-fluoro, 3,5-difluoro, 2,6-difluoro, and 2,3,4,5,6-pentafluorophenyl azides produces the corresponding singlet nitrenes. The singlet nitrenes were detected by transient absorption spectroscopy, and their spectra are characterized by sharp absorption bands with maxima in the range of 300-365 nm. The kinetics of their decay were analyzed as a function of temperature to yield observed decay rate constants, k(OBS). The observed rate constant in inert solvents is the sum of k(R) + k(ISC) where k(R) is the absolute rate constant of rearrangement of singlet nitrene to an azirine and k(ISC) is the absolute rate constant of nitrene intersystem crossing (ISC). Values of k(R) and k(ISC) were deduced after assuming that k(ISC) is independent of temperature. Barriers to cyclization of 4-fluoro-, 3,5-difluoro-, 2-fluoro-, 2,6-difluoro-, and 2,3,4,5,6-pentafluorophenylnitrene in inert solvents are 5.3 +/- 0.3, 5.5 +/- 0.3, 6.7 +/- 0.3, 8.0 +/- 1.5, and 8.8 +/- 0.4 kcal/mol, respectively. The barrier to cyclization of parent singlet phenylnitrene is 5.6 +/- 0.3 kcal/mol. All of these values are in good quantitative agreement with CASPT2 calculations of the relative barrier heights for the conversion of fluoro-substituted singlet aryl nitrenes to benzazirines (Karney, W. L. and Borden, W. T. J. Am. Chem. Soc. 1997, 119, 3347). A single ortho-fluorine substituent exerts a small but significant bystander effect on remote cyclization that is not steric in origin. The influence of two ortho-fluorine substituents on the cyclization is pronounced. In the case of the singlet 2-fluorophenylnitrene system, evidence is presented that the benzazirine is an intermediate and that the corresponding singlet nitrene and benzazirine interconvert. Ab initio calculations at different levels of theory on a series of benzazirines, their isomeric ketenimines, and the transition

Photoionization of oxidized coenzyme Q in microemulsion: laser flash photolysis study in biomembrane-like system.

Science.gov (United States)

Li, Kun; Wang, Mei; Wang, Jin; Zhu, Rongrong; Sun, Dongmei; Sun, Xiaoyu; Wang, Shi-Long

2013-01-01

Photoexcitation to generate triplet state has been proved to be the main photoreaction in homogeneous system for many benzoquinone derivatives, including oxidized coenzyme Q (CoQ) and its analogs. In the present study, microemulsion of CoQ, a heterogeneous system, is employed to mimic the distribution of CoQ in biomembrane. The photochemistry of CoQ(10) in microemulsion and cyclohexane is investigated and compared using laser flash photolysis and results show that CoQ(10) undergoes photoionization via a monophotonic process to generate radical cation of CoQ(10) in microemulsion and photoexcitation to generate excited triplet state in cyclohexane. Meanwhile, photoreactions of duroquinone (DQ) and CoQ(0) in microemulsion are also investigated to analyze the influence of molecular structure on the photochemistry of benzoquinone derivatives in microemulsion. Results suggest that photoexcitation, which is followed by excited state-involved hydrogen-abstraction reaction, is the main photoreaction for DQ and CoQ(0) in microemulsion. However, photoexcited CoQ(0) also leads to the formation of hydrated electrons. The isoprenoid side chain-involved high resonance stabilization is proposed to explain the difference in photoreactions of CoQ(0) and CoQ(10) in microemulsion. Considering that microemulsion is close to biomembrane system, its photoionization in microemulsion may be helpful to understand the real photochemistry of biological quinones in biomembrane system. © 2012 Tongji University. Photochemistry and Photobiology © 2012 The American Society of Photobiology.

High pressure studies of as grown WX2-x single crystals

International Nuclear Information System (INIS)

Solanki, G.K.; Agarwal, M.K.; Patel, Yogesh A.

2011-01-01

The structural optical and transport properties of tungsten metal dichalogenides having layered structure have been extensively studied in the last two decades. These materials shows highly anisotropic behaviour and have been receiving considerable interest for a variety of applications. Several of these layered semiconductors have attracted attention as a new class of solar cell material. We present here the results of simultaneous resistivity and thermoelectric power (TEP) measurements upto 7 GPa on single crystals of WS 2 , WS 1.9 , WSe 2 and WSe 1.9 grown using Direct Vapour Transport (DVT) technique. The observations clearly shows WS 2 and WS 1.9 are more resistive compared to other two crystals. In all samples an exponential fall of resistivity on increases in pressure upto 2.1 GPa but after 2.2 GPa the resistivity decreases substantially with increases pressure. The TEP of WSe 2 increases steadily and reaches maximum at 0.65 GPa, while for WSe 1.9 TEP increases upto pressure 0.5 GPa. In both the cases after attaining the maximum TEP, then decreases monotonically with increase in pressure. TEP of WS 2 and WS 1.9 increase upto pressure 1.1 GPa, beyond 1.1 GPa pressure in both the cases TEP decreases steadily with further increase in pressure. In all the samples, the sign of TEP is positive indicating that all of them are p-type and remain p-type with increase in pressure. The variation of thermoelectric power factor with pressure has been thoroughly studied. An analysis of the data point out that perfectly stoichiometric crystals of WSe 2 work as superior thermoelectric materials. The results have been presented and implications have been discussed. (author)

Photochemical defluorination of aqueous perfluorooctanoic acid (PFOA) by Fe(0)/GAC micro-electrolysis and VUV-Fenton photolysis.

Science.gov (United States)

Zhang, Li-Hong; Cheng, Jian-Hua; You, Xia; Liang, Xiao-Yan; Hu, Yong-You

2016-07-01

Perfluorooctanoic acid (PFOA) is extremely persistent and bioaccumulative in the environment; thus, it is very urgent to investigate an effective and moderate technology to treat the pollution of PFOA. In this study, a process combined iron and granular activated carbon (Fe(0)/GAC) micro-electrolysis with VUV-Fenton system is employed for the remediation of PFOA. Approximately 50 % PFOA (10 mg L(-1)) could be efficiently defluorinated under the following conditions: pH 3.0, dosage of Fe 7.5 g L(-1), dosage of GAC 12.5 g L(-1), and concentration of H2O2 22.8 mmol L(-1). Meanwhile, during the process, evident defluorination was observed and the concentration of fluoride ion was eventually 3.23 mg L(-1). The intermediates including five shorter-chain perfluorinated carboxylic acids (PFCAs), i.e., C7, C6, C5, C4, and C3, were also analyzed by high-performance liquid chromatography tandem mass spectrometry (HPLC/MS/MS) and defluorination mechanisms of PFOA was proposed, which involved photochemical of OH·, direct photolysis (185-nm VUV), and photocatalytic degradation of PFOA in the presence of Fe(3+) (254-nm UV).

Triplet state and semiquinone free radical of 5-methoxyquinizarin : a laser flash photolysis and pulse radiolysis study

International Nuclear Information System (INIS)

Pal, H.; Patil, D.K.; Mukherjee, T.; Mittal, J.P.

1992-01-01

The triplet(T) state properties like T-T absorption spectra, quantum yield, energy level and decay kinetics of 5-methoxyquinizarin (5-methoxy-1, 4-dihydroxy-9, 10-anthraquinone; MQZ) have been investigated in cyclohexane, acetonitrile and isopropyl alcohol using nanosecond laser flash photolysis technique. In isopropylalcohol, a neutral semiquinone radical is also formed which has been characterised by comparing the long lived transient spectra with the MQZ-semiquinone spectra obtained by pulse radiolysis of MQZ in the same solvent. A relatively small amount of a long lived transient formed in cyclohexane and acetonitrile, along with the triplet state of MQZ, could not be characterised unambiguously, but has been attributed to the semiquinone radical of MQZ, produced by the reaction of the excited states of the quinone with the solvent. The quantum yield of the semiquinone radical in isopropyl alcohol is considerably higher than the triplet quantum yield, showing that both the excited singlet and the triplet states of the quinone probably react with the solvent molecules to form the semiquinone radical. The photophysical properties of the triplet and the semiquinone radical of MQZ have been compared with those of simple 1,4-disubstituted anthraquinones. (author). 23 refs., 5 figs., 1 tab

Organic carbon movement through two SWRO facilities from source water to pretreatment to product with relevance to membrane biofouling

KAUST Repository

Alshahri, Abdullah; Dehwah, Abdullah; Leiknes, TorOve; Missimer, Thomas M.

2016-01-01

reductions. The mixed media filtration process was marginally useful in removing some TOC and NOM, but had little effect on TEP removal. Some bacterial regrowth may be occurring in the cartridge filters, but the evidence is inconsistent. Significant

Thermoelectric power and topological transitions in quasi-two-dimensional electronic systems

International Nuclear Information System (INIS)

Blanter, Ya.M.; Pantsulaya, A.V.; Varlamov, A.A.

1991-05-01

Electron-impurity relaxation time and the thermoelectric power (TEP) of quasi-two-dimensional electron gas are calculated. Two cases are discussed: the isotropic spectrum and the electronic topological transition (ETT) of the ''neck-breaking'' type. Methods of thermal diagramatic technique are used for the calculation. It is found that the TEP in the vicinity of the ETT greatly exceeds its background value. The results of experimental investigations of the TEP in the metal-oxide-semiconductor structures are compared with the predictions of the proposed theory. (author). 17 refs, 5 figs

Changes of Dielectric Properties induced by Fast neutrons in Tissue Equivalent Plastic A-150

International Nuclear Information System (INIS)

Abdou, M.S.

2000-01-01

Tissue equivalent plastic A-150 (TEP A-150) samples are exposed to fast neutrons. Dielectric studies for TEP A-150 are carried out in the frequency range from 40 Hz to 4 MHz in the temperature range 295-343 K. The obtained data revealed that, both the dielectric properties and conductivity sigma ac (omega) of TEP A-150 are altered when irradiated by a relatively high fast neutron dose (15 Sv). The values of dielectric constant and conductivity are increased for the irradiated samples to about 24% than the blank samples

Substituent effects on the photolysis of methyl 2-carboxylate substituted aliphatic 2 H-azirines

Science.gov (United States)

Gómez-Zavaglia, Andrea; Kaczor, Agnieszka; Cardoso, Ana L.; Pinho e Melo, Teresa M. V. D.; Fausto, Rui

2007-05-01

In this study, the UV induced photochemical reactions of two 2 H-azirines - methyl 2-chloro-3-methyl-2 H-azirine-2-carboxylate (MCMAC) and methyl 3-methyl-2 H-azirine-2-carboxylate (MMAC) - isolated in argon matrices are compared. For both compounds, irradiation with λ > 235 nm led to observation of two primary photoprocesses: (a) C sbnd C bond cleavage, with production of nitrile ylides (P1-type products), and (b) C sbnd N bond cleavage, with production of methylated ketene imines (P2-type products). However, subsequent photoprocesses were found to be different in the two cases. In MCMAC, both primary photoproducts were shown to undergo further reactions: P1-type products decarboxylate, giving [(1-chloroethylidene)imino]ethanide, which bears a C dbnd N +dbnd C - group (P3-type product); P2-type products decarbonylate, yielding a substituted ylidene methanamine (P4-type product). In MMAC, only P2-type primary photoproducts appeared to react, undergoing decarbonylation or decarboxylation (both reactions leading to P4-type products), whereas P1-type products were found to be non-reactive. The non-observation of any secondary photoproduct resulting from photolysis of P1-MMAC revealed the higher photostability of this species when compared with the corresponding photoproduct obtained from MCMAC. The C sbnd N photochemical cleavage is an unusual process in aliphatic 2 H-azirines. In the studied compounds, its preference over the commonly observed C sbnd C azirine-ring bond photocleavage is attributed to the presence of electron withdrawing substituents (methylcarboxy group in both azirines and also the chlorine atom in MCMAC), which accelerates intersystem crossing towards the triplet state from where the cleavage of the C sbnd N bond takes place. The lack of the chlorine atom in MMAC may be partially compensated by the significantly higher stabilization of the P2-type photoproduct derived from this molecule ( ca. -52 kJ mol -1) relatively to the reactant, when

Variable production of transparent exopolymeric particles by haploid and diploid life stages of coccolithophores grown under different CO2 concentrations

NARCIS (Netherlands)

Pedrotti, M.L.; Fiorini, S.; Kerros, M.E.; Middelburg, J.J.; Gattuso, J.P.

2012-01-01

The production of transparent exopolymeric particles (TEP) by the coccolithophores, Emiliania huxleyi, Calcidiscus leptoporus and Syracosphaera pulchra was investigated in batch cultures. The abundance, size spectra and carbon content of TEP were examined during the exponential growth phase of both

UV-photodegradation of desipramine: Impact of concentration, pH and temperature on formation of products including their biodegradability and toxicity

Energy Technology Data Exchange (ETDEWEB)

Khaleel, Nareman D.H.; Mahmoud, Waleed M.M. [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Leuphana University of Lüneburg, Scharnhorststraße 1 C13, DE 21335 Lüneburg (Germany); Pharmaceutical Analytical Chemistry Department, Faculty of Pharmacy, Suez Canal University, Ismailia 41522 (Egypt); Olsson, Oliver [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Leuphana University of Lüneburg, Scharnhorststraße 1 C13, DE 21335 Lüneburg (Germany); Kümmerer, Klaus, E-mail: klaus.kuemmerer@leuphana.de [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Leuphana University of Lüneburg, Scharnhorststraße 1 C13, DE 21335 Lüneburg (Germany)

2016-10-01

Desipramine (DMI) is a widely used tricyclic antidepressant, and it is the major metabolite of imipramine (IMI) and lofepramine (LMI); IMI and LMI are two of the most commonly used tricyclic antidepressants. If DMI enters the aquatic environment, it can be transformed by the environmental bacteria or UV radiation. Therefore, photolysis of DMI in water was performed using a simulated sunlight Xenon-lamp and a UV-lamp. Subsequently, the biodegradability of DMI and its photo-transformation products (PTPs) formed during its UV photolysis was studied. The influence of variable conditions, such as initial DMI concentration, solution pH, and temperature, on DMI UV photolysis behavior was also studied. The degree of mineralization of DMI and its PTPs was monitored. A Shimadzu HPLC-UV apparatus was used to follow the kinetic profile of DMI during UV-irradiation; after that, ion-trap and high-resolution mass spectrometry coupled with chromatography were used to monitor and identify the possible PTPs. The environmentally relevant properties and selected toxicity properties of DMI and the non-biodegradable PTPs were predicted using different QSAR models. DMI underwent UV photolysis with first-order kinetics. Quantum yields were very low. DOC values indicated that DMI formed new PTPs and was not completely mineralized. Analysis by means of high-resolution mass spectrometry revealed that the photolysis of DMI followed three main photolysis pathways: isomerization, hydroxylation, and ring opening. The photolysis rate was inversely proportional to initial DMI concentration. The pH showed a significant impact on the photolysis rate of DMI, and on the PTPs in terms of both formation kinetics and mechanisms. Although temperature was expected to increase the photolysis rate, it showed a non-significant impact in this study. Results from biodegradation tests and QSAR analysis revealed that DMI and its PTPs are not readily biodegradable and that some PTPs may be human and/or eco

Subsurface intake systems: Green choice for improving feed water quality at SWRO desalination plants, Jeddah, Saudi Arabia

KAUST Repository

Dehwah, Abdullah

2015-10-25

An investigation of three seawater reverse osmosis facilities located along the shoreline of the Red Sea of Saudi Arabia that use well intake systems showed that the pumping-induced flow of raw seawater through a coastal aquifer significantly improves feed water quality. A comparison between the surface seawater and the discharge from the wells shows that turbidity, algae, bacteria, total organic carbon, most fractions of natural organic matter (NOM), and particulate and colloidal transparent exopolymer particles (TEP) have significant reductions in concentration. Nearly all of the algae, up to 99% of the bacteria, between 84 and 100% of the biopolymer fraction of NOM, and a high percentage of the TEP were removed during transport. The data suggest that the flowpath length and hydraulic retention time in the aquifer play the most important roles in removal of the organic matter. Since the collective concentrations of bacteria, biopolymers, and TEP in the intake seawater play important roles in the biofouling of SWRO membranes, the observed reductions suggest that the desalination facilities that use well intakes systems will have a potentially lower fouling rate compared to open-ocean intake systems. Furthermore, well intake system intakes also reduce the need for chemical usage during complex pretreatment systems required for operation of SWRO facilities using open-ocean intakes and reduce environmental impacts.

Subsurface intake systems: Green choice for improving feed water quality at SWRO desalination plants, Jeddah, Saudi Arabia

KAUST Repository

Dehwah, Abdullah; Missimer, Thomas M.

2015-01-01

An investigation of three seawater reverse osmosis facilities located along the shoreline of the Red Sea of Saudi Arabia that use well intake systems showed that the pumping-induced flow of raw seawater through a coastal aquifer significantly improves feed water quality. A comparison between the surface seawater and the discharge from the wells shows that turbidity, algae, bacteria, total organic carbon, most fractions of natural organic matter (NOM), and particulate and colloidal transparent exopolymer particles (TEP) have significant reductions in concentration. Nearly all of the algae, up to 99% of the bacteria, between 84 and 100% of the biopolymer fraction of NOM, and a high percentage of the TEP were removed during transport. The data suggest that the flowpath length and hydraulic retention time in the aquifer play the most important roles in removal of the organic matter. Since the collective concentrations of bacteria, biopolymers, and TEP in the intake seawater play important roles in the biofouling of SWRO membranes, the observed reductions suggest that the desalination facilities that use well intakes systems will have a potentially lower fouling rate compared to open-ocean intake systems. Furthermore, well intake system intakes also reduce the need for chemical usage during complex pretreatment systems required for operation of SWRO facilities using open-ocean intakes and reduce environmental impacts.

The investigation of molecular mechanisms in photodynamic action and radiobiology with nanosecond flash photolysis and pulse radiolysis: Final report for period April 1, 1972-June 30, 1987

International Nuclear Information System (INIS)

Grossweiner, L.I.

1987-07-01

Laser flash was employed to investigate initial photolysis mechanisms in enzymes and constituent aromatic amino acids. The key role of photoionization and solvated electron generation was demonstrated. The photochemistry of furocoumarins employed for phototherapy of skin diseases was investigated, emphasizing the production and subsequent reactions of singlet molecular oxygen. The photochemistry of porphyrins employed for photodynamic therapy of malignant tumors was studied, emphasizing photosensitization of model membranes, liposomes and resealed red blood cell membranes. Photosensitization in light-scattering media was investigated in a tissue model, consisting of polystyrene microspheres in an aqueous dye solution and analyzed with the diffusion approximation to radiative transfer. The diffusion approximation was employed to develop a dosimetry model for photodynamic therapy

Journal of Earth System Science | Indian Academy of Sciences

Indian Academy of Sciences (India)

Bacterial abundance and production, numbers, sizes and concentrations of transparent exopolymer particles (TEP) and total organic carbon (TOC) were measured during the 1996 summer monsoon to understand the relationship between TEP, the most labile particulate organic carbon, and bacteria. While high regional ...

Chloride effect on the early photolysis intermediates of a gecko cone-type visual pigment.

Science.gov (United States)

Lewis, J W; Liang, J; Ebrey, T G; Sheves, M; Kliger, D S

1995-05-02

Nanosecond laser photolysis measurements were conducted on the cone-type visual pigment P521 in digitonin extracts of Tokay gecko (Gekko gekko) retina containing physiological chloride ion levels and also on samples which had been chloride depleted or which contained high levels (4 M) of chloride. Absorbance difference spectra were recorded at a sequence of time delays from 30 ns to 60 microseconds following excitation with a pulse of either 532- or 477-nm actinic light. Global analysis showed the kinetic decay data for gecko pigment P521 to be best fit by two exponential processes under all chloride conditions. The initial photoproduct detected had a broad spectrum characteristic of an equilibrated mixture of a Batho P521 intermediate with its blue-shifted intermediate (BSI P521) decay product. The first exponential process was assigned to the decay of this mixture to the Lumi P521 intermediate. The second exponential process was identified as the decay of Lumi P521 to Meta I P521. The initial photoproduct's spectrum exhibited a strong dependence on chloride concentration, indicating that chloride affects the composition of the equilibrated mixture of Batho P521 and BSI P521. These results suggest that the affinity for chloride is reduced approximately 5-fold in the Batho P521 intermediate and approximately 50-fold in the BSI P521 intermediate. Chloride concentration also affects the apparent decay rate of the equilibrated mixture. When the apparent decay rate is corrected for the composition of the equilibrated mixture, a relatively invariant microscopic rate constant is obtained for BSI decay (k = 1/55 ns-1).(ABSTRACT TRUNCATED AT 250 WORDS)

Bilateral inguinal hernia repair: laparoscopic or open approach?

Science.gov (United States)

Feliu, X; Clavería, R; Besora, P; Camps, J; Fernández-Sallent, E; Viñas, X; Abad, J M

2011-02-01

The aim of this study was to investigate outcomes in the treatment of bilateral inguinal hernia, comparing the laparoscopic totally extraperitoneal (TEP) and open tension-free mesh repair (LICHT) approaches. We performed a prospective controlled non randomized clinical study in 128 patients with bilateral inguinal hernia over a period of 3 years. LICHT was used in 106 cases (53 patients) while TEP was employed in 150 cases (75 patients). The main outcome measurements were: recurrence rate, operating time, hospital stay and postoperative complications. There were three recurrences (2.3%): two in the LICHT group (3.8%) and one (1.3%) in the TEP group P = NS. The TEP procedure was faster than LICHT repair (48.8 ± 10.8 vs. 70.4 ± 11.2 min) P approach is an effective option for the treatment of bilateral inguinal hernia when performed by experienced surgeons.

ESA's Food Security Thematic Exploitation Platform "Supporting Sustainable Food Production from Space"

Science.gov (United States)

Gilliams, S. J.

2017-12-01

In line with the paradigm shift in Earth Observation of "Bringing the users to the data", ESA provides collaborative, virtual work environments giving access to EO data and tools, processors, and ICT resources through coherent interfaces. These coherent interfaces are categorized thematically, tailored to the related user communities and named Thematic Exploitation Platforms (TEP). The Food Security Thematic Exploitation Platform (FS-TEP) is the youngest out of seven TEPs and is developed in an agile mode in close coordination with its users. It will provide a "one stop platform" for the extraction of information from EO data for services in the food security sector mainly in Europe & Africa, allowing both access to EO data and processing of these data sets. Thereby it will foster smart, data-intensive agricultural and aquacultural applications in the scientific, private and public domain. The FS-TEP builds on a large and heterogeneous user community, spanning from application developers in agriculture to aquaculture, from small-scale farmers to agricultural industry, from public science to the finance and insurance sectors, from local and national administration to international agencies. To meet the requirements of these groups, the FS-TEP will provide different frontend interfaces. Service pilots will demonstrate the platform's ability to support agriculture and aquaculture with tailored EO based information services.The project team developing the FS-TEP and implementing pilot services during a 30 months period (started in April 2017) is led by Vista GmbH, Germany, supported by CGI Italy, VITO, Belgium, and Hatfield Consultants, Canada. It is funded by ESA under contract number 4000120074/17/I-EF.

Effect of heterogeneities on the thermoelectric power of pressure vessel steel

International Nuclear Information System (INIS)

Simonet, L.

2006-12-01

In service working conditions, the vessel of the Pressurized Water Reactors (PWR) undergoes an ageing due to irradiation. In order to follow the evolution of the mechanical characteristics of the steel in service, EDF launched a surveillance program which consists to carry out mechanical tests on samples aged in reactor. However, the results of these tests have the disadvantage to be affected by the presence of heterogeneities within the steel. Indeed, because of its manufacturing process, the steel contains segregated areas. Thus, EDF launched Thermoelectric Power Measurements (TEP) on the resilience samples of the surveillance program, to complete the mechanical tests and to help with their interpretation. However, these measurements are today difficult to analyse because they include at the same time the effect of the irradiation and the effect of the metallurgical heterogeneities. The aim of this work consisted in evaluating the effect of the heterogeneities on the TEP of the non-irradiated vessel steel. For that, a numerical model was developed which allows to calculate the TEP of a composite structure. We have shown that the model is pertinent to highlight the effect of the heterogeneities on the TEP of the vessel steel, which is considered like a 'matrix'/'segregation' composite. The model allowed us to put emphasis on the influence of different parameters on the TEP measurement. We have thus showed that the measurements conditions have an important effect on the obtained TEP value (influence of the applied pressure, the position of the sample on the device, the site of the metallurgical heterogeneities,...). (author)

Zoogeography of the shorefish fauna of Clipperton Atoll

Science.gov (United States)

Robertson, D. R.; Allen, G. R.

1996-06-01

One hundred and fifteen species of fishes (14 oceanic, plus 101 shore and nearshore species) are known from Clipperton Island, a small, remote coral atoll in the tropical eastern Pacific (TEP). This fish fauna includes only ˜ 14% of the region's shallow-water species, and also is depauperate relative to the fish faunas of other isolated tropical islands. The island's isolation, small size, reduced habitat diversity, and oceanic environment contribute to this paucity of species. Fifty-two species at Clipperton can be identified as TEP; these include 37 widespread species, six species shared only with the Revillagigedo Islands [the nearest (950 km) offshore shoals], and eight endemic to Clipperton. Endemics species apparently have a mix of west and east Pacific origins. Sixty-three species are transpacific; they include three new records (of Naso surgeonfishes) that maybe vagrants recruited > 4,000 km from Oceania. Clipperton is situated at the juncture between the TEP and Oceania. Its fish fauna contains about equal numbers of TEP and transpacific species. This faunal structure reflects the relative influence of surface currents from Oceania and the TEP. Although most of Clipperton's transpacific shorefishes are widespread in eastern Oceania, the Clipperton fauna has specific affinities to the fauna of the Line Islands, which are located within the main eastbound current from Oceania. Clipperton may therefore be a major stepping stone for dispersal between Oceania and the remainder of the TEP. About 50% of the non-oceanic, tropical transpacific fishes occur there, and at least 75 % of those species apparently have resident populations at the island.

Optimum transmission system expansion offshore considering renewable energy sources

NARCIS (Netherlands)

Torbaghan, Shahab S.; Gibescu, Madeleine

2017-01-01

This chapter provides an overview of transmission expansion planning (TEP) methods and their practical application. First, it discusses the strategic importance of the transmission system. Next, it describes the reasons why TEP remains a challenge for systems with a large share of renewable energy.

Degradation of 4-chloro 2-aminophenol using combined strategies based on ultrasound, photolysis and ozone.

Science.gov (United States)

Barik, Arati J; Gogate, Parag R

2016-01-01

The present work investigates the degradation of 4-chloro 2-aminophenol (4C2AP), a highly toxic organic compound, using ultrasonic reactors and combination of ultrasound with photolysis and ozonation for the first time. Two types of ultrasonic reactors viz. ultrasonic horn and ultrasonic bath operating at frequency of 20 kHz and 36 kHz respectively have been used in the work. The effect of initial pH, temperature and power dissipation of the ultrasonic horn on the degradation rate has been investigated. The established optimum parameters of initial pH as 6 (natural pH of the aqueous solution) and temperature as 30 ± 2°C were then used in the degradation studies using the combined approaches. Kinetic study revealed that degradation of 4C2AP followed first order kinetics for all the treatment approaches investigated in the present work. It has been established that US+UV+O3 combined process was the most promising method giving maximum degradation of 4C2AP in both ultrasonic horn (complete removal) and bath (89.9%) with synergistic index as 1.98 and 1.29 respectively. The cavitational yield of ultrasonic bath was found to be eighteen times higher as compared to ultrasonic horn implying that configurations with higher overall areas of transducers would be better selection for large scale treatment. Overall, the work has clearly demonstrated that combined approaches could synergistically remove the toxic pollutant (4C2AP). Copyright © 2015 Elsevier B.V. All rights reserved.

RNA-Seq of Tumor-Educated Platelets Enables Blood-Based Pan-Cancer, Multiclass, and Molecular Pathway Cancer Diagnostics

NARCIS (Netherlands)

Best, Myron G.; Sol, Nik; Kooi, Irsan; Tannous, Jihane; Westerman, Bart A.; Rustenburg, François; Schellen, Pepijn; Verschueren, Heleen; Post, Edward; Koster, Jan; Ylstra, Bauke; Ameziane, Najim; Dorsman, Josephine; Smit, Egbert F.; Verheul, Henk M.; Noske, David P.; Reijneveld, Jaap C.; Nilsson, R. Jonas A.; Tannous, Bakhos A.; Wesseling, Pieter; Wurdinger, Thomas

2015-01-01

Tumor-educated blood platelets (TEPs) are implicated as central players in the systemic and local responses to tumor growth, thereby altering their RNA profile. We determined the diagnostic potential of TEPs by mRNA sequencing of 283 platelet samples. We distinguished 228 patients with localized and

X-ray photoelectron spectroscopy study and thermoelectric properties of Al-doped ZnO thin films

International Nuclear Information System (INIS)

Li Li; Fang Liang; Zhou Xianju; Liu Ziyi; Zhao Liang; Jiang Sha

2009-01-01

In this paper, high quality Al-doped ZnO (AZO) thin films were prepared by direct current (DC) reactive magnetron sputtering using a Zn target (99.99%) containing Al of 1.5 wt.%. The films obtained were characterized by X-ray photoelectron spectroscopy (XPS) and thermoelectric measurements. The XPS results reveal that Zn and Al exist only in oxidized state, while there are dominant crystal lattice and rare adsorbed oxygen for O in the annealed AZO thin films. The studies of thermoelectric property show a striking thermoelectric effect in the AZO thin films. On the one hand, the thermoelectromotive and magnetothermoelectromotive forces increase linearly with increasing temperature difference (ΔT). On the other hand, the thermoelectric power (TEP) decreases with the electrical resistance of the sample. But the TEP increases with the increase of temperature below 300 K, and it nearly does not change around room temperature. The experimental results also demonstrate that the annealing treatment increases TEP, while the external magnetic field degrades TEP.

The Effect of Lamotrigine and Levetiracetam on TMS-Evoked EEG Responses Depends on Stimulation Intensity

Directory of Open Access Journals (Sweden)

Isabella Premoli

2017-10-01

Full Text Available The combination of transcranial magnetic stimulation and electroencephalography (TMS-EEG has uncovered underlying mechanisms of two anti-epileptic medications: levetiracetam and lamotrigine. Despite their different mechanism of action, both drugs modulated TMS-evoked EEG potentials (TEPs in a similar way. Since both medications increase resting motor threshold (RMT, the current aim was to examine the similarities and differences in post-drug TEPs, depending on whether stimulation intensity was adjusted to take account of post-drug RMT increase. The experiment followed a placebo controlled, double blind, crossover design, involving a single dose of either lamotrigine or levetiracetam. When a drug-induced increase of RMT occurred, post-drug measurements involved two blocks of stimulations, using unadjusted and adjusted stimulation intensity. A cluster based permutation analysis of differences in TEP amplitude between adjusted and unadjusted stimulation intensity showed that lamotrigine induced a stronger modulation of the N45 TEP component compared to levetiracetam. Results highlight the impact of adjusting stimulation intensity.

Mechanical Performance Evaluation of a Top End Piece for Dual Cooled Fuels

International Nuclear Information System (INIS)

Kim, Jae Yong; Yoon, Kyung Ho; Kim, Hyung Kyu; Choi, Woo Seok

2011-01-01

A fuel assembly consists of five major components, i.e., a top end piece (TEP), a bottom end piece (BEP), spacer grids (SGs), guide tubes (GTs) and an instrumentation tube (IT): in addition, it also includes fuel rods (FRs). The TEP/BEP should satisfy stress intensity limits according to the conditions A and B of ASME, Section III, Division 1.Subsection NB. In a dual-cooled fuel assembly, the array and position of fuel rods are different from those in a conventional PWR fuel assembly; these changes are necessary for achieving power uprating. The flow plates of the TEP and BEP have to be modified accordingly. The pattern and shape of the flow holes were newly designed. To verify the strength compatibility, the Tresca stress limit according to the ASME code was investigated in the case of an axial load of 22.241 kN. In this paper, the stress linearization procedure for strength evaluation of a newly designed TEP is presented

Evolution and Function of Thioester-Containing Proteins and the Complement System in the Innate Immune Response

Directory of Open Access Journals (Sweden)

Upasana Shokal

2017-06-01

Full Text Available The innate immune response is evolutionary conserved among organisms. The complement system forms an important and efficient immune defense mechanism. It consists of plasma proteins that participate in microbial detection, which ultimately results in the production of various molecules with antimicrobial activity. Thioester-containing proteins (TEPs are a superfamily of secreted effector proteins. In vertebrates, certain TEPs act in the innate immune response by promoting recruitment of immune cells, phagocytosis, and direct lysis of microbial invaders. Insects are excellent models for dissecting the molecular basis of innate immune recognition and response to a wide range of microbial infections. Impressive progress in recent years has generated crucial information on the role of TEPs in the antibacterial and antiparasite response of the tractable model insect Drosophila melanogaster and the mosquito malaria vector Anopheles gambiae. This knowledge is critical for better understanding the evolution of TEPs and their involvement in the regulation of the host innate immune system.

Market-based transmission expansion planning by improved differential evolution

International Nuclear Information System (INIS)

Georgilakis, Pavlos S.

2010-01-01

The restructuring and deregulation has exposed the transmission planner to new objectives and uncertainties. As a result, new criteria and approaches are needed for transmission expansion planning (TEP) in deregulated electricity markets. This paper proposes a new market-based approach for TEP. An improved differential evolution (IDE) model is proposed for the solution of this new market-based TEP problem. The modifications of IDE in comparison to the simple differential evolution method are: (1) the scaling factor F is varied randomly within some range, (2) an auxiliary set is employed to enhance the diversity of the population, (3) the newly generated trial vector is compared with the nearest parent, and (4) the simple feasibility rule is used to treat the constraints. Results from the application of the proposed method on the IEEE 30-bus test system demonstrate the feasibility and practicality of the proposed IDE for the solution of TEP problem. (author)

Photochemical degradation of alachlor in water

Directory of Open Access Journals (Sweden)

Tajana Đurkić

2017-01-01

Full Text Available This study investigates the photochemical degradation of alachlor, a chloroacetanilide herbicide. All experiments were conducted in ultra-pure deionized water (ASTM Type I quality using direct ultraviolet (UV photolysis and the UV/H2O2 advanced oxidation process. The direct UV photolysis and UV/H2O2 experiments were conducted in a commercial photochemical reactor with a quartz reaction vessel equipped with a 253.7 nm UV low pressure mercury lamp (Philips TUV 16 W. The experimental results demonstrate that UV photolysis was very effective for alachlor degradation (up to 97% removal using a high UV fluence of 4200 mJ/cm2. The UV/H2O2 process promoted alachlor degradation compared to UV photolysis alone, with a high degree of decomposition (97% achieved at a significantly lower UV fluence of 600 mJ/cm2 when combined with 1 mg H2O2/L. The application of UV photolysis alone with a UV fluence of 600 mJ/cm2 gave a negligible 4% alachlor degradation. The photo degradation of alachlor, in both direct UV photolysis and the UV/H2O2 process, followed pseudo first-order kinetics. The degradation rate constant was about 6 times higher for the UV/H2O2 process than for UV photolysis alone.

Total Extraperitoneal Hernia Repair: Residency Teaching Program and Outcome Evaluation.

Science.gov (United States)

Garofalo, Fabio; Mota-Moya, Pau; Munday, Andrew; Romy, Sébastien

2017-01-01

Total extraperitoneal (TEP) hernia repair has been shown to offer less pain, shorter postoperative hospital stay and earlier return to work when compared to open surgery. Our institution routinely performs TEP procedures for patients with primary or recurrent inguinal hernias. The aim of this study was to show that supervised senior residents can safely perform TEP repairs in a teaching setting. All consecutive patients treated for inguinal hernias by laparoscopic approach from October 2008 to June 2012 were retrospectively analyzed from a prospective database. A total of 219 TEP repairs were performed on 171 patients: 123 unilateral and 48 bilateral. The mean patient age was 51.6 years with a standard deviation (SD) of ± 15.9. Supervised senior residents performed 171 (78 %) and staff surgeons 48 (22 %) TEP repairs, respectively. Thirty-day morbidity included cases of inguinal paresthesias (0.4 %, n = 1), umbilical hematomas (0.9 %, n = 2), superficial wound infections (0.9 %, n = 2), scrotal hematomas (2.7 %, n = 6), postoperative urinary retentions (2.7 %, n = 6), chronic pain syndromes (5 %, n = 11) and postoperative seromas (6.7 %, n = 14). Overall, complication rates were 18.7 % for staff surgeons and 19.3 % for residents (p = 0.83). For staff surgeons and residents, mean operative times for unilateral hernia repairs were 65 min (SD ± 18.9) and 77.6 min (SD ± 29.8) (p = 0.043), respectively, while mean operative times for bilateral repairs were 115 min (SD ± 40.1) and 103.6 (SD ± 25.9) (p = 0.05). TEP repair is a safe procedure when performed by supervised senior surgical trainees. Teaching of TEP should be routinely included in general surgery residency programs.

Identifying inequitable exposure to toxic air pollution in racialized and low-income neighbourhoods to support pollution prevention

Directory of Open Access Journals (Sweden)

Suzanne Kershaw

2013-05-01

Full Text Available Numerous environmental justice studies have confirmed a relationship between population characteristics such as low-income or minority status and the location of environmental health hazards. However, studies of the health risks from exposure to harmful substances often do not consider their toxicological characteristics. We used two different methods, the unit-hazard and the distance-based approach, to evaluate demographic and socio-economic characteristics of the population residing near industrial facilities in the City of Toronto, Canada. In addition to the mass of air emissions obtained from the national pollutant release inventory (NPRI, we also considered their toxicity using toxic equivalency potential (TEP scores. Results from the unit-hazard approach indicate no significant difference in the proportion of low-income individuals living in host versus non-host census tracts (t(107 = 0.3, P = 0.735. However, using the distance-based approach, the proportion of low-income individuals was significantly higher (+5.1%, t(522 = 6.0, P <0.001 in host tracts, while the indicator for “racialized” communities (“visible minority” was 16.1% greater (t(521 = 7.2, P <0.001 within 2 km of a NPRI facility. When the most toxic facilities by non-carcinogenic TEP score were selected, the rate of visible minorities living near the most toxic NPRI facilities was significantly higher (+12.9%, t(352 = 3.5, P = 0.001 than near all other NPRI facilities. TEP scores were also used to identify areas in Toronto that face a double burden of poverty and air toxics exposure in order to prioritise pollution prevention.

Describing Physics Student Teachers' Orientations through Lesson Planning

Science.gov (United States)

Karal, Isik Saliha

2017-01-01

Recent educational reforms realized in teacher education programs (TEPs) and secondary physics syllabus were aimed at placing the learning and teaching approaches in a constructivist framework. For this reason, student teachers in pre-service TEPs are expected to develop orientations adopting student-centred teaching approaches. The purpose of…

Role of wetland organic matters as photosensitizer for degradation of micropollutants and metabolites

International Nuclear Information System (INIS)

Lee, Eunkyung; Shon, Ho Kyong; Cho, Jaeweon

2014-01-01

Highlights: • Photodegradation of PPCPs was investigated in various NOM enriched solutions. • Direct and indirect photolysis experiments were conducted upon UV irradiation. • PPCPs showed different levels of photodegradation rates depending on their photoreactivity. • Allochthonous NOM inhibited the photolysis of target PPCPs. • Wetland NOM enhanced photodegradation of some conservative PPCPs. - Abstract: Overall photodegradation of pharmaceuticals, personal care products (PPCPs) and pharmaceutical metabolites were investigated in order to evaluate their photochemical fate in aquatic environments in various natural organic matter (NOM) enriched solutions. Tested PPCPs exhibited different rates of loss during direct and indirect photolysis. Here, only ultraviolet (UV) light source was used for direct photolysis and UV together with 3 DOM * for indirect photolysis. Diclofenac and sulfamethoxazole were susceptible to photodegradation, whereas carbamazepine, caffeine, paraxanthine and tri(2-chloroethyl) phosphate (TCEP) showed low levels of photodegradation rate, reflecting their conservative photoreactivity. During indirect photodegradation, in contrast to the hydrophilic autochthonous NOM, allochthonous NOM with relatively high molecular weight (MW), specific ultraviolet absorbance (SUVA) and hydrophobicity (e.g., Suwannee River humic acid (SRHA)) revealed to significantly inhibit the photolysis of target micropollutants. The presence of Typha wetland NOM enhanced the indirect photolysis of well-known conservative micopollutants (carbamazepine and paraxanthine). And atenolol, carbamazepine, glimepiride, and N-acetyl-sulfamethoxazole were found to be sensitive to the triplet excited state of dissolved organic matter ( 3 DOM * ) with Typha wetland NOM under deoxygenated condition. This suggests that photolysis in constructed wetlands connected to the wastewater treatment plant can enhance the degradation of some anthropogenic micropollutants by the

Laser flash photolysis and magnetic-field-effect studies on interaction of thymine and thymidine with menadione: role of sugar in controlling reaction pattern

Directory of Open Access Journals (Sweden)

Adity Bose, Debarati Dey and Samita Basu

2008-01-01

Full Text Available The magnetic field effect (MFE in conjunction with laser flash photolysis has been used for the study of the interaction of one of the small drug like quinone molecules, 2-methyl, 1,4-naphthoquinone, commonly known as menadione (MQ, with one of the DNA bases, thymine (THN, and its corresponding nucleoside, thymidine (THDN, in acetonitrile (ACN and sodium dodecylsulfate (SDS micelles. It has been observed that THN undergoes electron transfer (ET and hydrogen (H abstraction with MQ, while THDN undergoes only H abstraction in both the media. However, our earlier studies showed that a purine base, adenine (ADN, and its nucleoside, 2'-deoxyadenosine (ADS, undergo ET in ACN and H abstraction in SDS. Here we have attempted to explain the differences in the reactions of these DNA bases with MQ. We also reveal the crucial role of a sugar unit in altering the behavior of purine and pyrimidine bases with respect to ET and H abstraction.

Laser flash photolysis and magnetic-field-effect studies on interaction of thymine and thymidine with menadione: role of sugar in controlling reaction pattern

Science.gov (United States)

Bose, Adity; Dey, Debarati; Basu, Samita

2008-04-01

The magnetic field effect (MFE) in conjunction with laser flash photolysis has been used for the study of the interaction of one of the small drug like quinone molecules, 2-methyl, 1,4-naphthoquinone, commonly known as menadione (MQ), with one of the DNA bases, thymine (THN), and its corresponding nucleoside, thymidine (THDN), in acetonitrile (ACN) and sodium dodecylsulfate (SDS) micelles. It has been observed that THN undergoes electron transfer (ET) and hydrogen (H) abstraction with MQ, while THDN undergoes only H abstraction in both the media. However, our earlier studies showed that a purine base, adenine (ADN), and its nucleoside, 2'-deoxyadenosine (ADS), undergo ET in ACN and H abstraction in SDS. Here we have attempted to explain the differences in the reactions of these DNA bases with MQ. We also reveal the crucial role of a sugar unit in altering the behavior of purine and pyrimidine bases with respect to ET and H abstraction.

Laser flash photolysis and magnetic-field-effect studies on interaction of thymine and thymidine with menadione: role of sugar in controlling reaction pattern

International Nuclear Information System (INIS)

Bose, Adity; Dey, Debarati; Basu, Samita

2008-01-01

The magnetic field effect (MFE) in conjunction with laser flash photolysis has been used for the study of the interaction of one of the small drug like quinone molecules, 2-methyl, 1,4-naphthoquinone, commonly known as menadione (MQ), with one of the DNA bases, thymine (THN), and its corresponding nucleoside, thymidine (THDN), in acetonitrile (ACN) and sodium dodecylsulfate (SDS) micelles. It has been observed that THN undergoes electron transfer (ET) and hydrogen (H) abstraction with MQ, while THDN undergoes only H abstraction in both the media. However, our earlier studies showed that a purine base, adenine (ADN), and its nucleoside, 2'-deoxyadenosine (ADS), undergo ET in ACN and H abstraction in SDS. Here we have attempted to explain the differences in the reactions of these DNA bases with MQ. We also reveal the crucial role of a sugar unit in altering the behavior of purine and pyrimidine bases with respect to ET and H abstraction

Photobinding of tiaprofenic acid and suprofen to proteins and cells: a combined study using radiolabeling, antibodies and laser flash photolysis of model bichromophores.

Science.gov (United States)

Castell, J V; Hernández, D; Gómez-Lechón, M J; Lahoz, A; Miranda, M A; Morera, I M; Pérez-Prieto, J; Sarabia, Z

1998-11-01

Drug photoallergy is a matter of current concern. It involves the formation of drug-protein photoadducts (photoantigens) that may ultimately trigger an immunological response. Tyrosine residues appear to be key binding sites in proteins. The present work has investigated the photobinding of tiaprofenic and (TPA) and the closely related isomer suprofen (SUP) to proteins and cells by means of radioactive labelling and drug-directed antibodies. To ascertain whether preassociation with the protein may play a role in photoreactivity, two model bichromophoric compounds (TPA-Tyr and SUP-Tyr) have been prepared and studied by laser flash photolysis. The results of this work show that (a) TPA and SUP photobind to proteins with similar efficiencies, (b) both drugs form photoadducts that share a basic common structure, as they are recognized by the same antibody and (c) drug-protein preassociation must play a key role in photoreactivity, as indicated by the dramatic decrease in the triplet state lifetimes of the model bichromophores compared to the parent drugs.

Laser flash photolysis and magnetic-field-effect studies on interaction of thymine and thymidine with menadione: role of sugar in controlling reaction pattern

Energy Technology Data Exchange (ETDEWEB)

Bose, Adity; Dey, Debarati; Basu, Samita [Chemical Sciences Division, Saha Institute of Nuclear Physics, 1/AF Bidhannagar, Kolkata-700 064 (India)], E-mail: samita.basu@saha.ac.in

2008-04-01

The magnetic field effect (MFE) in conjunction with laser flash photolysis has been used for the study of the interaction of one of the small drug like quinone molecules, 2-methyl, 1,4-naphthoquinone, commonly known as menadione (MQ), with one of the DNA bases, thymine (THN), and its corresponding nucleoside, thymidine (THDN), in acetonitrile (ACN) and sodium dodecylsulfate (SDS) micelles. It has been observed that THN undergoes electron transfer (ET) and hydrogen (H) abstraction with MQ, while THDN undergoes only H abstraction in both the media. However, our earlier studies showed that a purine base, adenine (ADN), and its nucleoside, 2'-deoxyadenosine (ADS), undergo ET in ACN and H abstraction in SDS. Here we have attempted to explain the differences in the reactions of these DNA bases with MQ. We also reveal the crucial role of a sugar unit in altering the behavior of purine and pyrimidine bases with respect to ET and H abstraction.

Reducing DNACPR complaints to zero: designing and implementing a treatment escalation plan using quality improvement methodology.

Science.gov (United States)

Shermon, Elizabeth; Munglani, Laura; Oram, Sarah; William, Linda; Abel, Julian

2017-01-01

Do Not Attempt Resuscitation (DNAR)decisions have traditionally formed the basis of ceiling of care discussions. However, poor quality discussions can lead to high patient and relative dissatisfaction, generating hospital complaints. Treatment escalation plans (TEPs) aim to highlight the wider remit of treatment options with a focus on effective communication. We aimed to improve TEP discussions and documentation at Weston General Hospital by introducing a standardised form. We aimed to develop a TEP document to reduce resuscitation-related complaints by improving communication and documentation. Qualitative and quantitative data were collected over 2 years and used to develop plan-do-study-act (PDSA) cycles using quality improvement methodology. Main barriers to improvement included time constraints and clinician's resistance. Analysis of patient liaison services data showed a progressive reduction in complaints regarding resuscitation, with no complaints having been received for the final six months of the project. Through use of a standardised form including treatment prompts, the quality of discussions and plans improved. Qualitative feedback demonstrated increased patient and relative satisfaction. In addition, junior doctors report the plans are helpful when making out-of-hours decisions. Development of a user-friendly form to document patient-guided TEPs helped junior doctors to lead advanced care planning discussions. The use of PDSA cycles demonstrated improvement in the quality of forms, which in turn improved communication, documentation and satisfaction. Future developments could include involvement of specialist teams to ensure TEP forms remain relevant to all clinical areas. In addition, with widespread use of the TEP forms, the traditional tick-box DNAR could be replaced to focus on patient-led care planning.

Customization of the voice prosthesis to prevent leakage from the enlarged tracheoesophageal puncture: results of a prospective trial.

Science.gov (United States)

Lewin, Jan S; Hutcheson, Katherine A; Barringer, Denise A; Croegaert, Lindsay E; Lisec, Asher; Chambers, Mark S

2012-08-01

Customization of the tracheoesophageal (TE) voice prosthesis (VP) is often preferred over surgical closure to prevent aspiration around the VP in laryngectomized patients with an enlarged tracheoesophageal puncture (TEP), but it has not been thoroughly evaluated. Single-institution prospective trial. A prospective trial was conducted to evaluate the effectiveness of a customized VP with the addition of an enlarged tracheal and/or esophageal collar in patients with leakage around an enlarged TEP. Absence of leakage around the VP after placement defined immediate effectiveness. Long-term success was defined by the prevention of adverse events related to leakage during the study period. Events that defined failure included: permanent gastrostomy dependence, aspiration pneumonia, and/or surgical TEP closure. Twenty-one patients with enlarged TEP were enrolled (2003-2006). Insertion of a customized VP was unsuccessful in one patient; 145 customizations were performed in the remaining 20 patients (median, 3.5 customizations) during the trial period. Of the customizations, 77% (112/145) prevented leakage immediately after VP insertion. The most common adverse event was dislodgement of the prosthesis (11%) or the collar alone (7%) in 18% (26/145) of customized VP placements. Six patients who died of disease were not evaluable for long-term outcomes. Long-term success was achieved in 80% (12/15) of evaluable patients who avoided permanent gastrostomy, aspiration pneumonia, and surgical TEP closure. Prosthetic customization offers an effective method to prevent leakage around the VP in many patients with an enlarged TEP, thereby preserving TE voice while avoiding surgical closure in this high-risk population. Copyright © 2012 The American Laryngological, Rhinological, and Otological Society, Inc.

Thermoelectric power of YBa2Cu3Osub(7-δ) under pressure upto 9GPa

International Nuclear Information System (INIS)

Ramasesha, S.K.; Singh, A.K.

1991-01-01

Thermoelectric power (TEP) of two YBa 2 Cu 3 Osub(7-δ) compounds (with δ=0.17 and 0.21) was measured as a function of quasi-hydrostatic pressure up to 9GPa at 300 K on samples with low porosity. In both cases TEP decreases with increasing pressure, at a rate ∼0.8μVK -1 /GPa. The data obtained under hydrostatic pressure up to 3 GPa are in good agreement with those under quasi-hydrostatic pressure. The TEP of both compositions is found to decrease linearly at a rate 0.8 μVK -1 /GPa above 1.5 GPA. (author). 17 refs

ANALISIS COSTE-EFECTIVIDAD DE DISTINTOS MÉTODOS DE DIAGNÓSTICO POR IMAGEN DEL TROMBOEMBOLISMO PULMONAR AGUDO

Directory of Open Access Journals (Sweden)

Stella Maris Batallés

2009-01-01

Full Text Available La técnica diagnóstica óptima para detectar tromboembolismo pulmonar agudo (TEP continúa en discusión. La gammagrafía pulmonar de ventilación/perfusión ha sido el examen preferido durante décadas, pero con el advenimiento de nuevas pruebas de imágenes las posibilidades diagnósticas se ampliaron, siendo necesario evaluarlas desde la perspectiva del coste y de la efectividad. El objetivo de este trabajo fue evaluar distintos métodos de diagnóstico por imagen para detectar TEP agudo para determinar el más coste-efectivo. Métodos. Análisis de coste-efectividad (CE empleando un árbol de decisiones para modelar distintas pruebas (centellograma V/Q, TC helicoidal, angiografía por tomografía computada multidetector (TCMD, resonancia magnética por imágenes (RMI y arteriografía convencional. Se obtuvieron valores de sensibilidad, especificidad, valor predictivo positivo (VPP y negativo (VPN de las pruebas diagnósticas. Resultado medido: "caso detectado de TEP". Los costes evaluados fueron los directos, expresados en euros (t, incluyendo los secundarios a las complicaciones de los métodos diagnósticos. Se realizó un análisis de sensibilidad de una vía para evaluar la robustez de las conclusiones. Resultados. No se eliminaron pruebas por dominancia extendida. La tasa cruda de CE para TCMD fue de 486 t por cada caso de TEP detectado. El coste marginal entre la TC helicoidal y el centellograma V/Q fue de 103 t para detectar 8 casos adicionales de TEP, mientras que el coste marginal entre la TCMD y la TC helicoidal fue de 229 t para detectar un caso adicional de TEP. Conclusiones. La prueba diagnóstica más coste-efectiva fue la TCMD, hallazgo que mostró robustez en el análisis de sensibilidad. Sin embargo, el análisis de C-E incremental nos mostró que la TCMD costó 229 t más respeto a la TC helicoidal para lograr una mínima mejora en la efectividad de la prueba (detección de TEP agudo. El alto valor predictivo negativo de

Evaluating Teacher Preparation Using Graduates' Observational Ratings

Science.gov (United States)

Ronfeldt, Matthew; Campbell, Shanyce L.

2016-01-01

Despite growing calls for more accountability of teacher education programs (TEPs), there is little consensus about how to evaluate them. This study investigates the potential for using observational ratings of program completers to evaluate TEPs. Drawing on statewide data on almost 9,500 program completers, representing 44 providers (183…

Secondary tracheoesophageal puncture in-office using Seldinger technique.

Science.gov (United States)

Britt, Christopher J; Lippert, Dylan; Kammer, Rachael; Ford, Charles N; Dailey, Seth H; McCulloch, Timothy; Hartig, Gregory

2014-05-01

Evaluate the safety and efficacy of in-office secondary tracheoesophageal puncture (TEP) technique using transnasal esophagoscopy (TNE) and the Seldinger technique in conjunction with a cricothyroidotomy kit for placement. Case series with chart review. Academic medical center. A retrospective chart review was performed on 83 subjects who underwent in-office secondary TEP. Variables that were examined included disease site, staging, histologic diagnosis, extent of resection and reconstruction, chemoradiation, functional voice status (as assessed by speech pathologist in most recent note), and complications directly related to the procedure. Eighty-three individuals from our institution met our criteria for in-office secondary TEP from 2005 to August 2012. Of these, 97.6% (81/83) had no complications of TEP. The overall complication rate was 2.4% (2/83). Complications included bleeding from puncture site and closure of puncture site after dislodgement of prosthesis at the time of puncture. Fluent conversational speech was achieved in 69.9% of all patients (58/83), and an additional 19.3% (16/83) achieved functional/intelligible speech; of those, 3.6% (3/83) were unable to achieve fluent conversational speech due to anatomic defects from previous surgery. An in-office TEP can be safely performed using the Seldinger technique with direct visualization using TNE, despite the extent of resection or reconstruction, with functional speech outcomes comparable to other studies available in the literature.

Modeling the photochemical attenuation of down-the-drain chemicals during river transport by stochastic methods and field measurements of pharmaceuticals and personal care products.

Science.gov (United States)

Hanamoto, Seiya; Nakada, Norihide; Yamashita, Naoyuki; Tanaka, Hiroaki

2013-01-01

Existing stochastic models for predicting concentrations of down-the-drain chemicals in aquatic environments do not account for the diurnal variation of direct photolysis by sunlight, despite its being an important factor in natural attenuation. To overcome this limitation, we developed a stochastic model incorporating temporal variations in direct photolysis. To verify the model, we measured 57 pharmaceuticals and personal care products (PPCPs) in a 7.6-km stretch of an urban river, and determined their physical and biological properties in laboratory experiments. During transport along the river, 8 PPCPs, including ketoprofen and azithromycin, were attenuated by >20%, mainly owing to direct photolysis and adsorption to sediments. The photolabile PPCPs attenuated significantly in the daytime but persisted in the nighttime. The observations were similar to the values predicted by the photolysis model for the photolabile PPCPs (i.e., ketoprofen, diclofenac and furosemide) but not by the existing model. The stochastic model developed in this study was suggested to be a novel and useful stochastic model for evaluating direct photolysis of down-the-drain chemicals, which occurs during the river transport.

Induction of micronuclei by 2-hydroxypyridine in water and elimination of solution genotoxicity by UVC (254 nm) photolysis

International Nuclear Information System (INIS)

Skoutelis, Charalambos G.; Vlastos, Dimitris; Kortsinidou, Marianna C.; Theodoridis, Ioannis T.; Papadaki, Maria I.

2011-01-01

Highlights: ► 2-Hydroxypyridine (2-HPY) is the major metabolite of 2-halogenated pyridines photolysis. ► We examine the genotoxicity of 2-HPY in cultured human lymphocytes applying the micronucleus assay. ► 2-HPY was found to be genotoxic. ► Aqueous solutions of 2-HPY were irradiated by UV at 254 nm. ► Solution genotoxicity can be completely removed after prolonged phototreatment. - Abstract: 2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5–400 μg ml −1 . 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation.

Role of wetland organic matters as photosensitizer for degradation of micropollutants and metabolites

Energy Technology Data Exchange (ETDEWEB)

Lee, Eunkyung [Department of Civil and Environmental Engineering, Yonsei University, Yonsei-ro 50, Seodaemun-gu, Seoul 120-749 (Korea, Republic of); Shon, Ho Kyong [School of Civil and Environmental Engineering, University of Technology, Sydney (UTS), PO Box 123, Broadway, Sydney 2007, NSW (Australia); Cho, Jaeweon, E-mail: chojw@yonsei.ac.kr [Department of Civil and Environmental Engineering, Yonsei University, Yonsei-ro 50, Seodaemun-gu, Seoul 120-749 (Korea, Republic of)

2014-07-15

Highlights: • Photodegradation of PPCPs was investigated in various NOM enriched solutions. • Direct and indirect photolysis experiments were conducted upon UV irradiation. • PPCPs showed different levels of photodegradation rates depending on their photoreactivity. • Allochthonous NOM inhibited the photolysis of target PPCPs. • Wetland NOM enhanced photodegradation of some conservative PPCPs. - Abstract: Overall photodegradation of pharmaceuticals, personal care products (PPCPs) and pharmaceutical metabolites were investigated in order to evaluate their photochemical fate in aquatic environments in various natural organic matter (NOM) enriched solutions. Tested PPCPs exhibited different rates of loss during direct and indirect photolysis. Here, only ultraviolet (UV) light source was used for direct photolysis and UV together with {sup 3}DOM{sup *}for indirect photolysis. Diclofenac and sulfamethoxazole were susceptible to photodegradation, whereas carbamazepine, caffeine, paraxanthine and tri(2-chloroethyl) phosphate (TCEP) showed low levels of photodegradation rate, reflecting their conservative photoreactivity. During indirect photodegradation, in contrast to the hydrophilic autochthonous NOM, allochthonous NOM with relatively high molecular weight (MW), specific ultraviolet absorbance (SUVA) and hydrophobicity (e.g., Suwannee River humic acid (SRHA)) revealed to significantly inhibit the photolysis of target micropollutants. The presence of Typha wetland NOM enhanced the indirect photolysis of well-known conservative micopollutants (carbamazepine and paraxanthine). And atenolol, carbamazepine, glimepiride, and N-acetyl-sulfamethoxazole were found to be sensitive to the triplet excited state of dissolved organic matter ({sup 3}DOM{sup *}) with Typha wetland NOM under deoxygenated condition. This suggests that photolysis in constructed wetlands connected to the wastewater treatment plant can enhance the degradation of some anthropogenic micropollutants

Self Assembly and Properties of C:WO3 Nano-Platelets and C:VO2/V2O5 Triangular Capsules Produced by Laser Solution Photolysis

Directory of Open Access Journals (Sweden)

Sideras-Haddad E

2009-01-01

Full Text Available Abstract Laser photolysis of WCl6 in ethanol and a specific mixture of V2O5 and VCl3 in ethanol lead to carbon modified vanadium and tungsten oxides with interesting properties. The presence of graphene’s aromatic rings (from the vibrational frequency of 1,600 cm−1 together with C–C bonding of carbon (from the Raman shift of 1,124 cm−1 present unique optical, vibrational, electronic and structural properties of the intended tungsten trioxide and vanadium dioxide materials. The morphology of these samples shows nano-platelets in WO x samples and, in VO x samples, encapsulated spherical quantum dots in conjunction with fullerenes of VO x . Conductivity studies revealed that the VO2/V2O5 nanostructures are more sensitive to Cl than to the presence of ethanol, whereas the C:WO3 nano-platelets are more sensitive to ethanol than atomic C.

Speech Rehabilitation For 10 Alaryngeal Patients Using Tracheoesophageal Puncture And Prosthesis Insertion In Amir Alam And Imam Khomeini Hospitals 2002-2003

Directory of Open Access Journals (Sweden)

M.T. Khorsi Ashtiani

2006-05-01

Full Text Available Background and Aim: Total laryngectomy following laryngeal cancer has many sequelae , that loss of voice is the most important of them. Tracheoesophageal puncture (TEP and prosthesis insertion has evolved into the most widely used and accepted technique for vocal rehabilitation. Materials and Methods: 10 patients that underwent TEP in Amir Alam and Imam Khomeini hospitals from Feb. 2002 through Nov. 2003; were included in this study. Prosthesis insertion in 4 patients is primary and in 6 patients is secondary; and all patients are men. Results: The age of patients was between 50 to 70. 90% of patients had history of cigarette smoking and 10% of them had history of drinking alcohol. Salivary leakage was seen in 30% of patients that was improved with conservative management. Fluency of speech in 30% of patients and intelligibility of speech & voice quality in 40% of patients is good. Conclusion: We could conclude that TEP has less complication & better speech results of other vocal rehabilitation methods. Carefully selection of patients & size of prosthesis has important role in results of TEP.

Changes in feedwater organic matter concentrations based on intake type and pretreatment processes at SWRO facilities, Red Sea, Saudi Arabia

KAUST Repository

Dehwah, Abdullah

2015-03-01

Transparent exopolymer particles (TEP), natural organic matter, and bacterial concentrations in feedwater are important factors that can lead to membrane biofouling in seawater reverse osmosis (SWRO) systems. Two methods for controlling these concentrations in the feedwater prior to pretreatment have been suggested; use of subsurface intake systems or placement of the intake at a greater depth in the sea. These proposed solutions were tested at two SWRO facilities located along the Red Sea of Saudi Arabia. A shallow well intake system was very effective in reducing the algae and bacterial concentrations and somewhat effective in reducing TEP concentrations. An intake placed at a depth of 9. m below the surface was found to have limited impact on improving water quality compared to a surface intake. The algae and bacteria concentration in the feedwater (deep) was lower compared to the surface seawater, but the overall TEP concentration was higher. Bacteria and TEP measurements made in the pretreatment process train in the plant and after the cartridge filters suggest that regrowth of bacteria is occurring within the cartridge filters.

Stress Linearization and Strength Evaluation of the BEP's Flow Plates for a Dual Cooled Fuel Assembly

International Nuclear Information System (INIS)

Kim, Jae Yong; Yoon, Kyung Ho; Kang, Heung Seok; Lee, Young Ho; Lee, Kang Hee; Kim, Hyung Kyu

2009-01-01

A fuel assembly is composed of 5 major components, such as a top end piece (TEP), a bottom end piece (BEP), spacer grids (SGs), guide tubes (GTs) and an instrumentation tube (IT) and fuel rods (FRs). There are no ASME criteria about all components except for a TEP/BEP. The TEP/BEP should satisfy stress intensity limits in case of condition A and B of ASME, Section III, Division 1 . Subsection NB. In a dual cooled fuel assembly, the array and position of fuels are changed from those of a conventional PWR fuel assembly to achieve a power uprating. The flow plates of top/bottom end pieces (TEP/BEP) have to be modified into proper shape to provide flow holes to direct the heated coolant into/out of the fuel assembly but structural intensity of these plates within a 22.241 kN axial loading should satisfy Tresca stress limits in ASME code. In this paper, stress linearization procedure and strength evaluation of a newly designed BEP for the dual cooled fuel assembly are described

Changes in feedwater organic matter concentrations based on intake type and pretreatment processes at SWRO facilities, Red Sea, Saudi Arabia

KAUST Repository

Dehwah, Abdullah; Li, Sheng; Almashharawi, Samir; Winters, Harvey; Missimer, Thomas M.

2015-01-01

Transparent exopolymer particles (TEP), natural organic matter, and bacterial concentrations in feedwater are important factors that can lead to membrane biofouling in seawater reverse osmosis (SWRO) systems. Two methods for controlling these concentrations in the feedwater prior to pretreatment have been suggested; use of subsurface intake systems or placement of the intake at a greater depth in the sea. These proposed solutions were tested at two SWRO facilities located along the Red Sea of Saudi Arabia. A shallow well intake system was very effective in reducing the algae and bacterial concentrations and somewhat effective in reducing TEP concentrations. An intake placed at a depth of 9. m below the surface was found to have limited impact on improving water quality compared to a surface intake. The algae and bacteria concentration in the feedwater (deep) was lower compared to the surface seawater, but the overall TEP concentration was higher. Bacteria and TEP measurements made in the pretreatment process train in the plant and after the cartridge filters suggest that regrowth of bacteria is occurring within the cartridge filters.

Influence of heat treatments on thermoelectric power of pressure vessel steels: effect of microstructural evolutions of strongly segregated areas

International Nuclear Information System (INIS)

Houze, M.

2002-12-01

Thermoelectric power measurement (TEP) is a very potential non destructive evaluation method considered to follow ageing under neutron irradiation of pressure vessel steel of nuclear reactor. Prior to these problems, the aim of this study is to establish correlations between TEP variations and microstructural evolutions of pressure vessel steels during heat treatments. Different steels, permitting to simulate heterogeneities of pressure vessel steels and to deconvoluate main metallurgical phenomenons effects were studied. This work allowed to emphasize effect on TEP of: austenitizing and cooling conditions and therefore of microstructure, metallurgical transformations during tempering (recovery, precipitation of alloying elements), and particularly molybdenum precipitation associated to secondary hardening, residual austenite amount or partial austenitizing. (author)

40 CFR 161.590 - Nontarget insect data requirements.

Science.gov (United States)

2010-07-01

... pollinators (4) CR CR CR CR CR CR TEP TEP 141-5 Nontarget insect testing—aquatic insects Acute toxicity to aquatic insects (5) 142-1 Aquatic insect life-cycle study (5) 142-1 Simulated or actual field testing for aquatic insects (5) 142-3 Nontarget insect testing—predators and parasites (5) 143-1thru 143-3 Key: CR...

Release of dissolved carbohydrates by Emiliania huxleyi and formation of transparent exopolymer particles depend on algal life cycle and bacterial activity.

Science.gov (United States)

Van Oostende, Nicolas; Moerdijk-Poortvliet, Tanja C W; Boschker, Henricus T S; Vyverman, Wim; Sabbe, Koen

2013-05-01

The coccolithophore Emiliania huxleyi plays a pivotal role in the marine carbon cycle. However, we have only limited understanding of how its life cycle and bacterial interactions affect the production and composition of dissolved extracellular organic carbon and its transfer to the particulate pool. We traced the fate of photosynthetically fixed carbon during phosphate-limited stationary growth of non-axenic, calcifying E. huxleyi batch cultures, and more specifically the transfer of this carbon to bacteria and to dissolved high molecular weight neutral aldoses (HMW NAld) and extracellular particulate carbon. We then compared the dynamics of dissolved carbohydrates and transparent exopolymer particles (TEP) between cultures of non-axenic and axenic diploid E. huxleyi. In addition, we present the first data on extracellular organic carbon in (non-axenic) haploid E. huxleyi cultures. Bacteria enhanced the accumulation of dissolved polysaccharides and altered the composition of dissolved HMW NAld, while they also stimulated the formation of TEP containing high densities of charged polysaccharides in diploid E. huxleyi cultures. In haploid E. huxleyi cultures we found a more pronounced accumulation of dissolved carbohydrates, which had a different NAld composition than the diploid cultures. TEP formation was significantly lower than in the diploid cultures, despite the presence of bacteria. In diploid E. huxleyi cultures, we measured a high level of extracellular release of organic carbon (34-76%), retrieved mainly in the particulate pool instead of the dissolved pool. Enhanced formation of sticky TEP due to bacteria-alga interactions, in concert with the production of coccoliths, suggests that especially diploid E. huxleyi blooms increase the efficiency of export production in the ocean during dissolved phosphate-limited conditions. © 2012 Society for Applied Microbiology and Blackwell Publishing Ltd.

A prospective randomised trial comparing mesh types and fixation in totally extraperitoneal inguinal hernia repairs.

Science.gov (United States)

Cristaudo, Adam; Nayak, Arun; Martin, Sarah; Adib, Reza; Martin, Ian

2015-05-01

The totally extraperitoneal (TEP) approach for surgical repair of inguinal hernias has emerged as a popular technique. We conducted a prospective randomised trial to compare patient comfort scores using different mesh types and fixation using this technique. Over a 14 month period, 146 patients underwent 232 TEP inguinal hernia repairs. We compared the comfort scores of patients who underwent these procedures using different types of mesh and fixation. A non-absorbable 15 × 10 cm anatomical mesh fixed with absorbable tacks (Control group) was compared with either a non-absorbable 15 × 10 cm folding slit mesh with absorbable tacks (Group 2), a partially-absorbable 15 × 10 cm mesh with absorbable tacks (Group 3) or a non-absorbable 15 × 10 cm anatomical mesh fixed with 2 ml fibrin sealant (Group 4). Outcomes were compared at 1, 2, 4 and 12 weeks using the Carolina Comfort Scale (CCS) scores. At 1, 2, 4 and 12 weeks, the median global CCS scores were low for all treatment groups. Statistically significant differences were seen only for median CCS scores and subscores with the use of partially-absorbable mesh with absorbable tacks (Group 3) at weeks 2 and 4. However, these were no longer significant at week 12. In this study, the TEP inguinal hernia repair with minimal fixation results in low CCS scores. There were no statistical differences in CCS scores when comparing types of mesh, configuration of the mesh or fixation methods. Copyright © 2015 IJS Publishing Group Limited. Published by Elsevier Ltd. All rights reserved.

Quorum-sensing regulator RhlR but not its autoinducer RhlI enables Pseudomonas to evade opsonization.

Science.gov (United States)

Haller, Samantha; Franchet, Adrien; Hakkim, Abdul; Chen, Jing; Drenkard, Eliana; Yu, Shen; Schirmeier, Stefanie; Li, Zi; Martins, Nelson; Ausubel, Frederick M; Liégeois, Samuel; Ferrandon, Dominique

2018-03-09

When Drosophila melanogaster feeds on Pseudomonas aeruginosa , some bacteria cross the intestinal barrier and eventually proliferate in the hemocoel. This process is limited by hemocytes through phagocytosis. P. aeruginosa requires the quorum-sensing regulator RhlR to elude the cellular immune response of the fly. RhlI synthesizes the autoinducer signal that activates RhlR. Here, we show that rhlI mutants are unexpectedly more virulent than rhlR mutants, both in fly and in nematode intestinal infection models, suggesting that RhlR has RhlI-independent functions. We also report that RhlR protects P. aeruginosa from opsonization mediated by the Drosophila thioester-containing protein 4 (Tep4). RhlR mutant bacteria show higher levels of Tep4- mediated opsonization, as compared to rhlI mutants, which prevents lethal bacteremia in the Drosophila hemocoel. In contrast, in a septic model of infection, in which bacteria are introduced directly into the hemocoel, Tep4 mutant flies are more resistant to wild-type P. aeruginosa, but not to the rhlR mutant. Thus, depending on the infection route, the Tep4 opsonin can either be protective or detrimental to host defense. © 2018 The Authors.

40 CFR 795.70 - Indirect photolysis screening test: Sunlight photolysis in waters containing dissolved humic...

Science.gov (United States)

2010-07-01

... constants and half-lives of test chemicals in PW and SHW. If the photoreaction rate in SHW is significantly.... Test chemicals that are classified as having half-lives in SHW in the range of 1 hour to 50 days in... background information on this test guideline the following references should be consulted. (1) Cooper W.J...

Evaluation of outcome of totally extra peritoneal laparoscopic inguinal hernia repair with lichtenstein open repair

International Nuclear Information System (INIS)

Ahmed, I.; Dian, A.; Azam, U.F.; Khan, M.

2015-01-01

The objective of this study was to evaluate outcome of total extraperitoneal laparoscopic inguinal hernia repair with Lichtenstein open repair in terms of postoperative pain. Study Design: Quasi experimental study. Place and Duration of Study: Surgical unit l Rawalpindi and Allied hospitals from January to June 2012. Patients and Methods: Sixty patients, with unilateral, primary, inguinal hernia were alternately allocated to undergo either total extraperitoneal (TEP) laparoscopic repair of inguinal hernia or Lichtenstein tension free, mesh repair of inguinal hernia. Pain scores at 12, 24, and 48 hours and at 7 days of follow up were noted using a visual analogue scale. Total number of intravenous injections of Diclofenac Sodium requested by the patient for pain relief was also noted. Results: At 12 hours after surgery, the mean pain scores in the TEP group were 3.1 ± 1.8 and in the Lichtenstein group they were 4.2 ± 2.1 (p 0.031). At 24 hours after surgery, the scores were 2.3 ± 1.5 and 3.1 ± 1.9 for the TEP and Lichtenstein groups, respectively (p = 0.026). At 48 hours after surgery, the mean pain scores in the TEP group were 1.5 ± 1.1 while in the Lichtenstein group they were 2.0 ± 1.6 (p = 0.041). At 7 days after surgery, the scores were 0.3 ± 0.5 in the TEP group and 0.4 ± 0.8 in the Lichtenstein group (0.137). The mean number of injection of Diclofenac Sodium required by the TEP and Lichtenstein groups was 3.1 ± 1.6 and 5.8 ± 2.2, respectively (p = 0.011). Conclusion: Less postoperative pain and requirement for analgesics were reported by patients who underwent total extraperitoneal laparoscopic repair of inguinal hernia as compared to those who underwent inguinal hernia repair by Lichtenstein tension free mesh hernioplasty. (author)

Cryoelectron microscopy imaging of recombinant and tissue derived vaults: localization of the MVP N termini and VPARP.

Science.gov (United States)

Mikyas, Yeshi; Makabi, Miriam; Raval-Fernandes, Sujna; Harrington, Lea; Kickhoefer, Valerie A; Rome, Leonard H; Stewart, Phoebe L

2004-11-12

The vault is a highly conserved ribonucleoprotein particle found in all higher eukaryotes. It has a barrel-shaped structure and is composed of the major vault protein (MVP); vault poly(ADP-ribose) polymerase (VPARP); telomerase-associated protein 1 (TEP1); and small untranslated RNA (vRNA). Although its strong conservation and high abundance indicate an important cellular role, the function of the vault is unknown. In humans, vaults have been implicated in multidrug resistance during chemotherapy. Recently, assembly of recombinant vaults has been established in insect cells expressing only MVP. Here, we demonstrate that co-expression of MVP with one or both of the other two vault proteins results in their co-assembly into regularly shaped vaults. Particles assembled from MVP with N-terminal peptide tags of various length are compared. Cryoelectron microscopy (cryoEM) and single-particle image reconstruction methods were used to determine the structure of nine recombinant vaults of various composition, as well as wild-type and TEP1-deficient mouse vaults. Recombinant vaults with MVP N-terminal peptide tags showed internal density that varied in size with the length of the tag. Reconstruction of a recombinant vault with a cysteine-rich tag revealed 48-fold rotational symmetry for the vault. A model is proposed for the organization of MVP within the vault with all of the MVP N termini interacting non-covalently at the vault midsection and 48 copies of MVP forming each half vault. CryoEM difference mapping localized VPARP to three density bands lining the inner surface of the vault. Difference maps designed to localize TEP1 showed only weak density inside of the caps, suggesting that TEP1 may interact with MVP via a small interaction region. In the absence of atomic-resolution structures for either VPARP or TEP1, fold recognition methods were applied. A total of 21 repeats were predicted for the TEP1 WD-repeat domain, suggesting an unusually large beta-propeller fold.

RNA-Seq of Tumor-Educated Platelets Enables Blood-Based Pan-Cancer, Multiclass, and Molecular Pathway Cancer Diagnostics.

Science.gov (United States)

Best, Myron G; Sol, Nik; Kooi, Irsan; Tannous, Jihane; Westerman, Bart A; Rustenburg, François; Schellen, Pepijn; Verschueren, Heleen; Post, Edward; Koster, Jan; Ylstra, Bauke; Ameziane, Najim; Dorsman, Josephine; Smit, Egbert F; Verheul, Henk M; Noske, David P; Reijneveld, Jaap C; Nilsson, R Jonas A; Tannous, Bakhos A; Wesseling, Pieter; Wurdinger, Thomas

2015-11-09

Tumor-educated blood platelets (TEPs) are implicated as central players in the systemic and local responses to tumor growth, thereby altering their RNA profile. We determined the diagnostic potential of TEPs by mRNA sequencing of 283 platelet samples. We distinguished 228 patients with localized and metastasized tumors from 55 healthy individuals with 96% accuracy. Across six different tumor types, the location of the primary tumor was correctly identified with 71% accuracy. Also, MET or HER2-positive, and mutant KRAS, EGFR, or PIK3CA tumors were accurately distinguished using surrogate TEP mRNA profiles. Our results indicate that blood platelets provide a valuable platform for pan-cancer, multiclass cancer, and companion diagnostics, possibly enabling clinical advances in blood-based "liquid biopsies". Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

d-Amino acids in molecular evolution in space - Absolute asymmetric photolysis and synthesis of amino acids by circularly polarized light.

Science.gov (United States)

Sugahara, Haruna; Meinert, Cornelia; Nahon, Laurent; Jones, Nykola C; Hoffmann, Søren V; Hamase, Kenji; Takano, Yoshinori; Meierhenrich, Uwe J

2018-07-01

Living organisms on the Earth almost exclusively use l-amino acids for the molecular architecture of proteins. The biological occurrence of d-amino acids is rare, although their functions in various organisms are being gradually understood. A possible explanation for the origin of biomolecular homochirality is the delivery of enantioenriched molecules via extraterrestrial bodies, such as asteroids and comets on early Earth. For the asymmetric formation of amino acids and their precursor molecules in interstellar environments, the interaction with circularly polarized photons is considered to have played a potential role in causing chiral asymmetry. In this review, we summarize recent progress in the investigation of chirality transfer from chiral photons to amino acids involving the two major processes of asymmetric photolysis and asymmetric synthesis. We will discuss analytical data on cometary and meteoritic amino acids and their potential impact delivery to the early Earth. The ongoing and future ambitious space missions, Hayabusa2, OSIRIS-REx, ExoMars 2020, and MMX, are scheduled to provide new insights into the chirality of extraterrestrial organic molecules and their potential relation to the terrestrial homochirality. This article is part of a Special Issue entitled: d-Amino acids: biology in the mirror, edited by Dr. Loredano Pollegioni, Dr. Jean-Pierre Mothet and Dr. Molla Gianluca. Copyright © 2018 Elsevier B.V. All rights reserved.

Destruction of microcystins (cyanotoxins) by UV-254 nm-based direct photolysis and advanced oxidation processes (AOPs): influence of variable amino acids on the degradation kinetics and reaction mechanisms.

Science.gov (United States)

He, Xuexiang; de la Cruz, Armah A; Hiskia, Anastasia; Kaloudis, Triantafyllos; O'Shea, Kevin; Dionysiou, Dionysios D

2015-05-01

Hepatotoxic microcystins (MCs) are the most frequently detected group of cyanobacterial toxins. This study investigated the degradation of common MC variants in water, MC-LR, MC-RR, MC-YR and MC-LA, by UV-254 nm-based processes, UV only, UV/H2O2, UV/S2O8(2-) and UV/HSO5(-). Limited direct photolysis of MCs was observed, while the addition of an oxidant significantly improved the degradation efficiency with an order of UV/S2O8(2-) > UV/HSO5(-) > UV/H2O2 at the same initial molar concentration of the oxidant. The removal of MC-LR by UV/H2O2 appeared to be faster than another cyanotoxin, cylindrospermopsin, at either the same initial molar concentration or the same initial organic carbon concentration of the toxin. It suggested a faster reaction of MC-LR with hydroxyl radical, which was further supported by the determined second-order rate constant of MCs with hydroxyl radical. Both isomerization and photohydration byproducts were observed in UV only process for all four MCs; while in UV/H2O2, hydroxylation and diene-Adda double bond cleavage byproducts were detected. The presence of a tyrosine in the structure of MC-YR significantly promoted the formation of monohydroxylation byproduct m/z 1061; while the presence of a second arginine in MC-RR led to the elimination of a guanidine group and the absence of double bond cleavage byproducts. It was therefore demonstrated in this study that the variable amino acids in the structure of MCs influenced not only the degradation kinetics but also the preferable reaction mechanisms. Copyright © 2015 Elsevier Ltd. All rights reserved.

Study of the solubility of iron in zirconium by thermoelectric power measurements

International Nuclear Information System (INIS)

Borrelly, R.; Merle, P.; Adami, L.; Centre National de la Recherche Scientifique, 69 - Villeurbanne

1990-01-01

Thermoelectric power (TEP) measurements are used to determine the solubility of iron in α-zirconium. A preliminary study shows that TEP is very sensitive to elements in solid solution, to cold-working and to the texture due to rolling in a temperature range including room temperature which is choosen for thermoelectric power measurements. The solutioning of iron obtained by a homogenization treatment and water-quench leads to a decrease of thermoelectric power. The conditions of homogenization treatments such that TEP variations are only due to the variation of iron content in solid solution have been determined. From these results the solubility of iron α-zirconium as a function of temperature has been determined. Moreover, the α-domain of the Zr-rich part of the Zr-Fe diagram has been completely delimited. A micrographic study has been made to confirm these results. (orig.)

The Development of a Team Empowerment Program in Schools at the Basic Education Level

Directory of Open Access Journals (Sweden)

Sakda Khamso

2017-03-01

Full Text Available The purpose of this research was to develop a Team Empowerment Program (TEP in Schools at the Basic Education Level (SBEL. The research methodology used in this study was research and development with four phases: 1 investigating actual state and desirable state with regard to team empowerment in SBEL; 2 developing a TEP in SBEL; 3 trying out on the implementation of the developed program in a sample school; and 4 assessing a use of the developed program. The sample consisted of 120 teachers of Chakkaratwittaya School in Nakhon-Ratchasima Province. The instruments used in this study were a set of questionnaires, a set of interview questions, an evaluation form and meeting minutes. The statistics used in the data analysis included percentage, mean ( , standard deviation (S.D., and priority needs index (PNI. The Conclusions were: 1. The current situation of team empowerment in SBEL both at the overall and individual levels indicates a low level of practice. In contrast, the highest level of team empowerment has been found under the most desirable conditions. 2. The developed TEP was comprised of: 1 rationale; 2 objectives and target; 3 content of teachers’ training included 6 aspects: 3.1 improving the administrative structure, 3.2 building a working system, 3.3 building work collaborations, 3.4 building the work environment, 3.5 building motivation to work, and 3.6 building the culture of work; 4 method of development used with intervention process which comprised 3 modules: 4.1 meetings to build awareness, 4.2 meetings to diagnose the relevant situations, and 4.3 meetings to appoint a problem-solving team; and 5 evaluation. 3. The results of the mplementation of the TEP in Chakkaratwittaya School were: 3.1 After the implementation of the developed program the teamwork behaviors of the teachers in each learning area group were significantly higher than before the implementation, with a statistical significance level of 0.1. 3.2 The overall

Temperature-induced assembly of semiconductor nanocrystals into fractal architectures and thermoelectric power properties in Au/Ge bilayer films

Energy Technology Data Exchange (ETDEWEB)

Li Quanbao; Wang Jian; Jiao Zheng [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Wu Minghong, E-mail: mhwu@staff.shu.edu.cn [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Shek, Chan-Hung; Lawrence Wu, C.M.; Lai, Joseph K.L. [Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon Tong (Hong Kong); Chen Zhiwen, E-mail: cnzwchen@yahoo.com.cn [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon Tong (Hong Kong)

2011-08-15

Highlights: > Ge fractal architectures were achieved by temperature-induced assembly. > The appearance of fractal architectures influences the thermoelectric power. > But it has little effect on the resistivity. > The values of the superlocalization exponent were within 1.22 {<=} {xi} {<=} 1.29. > It was higher than expected for two-dimension fractal system. - Abstract: Fractal architectures of semiconductor nanocrystals were successfully achieved by temperature-induced assembly of semiconductor nanocrystals in gold/germanium (Au/Ge) bilayer films. New assessment strategies of fractal architectures are of fundamental importance in the development of micro/nano-devices. Temperature-dependent properties including resistivity and thermoelectric power (TEP) of Au/Ge bilayer films with self-similar fractal patterns were investigated in detail. Experimental results indicated that the microstructure of Au film plays an important role in the characteristics of Au/Ge bilayer films after annealing and the crystallization processes of amorphous Ge accompany by fractal formation of Ge nanocrystals via temperature-induced assembly. The appearance of fractal architectures has significantly influence on the TEP but little effect on the resistivity of the annealed bilayer film. By analysis of the data, we found that the values of superlocalization exponent are within 1.22 {<=} {xi} {<=} 1.29, which are higher than expected for two-dimension fractal systems. The results provided possible evidence for the superlocalization on fractal architectures in Au/Ge bilayer films. The TEP measurements are considered a more effective method than the conductivity for investigating superlocalization in a percolating system.

Geo-thermo-electric power: geo-TEP materials; Geo-Thermopower. Geo-TEP Materials. Jahresbericht 2006

Energy Technology Data Exchange (ETDEWEB)

Bocher, L.; Weidenkaff, A.

2006-11-15

This illustrated annual report for 2006 for the Swiss Federal Office of Energy (SFOE) summarises activities carried out at the Swiss Federal Laboratories for Materials Testing and Research EMPA in the area of materials for use in thermo-electric power generation. Work carried out using Perovskite-type oxides exhibiting promising thermo-electric properties is described. The morphology and microstructure of polycrystalline particles are discussed as are the associated Seebeck coefficients. Further work to be carried out in 2007 is briefly reviewed.

Investigation of molecular mechanisms in photodynamic action and radiobiology with nanosecond flash photolysis and pulse radiolysis. Progress report, July 1, 1975--June 30, 1976

International Nuclear Information System (INIS)

Grossweiner, L.I.

1976-03-01

Flash photolysis studies have shown that exposed tyrosyl or tryptophyl residues of enzymes are photoionized at approximately the same quantum efficiency as the aqueous amino acids. Comparisons with permanent damage indicate that this primary process contributes to inactivation when a photolyzed aromatic residue is essential or is located adjacent to a catalytic, non-chromoporic residue. Studies on sensitization by the phototherapeutic drug, 8-methoxypsoralen (8-MOP), show the triplet state can lead to singlet oxygen generation and that weak binding to poly (dA-dT) suppresses this process. 8-MOP was found to be potent sensitizer of yeast photoinactivation with negligible post-irradiation recovery. Spinlable ESR measurements made on yeast cells after photodynamic treatment show that the membrane damage generated by the penetrating dye Toluidine Blue 0 is more extensive than the external dye, Eosin Y. In related ionizing radiation studies, it was found that 8-MOP is an anoxic radiosensitizer of T7 phage, attributed to enhancement of crosslinks; that complexing of eosin to lysozyme sensitizes the enzyme to oxidizing radicals; that the reactions of Br 2 - and (CNS) 2 - with tryptophan generate the same initial radical as uv-excited photoionization

Construction of a flash-photolysis apparatus having a short discharge time; Realisation d'un appareil de photolyse-eclair a faible duree de decharge

Energy Technology Data Exchange (ETDEWEB)

Devillers, C. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1964-07-01

Flash photolysis aims at reaching directly the primary mechanisms resulting from the action of light on an absorbent matter. This makes it necessary to produce a flash as short and as bright as possible. Our main effort was directed towards reducing the duration of the flash by decreasing the self-inductance of the discharge circuit. A description of this circuit and study of the characteristics of the apparatus are followed by a short description of the two analytical methods: flash spectrography and absorption spectrophotometry at a given wave-length. (author) [French] La photolyse-eclair cherche a atteindre directement les mecanismes primaires resultant de l'action de la lumiere sur une matiere absorbante. Ceci amene a produire un eclair aussi bref et intense que possible. Notre effort s'est porte sur la reduction de duree de l'eclair par diminution de la self-induction du circuit de decharge. Une description de ce circuit et une etude des caracteristiques de l'appareil precedent une breve description des deux methodes d'analyse; spectrographie eclair et spectrophotometrie d'absorption a longueur d'onde choisie. (auteur)

Photochemical degradation of atenolol, carbamazepine, meprobamate, phenytoin and primidone in wastewater effluents

Energy Technology Data Exchange (ETDEWEB)

Dong, Mei Mei [Civil, Environmental and Architectural Engineering, 428 UCB, University of Colorado, Boulder, CO 80309 (United States); Southern Nevada Water Authority (SNWA), P.O. Box 99954, Las Vegas, NV 89193-9954 (United States); Trenholm, Rebecca [Southern Nevada Water Authority (SNWA), P.O. Box 99954, Las Vegas, NV 89193-9954 (United States); Rosario-Ortiz, Fernando L., E-mail: Fernando.rosario@colorado.edu [Civil, Environmental and Architectural Engineering, 428 UCB, University of Colorado, Boulder, CO 80309 (United States)

2015-01-23

Highlights: • The photochemical degradation of 5 compounds was evaluated in wastewater effluents. • Attenuation by sensitized photolysis was the most important degradation pathway. • Hydroxyl radical accounted for most of the degradation for aliphatic compounds. • Other transient oxidants could also significantly impact the degradation of the compounds. - Abstract: The photochemical degradation of five pharmaceuticals was examined in two secondary wastewater effluents. The compounds, which included atenolol, carbamazepine, meprobamate, phenytoin and primidone, were evaluated for both direct and sensitized photolysis. In the two wastewaters, direct photolysis did not lead to significant compound degradation; however, sensitized photolysis was an important removal pathway for the five pharmaceuticals. Upon solar irradiation, hydroxyl radical (HO·) was quantified using the hydroxylation of benzene and singlet oxygen ({sup 1}O{sub 2}) formation was monitored following the degradation of furfuryl alcohol. Degradation via sensitized photolysis was observed following five-day exposures for atenolol (69–91%), carbamazepine (67–98%), meprobamate (16–52%), phenytoin (44–85%), and primidone (34–88%). Varying removal is likely a result of the differences in reactivity with transient oxidants. Averaged steady state HO· concentrations ranged from 1.2 to 4.0 × 10{sup −16} M, whereas the concentrations of {sup 1}O{sub 2} were 6.0–7.6 × 10{sup −14} M. Partial removal due to presence of HO· indicates it was not the major sink for most compounds examined. Other transient oxidants, such as {sup 1}O{sub 2} and triplet state effluent organic matter, are likely to play important roles in fates of these compounds.

Investigation of cytogenetic activity of radioprotectors in human lymphocyte culture

International Nuclear Information System (INIS)

Egiazaryan, S.V.; Arutyunyan, R.M.

1977-01-01

Studied are the effects of the F-11 and F-37 indene preparations on chromosome aberrations induced in lymphocyte culture of peripheral human blood by thioTEP. Investigation into the action of the substance in euqimolar concentrations has not shown their protective effect. Indene preparations did not change the spectrum of chromosome aberrations induced by thioTEP as well as did not increase the level of chromosome aberrations in lumphocyte culture of human peripheral human blood

Unusual perceptual experiences, anomalous/paranormal experiences and proneness to Schizotypy

OpenAIRE

Parra, Alejandro; Universidad Abierta Interamericana

2010-01-01

Parece haber similitudes entre el trastorno esquizotípico de personalidad (TEP) y las experiencias paranormales. De hecho, algunos de los síntomas en el TEP en el Diagnostic and Statistical Manual of Mental Disorders (DSM-IV-TR) coinciden con un número de experiencias anómalo/paranormales. La esquizotipia positiva, que incluye pensamiento mágico, alucinaciones y otras experiencias perceptuales inusuales, también ha estado relacionada con experiencias y creencias paranormales. Sin embargo, las...

Effects of triethyl phosphate and nitrate on electrokinetically enhanced biodegradation of diesel in low permeability soils.

Science.gov (United States)

Lee, G T; Ro, H M; Lee, S M

2007-08-01

Bench-scale experiments for electrokinetically enhanced bioremediation of diesel in low permeability soils were conducted. An electrokinetic reactor (ER) was filled with kaolin that was artificially contaminated with diesel at a level of 2500 mg kg(-1). A constant voltage gradient of 1.0 V cm(-1) was applied. In phosphorus transport experiments, KH2PO4 was not distributed homogeneously along the ER, and most of the transported phosphorus was converted to water-insoluble aluminum phosphate after 12 days of electrokinetic (EK) operation. However, the advancing P front of triethyl phosphate (TEP) progressed with time and resulted in uniform P distribution. The treatments employed in the electrokinetically enhanced bioremediation of diesel were control (no addition of nitrogen and phosphorus), NP (KNO3+ KH2PO4), NT (KNO3+ TEP), UP (urea+ KH2PO4), and UT (urea+TEP). Analysis of effluent collected during the first 12 days of EK operation showed that diesel was not removed from the kaolin. After nutrient delivery, using the EK operation, the ER was transferred into an incubator for the biodegradation process. After 60 days of biodegradation, the concentrations of diesel in the kaolin for the NP, NT, UP, UT, and control treatments were 1356, 1002, 1658, 1612, and 2003 mg kg(-1), respectively. The ratio of biodegraded diesel concentration to initial concentration (2465 mg kg(-1)) in NP, NT, UP, UT, and control were 45.0%, 59.4%, 32.7%, 34.6%, and 18.7%, respectively. This result showed that TEP, treated along with NO3-, was most effective for the biodegradation of diesel. TEP was delivered more efficiently to the target zones and with less phosphorus loss than KH2PO4. However, this facilitated phosphorus delivery was effective in biodegrading diesel under anaerobic conditions only when electron acceptors, such as NO3-, were present.

Cortical modulation of short-latency TMS-evoked potentials

Directory of Open Access Journals (Sweden)

Domenica eVeniero

2013-01-01

Full Text Available Transcranial magnetic stimulation - electroencephalogram (TMS-EEG co-registration offers the opportunity to test reactivity of brain areas across distinct conditions through TMS-evoked potentials (TEPs. Several TEPs have been described, their functional meaning being largely unknown. In particular, short-latency potentials peaking at 5 (P5 and 8 (N8 ms after the TMS pulse have been recently described, but because of their huge amplitude, the problem of whether their origin is cortical or not has been opened. To gain information about these components, we employed a protocol that modulates primary motor cortex excitability (MI through an exclusively cortical phenomena: low frequency stimulation of premotor area (PMC. TMS was applied simultaneously with EEG recording from 70 electrodes. Amplitude of TEPs evoked by 200 single-pulses TMS delivered over MI at 110% of resting motor threshold was measured before and after applying 900 TMS conditioning stimuli to left premotor cortex with 1 Hz repetition rate. Single subject analyses showed reduction in TEPs amplitude after PMC conditioning in a sample of participants and increase in TEPs amplitude in two subjects. No effects were found on corticospinal excitability as recorded by motor evoked potentials (MEPs. Furthermore, correlation analysis showed an inverse relation between the effects of the conditioning protocol on P5-N8 complex amplitude and MEPs amplitude. Because the effects of the used protocol have been ascribed to a cortical interaction between premotor area and MI, we suggest that despite the sign of P5-N8 amplitude modulation is not consistent across participant, this modulation could indicate, at least in part, their cortical origin. We conclude that with an accurate experimental procedure early-latency components can be used to evaluate the reactivity of the stimulated cortex.

[Patients' intervention in a therapeutic education program dedicated to systemic lupus: definitions, setting and benefits].

Science.gov (United States)

Hervier, B; Magar, Y; Allab, F; Richard, K; Neves, Y; Danjou, S; Amoura, Z; Ayçaguer, S

2015-10-01

Though recommended, participation of patients with specific expertise in therapeutic education programs (TEP) is rare. This work reports the experience of a national reference centre for rare systemic diseases. Involvement of "expert patients" (EP) has been planned from the development of a TEP dedicated to systemic lupus: patients' roles and required expertise have been defined and linked to the pedagogical tools. Such patients have been recruited during individual interviews and called to participate to specific pedagogical training. EP intervention have been evaluated by questionnaire to EP and health care providers. Three EP's functions have been identified: sharing experiences, giving "tips and tricks" and promoting dialogue. EP's interventions has been organised into a hierarchy (from sharing to co-animation). Among 298 patients enrolled in the TEP, 25 (8.4%) have been identified as possible EP. Eight of them (32%) benefited from a specific training of 12 hours. Among these patients, two (25%) regularly participate to the education sessions. For EP as well as for health care providers, EP's intervention seems beneficial (visual scale scores of 7.5 and 9.5, respectively). Though difficult to organise, EP's intervention in TEP dedicated to rare systemic diseases seems useful and would earn to be increase. Copyright © 2015 Société nationale française de médecine interne (SNFMI). Published by Elsevier SAS. All rights reserved.

The Urban Exploitation Platform - An instrument for the global provision of indicators related to sustainable cities and communities

Science.gov (United States)

Esch, Thomas; Asamer, Hubert; Hirner, Andreas; Marconcini, Mattia; Metz, Annekatrin; Uereyen, Soner; Zeidler, Julian; Boettcher, Martin; Permana, Hans; Boissier, Enguerran; Mathot, Emmanuel; Soukop, Tomas; Balhar, Jakub; Svaton, Vaclav; Kuchar, Stepan

2017-04-01

The Sentinel fleet will provide a so-far unique coverage with Earth Observation (EO) data and therewith new opportunities for the implementation of methodologies to generate innovative geo-information products and services supporting the SDG targets. It is here where the TEP Urban project is supposed to initiate a step change by providing an open and participatory platform that allows any interested user to easily exploit large-volume EO data pools, in particular those of the European Sentinel and the US Landsat missions, and derive thematic geo-information, metrics and indicators related to the status and development of the built environment. Key component of TEP Urban initiative is the implementation of a web-based platform (https://urban-tep.eo.esa.int) employing distributed high-level computing infrastructures and providing key functionalities for i) high-performance access to satellite imagery and other data sources such as statistics or topographic data, ii) state-of-the-art pre-processing, analysis, and visualization techniques, iii) customized development and dissemination of algorithms, products and services, and iv) networking and communication. This contribution introduces the main facts about the TEP Urban platform, including a description of the general objectives, the platform systems design and functionalities, and the available portfolio of products and services that can directly serve the global provision of indicators for SDG targets, in particular related to SDG 11.

Investigating consummatory and anticipatory pleasure across motivation deficits in schizophrenia and healthy controls.

Science.gov (United States)

Da Silva, Susana; Saperia, Sarah; Siddiqui, Ishraq; Fervaha, Gagan; Agid, Ofer; Daskalakis, Z Jeff; Ravindran, Arun; Voineskos, Aristotle N; Zakzanis, Konstantine K; Remington, Gary; Foussias, George

2017-08-01

Anhedonia has traditionally been considered a characteristic feature of schizophrenia, but the true nature of this deficit remains elusive. This study sought to investigate consummatory and anticipatory pleasure as it relates to motivation deficits. Eighty-four outpatients with schizophrenia and 81 healthy controls were administered the Temporal Experience of Pleasure Scale (TEPS), as well as a battery of clinical and cognitive assessments. Multivariate analyses of variance were used to examine the experience of pleasure as a function of diagnosis, and across levels of motivation deficits (i.e. low vs. moderate. vs. high) in schizophrenia. Hierarchical regression analyses were also conducted to evaluate the predictive value of amotivation in relation to the TEPS. There were no significant differences between schizophrenia and healthy control groups for either consummatory or anticipatory pleasure. Within the schizophrenia patients, only those with high levels of amotivation were significantly impaired in consummatory and anticipatory pleasure compared to low and moderate groups, and compared to healthy controls. Further, our results revealed that amotivation significantly predicts both consummatory and anticipatory pleasure, with no independent contribution of group. Utilizing study samples with a wide range of motivation deficits and incorporating objective paradigms may provide a more comprehensive understanding of hedonic deficits. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

Diode laser probe of CO2 vibrational excitation produced by collisions with hot deuterium atoms from the 193 nm excimer laser photolysis D2S

International Nuclear Information System (INIS)

O'Neill, J.A.; Cai, J.Y.; Flynn, G.W.; Weston, R.E. Jr.

1986-01-01

The 193 nm excimer laser photolysis of D 2 S in D 2 S/CO 2 mixtures produces fast deuterium atoms (E/sub TR/approx.2.2 eV) which vibrationally excite CO 2 molecules via inelastic translation--vibration/rotation (T--V/R) energy exchange processes. A high resolution (10 -3 cm -1 ) cw diode laser probe was used to monitor the excitation of ν 3 (antisymmetric stretch) and ν 2 (bend) vibrations in CO 2 . The present results are compared with previous experiments involving hot hydrogen atom excitation of CO 2 in H 2 S/CO 2 mixtures as well as with theoretical calculations of the excitation probability. The probability for excitation of a ν 3 quantum in CO 2 is about 1%--2% per gas kinetic D/CO 2 collision. Bending (ν 2 ) quanta are produced about eight times more efficiently than antisymmetric stretching (ν 3 ) quanta. The thermalization rate for cooling hot D atoms below the threshold for production of a ν 3 vibrational quantum corresponds to less than 2 D*/D 2 S collisions or 15 D*/CO 2 collisions

Mechanistic Insight into the Degradation of Nitrosamines via Aqueous-Phase UV Photolysis or a UV-Based Advanced Oxidation Process: Quantum Mechanical Calculations.

Science.gov (United States)

Minakata, Daisuke; Coscarelli, Erica

2018-02-28

Nitrosamines are a group of carcinogenic chemicals that are present in aquatic environments that result from byproducts of industrial processes and disinfection products. As indirect and direct potable reuse increase, the presence of trace nitrosamines presents challenges to water infrastructures that incorporate effluent from wastewater treatment. Ultraviolet (UV) photolysis or UV-based advanced oxidation processes that produce highly reactive hydroxyl radicals are promising technologies to remove nitrosamines from water. However, complex reaction mechanisms involving radicals limit our understandings of the elementary reaction pathways embedded in the overall reactions identified experimentally. In this study, we perform quantum mechanical calculations to identify the hydroxyl radical-induced initial elementary reactions with N -nitrosodimethylamine (NDMA), N -nitrosomethylethylamine, and N -nitrosomethylbutylamine. We also investigate the UV-induced NDMA degradation mechanisms. Our calculations reveal that the alkyl side chains of nitrosamine affect the reaction mechanism of hydroxyl radicals with each nitrosamine investigated in this study. Nitrosamines with one- or two-carbon alkyl chains caused the delocalization of the electron density, leading to slower subsequent degradation. Additionally, three major initial elementary reactions and the subsequent radical-involved reaction pathways are identified in the UV-induced NDMA degradation process. This study provides mechanistic insight into the elementary reaction pathways, and a future study will combine these results with the kinetic information to predict the time-dependent concentration profiles of nitrosamines and their transformation products.

Mechanistic Insight into the Degradation of Nitrosamines via Aqueous-Phase UV Photolysis or a UV-Based Advanced Oxidation Process: Quantum Mechanical Calculations

Directory of Open Access Journals (Sweden)

Daisuke Minakata

2018-02-01

Full Text Available Nitrosamines are a group of carcinogenic chemicals that are present in aquatic environments that result from byproducts of industrial processes and disinfection products. As indirect and direct potable reuse increase, the presence of trace nitrosamines presents challenges to water infrastructures that incorporate effluent from wastewater treatment. Ultraviolet (UV photolysis or UV-based advanced oxidation processes that produce highly reactive hydroxyl radicals are promising technologies to remove nitrosamines from water. However, complex reaction mechanisms involving radicals limit our understandings of the elementary reaction pathways embedded in the overall reactions identified experimentally. In this study, we perform quantum mechanical calculations to identify the hydroxyl radical-induced initial elementary reactions with N-nitrosodimethylamine (NDMA, N-nitrosomethylethylamine, and N-nitrosomethylbutylamine. We also investigate the UV-induced NDMA degradation mechanisms. Our calculations reveal that the alkyl side chains of nitrosamine affect the reaction mechanism of hydroxyl radicals with each nitrosamine investigated in this study. Nitrosamines with one- or two-carbon alkyl chains caused the delocalization of the electron density, leading to slower subsequent degradation. Additionally, three major initial elementary reactions and the subsequent radical-involved reaction pathways are identified in the UV-induced NDMA degradation process. This study provides mechanistic insight into the elementary reaction pathways, and a future study will combine these results with the kinetic information to predict the time-dependent concentration profiles of nitrosamines and their transformation products.

Repair of inguinal hernia: a comparison between extraperitoneal laparoscopy and Lichtenstein open surgery

Directory of Open Access Journals (Sweden)

Tavassoli A

2010-06-01

Full Text Available "n Normal 0 false false false EN-US X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:Arial; mso-bidi-theme-font:minor-bidi;} Background: The inguinal hernia is a common disorder in general surgery. Different methods have been described for repair of these hernias. In modern methods, synthetic mesh is used to cover the wall defect and the most known method is Lichtenstein surgical repair. The laparoscopic totally extra peritoneal procedure (TEP is a newer technique of repairing hernia. The aim of this study is to compare the outcomes of totally extraperitoneal laparoscopic inguinal hernia repair versus Lichtenstein open repair in patients with inguinal hernia."n"nMethods: Among 50 patients, 25 cases underwent Lichtenstein procedure and 25 patients underwent TEP technique for repairing primary unilateral inguinal hernia. Findings during the operation have been recorded and the 12-months follow-up of patients in different views was performed through a questionnaire and then the results were compared."n"nResults: The operation duration, the rate of complications and frequency of recurrence were similar in two groups; but the hospital stay, postoperative pain, chronic groin pain and the required time to return to normal activity were significantly lower in patients who underwent the TEP method compared to the patients who underwent the

Impact of changes in broth composition on Chlorella vulgaris cultivation in a membrane photobioreactor (MPBR) with permeate recycle.

Science.gov (United States)

Discart, V; Bilad, M R; Marbelia, L; Vankelecom, I F J

2014-01-01

A membrane photobioreactor (MPBR) is a proven and very useful concept in which microalgae can be simultaneously cultivated and pre-harvested. However, the behavior with respect to accumulation of algogenic organic matter, including transparent exopolymeric particles (TEPs), counter ions and unassimilated nutrients due to the recycling of the medium is still unclear, even though the understanding of this behavior is essential for the optimization of microalgae processing. Therefore, the dynamics of these compounds, especially TEPs, during coupled cultivation and harvesting of Chlorella vulgaris in an MPBR with permeate recycle are addressed in this study. Results show that TEPs are secreted during algae cell growth, and that their presence is thus inevitable. In the system with permeate recycle, substances such as counter ions and unassimilated nutrients get accumulated in the system. This was proven to limit the algae growth, together with the occurrence of bioflocculation due to an increasing broth pH. Copyright © 2013 Elsevier Ltd. All rights reserved.

Trait Anticipatory Pleasure Predicts Effort Expenditure for Reward.

Directory of Open Access Journals (Sweden)

Joachim T Geaney

Full Text Available Research in motivation and emotion has been increasingly influenced by the perspective that processes underpinning the motivated approach of rewarding goals are distinct from those underpinning enjoyment during reward consummation. This distinction recently inspired the construction of the Temporal Experience of Pleasure Scale (TEPS, a self-report measure that distinguishes trait anticipatory pleasure (pre-reward feelings of desire from consummatory pleasure (feelings of enjoyment and gratification upon reward attainment. In a university community sample (N = 97, we examined the TEPS subscales as predictors of (1 the willingness to expend effort for monetary rewards, and (2 affective responses to a pleasant mood induction procedure. Results showed that both anticipatory pleasure and a well-known trait measure of reward motivation predicted effort-expenditure for rewards when the probability of being rewarded was relatively low. Against expectations, consummatory pleasure was unrelated to induced pleasant affect. Taken together, our findings provide support for the validity of the TEPS anticipatory pleasure scale, but not the consummatory pleasure scale.

TNFα promotes CAR-dependent migration of leukocytes across epithelial monolayers

Science.gov (United States)

Morton, Penny E.; Hicks, Alexander; Ortiz-Zapater, Elena; Raghavan, Swetavalli; Pike, Rosemary; Noble, Alistair; Woodfin, Abigail; Jenkins, Gisli; Rayner, Emma; Santis, George; Parsons, Maddy

2016-01-01

Trans-epithelial migration (TEpM) of leukocytes during inflammation requires engagement with receptors expressed on the basolateral surface of the epithelium. One such receptor is Coxsackie and Adenovirus Receptor (CAR) that binds to Junctional Adhesion Molecule-like (JAM-L) expressed on leukocytes. Here we provide the first evidence that efficient TEpM of monocyte-derived THP-1 cells requires and is controlled by phosphorylation of CAR. We show that TNFα acts in a paracrine manner on epithelial cells via a TNFR1-PI3K-PKCδ pathway leading to CAR phosphorylation and subsequent transmigration across cell junctions. Moreover, we show that CAR is hyper-phosphorylated in vivo in acute and chronic lung inflammation models and this response is required to facilitate immune cell recruitment. This represents a novel mechanism of feedback between leukocytes and epithelial cells during TEpM and may be important in controlling responses to pro-inflammatory cytokines in pathological settings. PMID:27193388

Thermopower and magnetocaloric properties in NdSrMnO/CrO3 composites

Science.gov (United States)

Ahmed, A. M.; Mohamed, H. F.; Paixão, J. A.; Mohamed, Sara A.

2018-06-01

The thermoelectric power (TEP) and magnetocaloric effect (MCE) for (Nd0.6Sr0.4MnO3)1-x/(CrO3)x composites have been measured. The TEP measurements show a negative sign value of the Seebeck coefficient (S), in microvolts. TEP data construe in the low range of temperature by the magnon and phonon drag model, whereas at high temperature by small polaron conduction mechanism. Magnetic measurements exhibit that all composites show a paramagnetic-ferromagnetic transition with decreasing temperature. The Arrott plots of composites reveal the occurrence of a second order phase transition. The maximum value of magnetic entropy change (ΔS) is 2.37 J kg-1 K-1, achieved fore the composite with x = 0.015. Moreover, the maximum value of relative cooling power (RCP) is 122.1 J kg-1, achieved for the composite with x = 0.020. These composites may be appropriate for magnetic application near room temperature.

NF3: UV Absorption Spectrum Temperature Dependence and the Atmospheric and Climate Forcing Implications

Science.gov (United States)

Papadimitriou, Vassileios C.; McGillen, Max R.; Fleming, Eric L.; Jackman, Charles H.; Burkholder, James B.

2013-01-01

Nitrogen trifluoride (NF3) is an atmospherically persistent greenhouse gas that is primarily removed by UV photolysis and reaction with O((sup 1)D) atoms. In this work, the NF3 gas-phase UV absorption spectrum, sigma(delta,T), was measured at 16 wavelengths between 184.95 and 250 nm at temperatures between 212 and 296 K. A significant spectrum temperature dependence was observed in the wavelength region most relevant to atmospheric photolysis (200-220 nm) with a decrease in sigma(210 nm,T) of approximately 45 percent between 296 and 212 K. Atmospheric photolysis rates and global annually averaged lifetimes of NF3 were calculated using the Goddard Space Flight Center 2-D model and the sigma(delta,T) parameterization developed in this work. Including the UV absorption spectrum temperature dependence increased the stratospheric photolysis lifetime from 610 to 762 years and the total global lifetime from 484 to 585 years; the NF3 global warming potentials on the 20-, 100-, and 500-year time horizons increased less than 0.3, 1.1, and 6.5 percent to 13,300, 17,700, and 19,700, respectively.

Effects of Phytoplankton Growth Phase on the Formation and Properties of Marine Snow

Science.gov (United States)

Montgomery, Q. W.; Proctor, K. W.; Prairie, J. C.

2016-02-01

Marine snow aggregates often dominate carbon export from the upper mixed layer to the deep ocean. Thus, understanding the formation and the properties of these aggregates is essential to the study of the biological pump. Aggregate formation is determined by both the encounter rate and the stickiness of the particles that they are composed of. Stickiness of phytoplankton has been linked to production of transparent exopolymer particles (TEP), which has been previously shown to vary in concentration throughout different parts of the phytoplankton growth cycle. The objective of this study is to determine the effects of the growth phase of the diatom Thalassiosira weissflogii to both TEP production and the properties of the resulting aggregates produced. Cultures of T. weissflogii were stopped at separate phases of the phytoplankton growth curve and incubated in rotating cylindrical tanks to form aggregates. Aggregate properties such as size, density, and porosity were measured at the end of each period of roller incubation. Preliminary results describe little variation in the size of the aggregates formed from different parts of the growth phase, but show a significant effect of growth phase on aggregate density. Density is an important factor in the settling of marine aggregates. Therefore, variations in aggregate density during different growth phases may have large implications for the efficiency of the biological pump during different stages of a phytoplankton bloom. Further examination will be performed on the potential effects of TEP abundance on the properties of the aggregates formed at separate growth phases and the resulting implications for carbon flux.

High-Resolution Mass Spectrometry and Molecular Characterization of Aqueous Photochemistry Products of Common Types of Secondary Organic Aerosols

Energy Technology Data Exchange (ETDEWEB)

Romonosky, Dian E.; Laskin, Alexander; Laskin, Julia; Nizkorodov, Sergey

2015-03-19

A significant fraction of atmospheric organic compounds is predominantly found in condensed phases, such as aerosol particles and cloud droplets. Many of these compounds are photolabile and can degrade through direct photolysis or indirect photooxidation processes on time scales that are comparable to the typical lifetimes of aqueous droplets (hours) and particles (days). This paper presents a systematic investigation of the molecular level composition and the extent of aqueous photochemical processing in different types of secondary organic aerosol (SOA) from biogenic and anthropogenic precursors including α-pinene, β-pinene, β-myrcene, d- limonene, α-humulene, 1,3,5-trimethylbenzene, and guaiacol, oxidized by ozone (to simulate a remote atmosphere) or by OH in the presence of NOx (to simulate an urban atmosphere). Chamber- and flow tube-generated SOA samples were collected, extracted in a methanol/water solution, and photolyzed for 1 h under identical irradiation conditions. In these experiments, the irradiation was equivalent to about 3-8 h of exposure to the sun in its zenith. The molecular level composition of the dissolved SOA was probed before and after photolysis with direct-infusion electrospray ionization high-resolution mass spectrometry (ESI-HR-MS). The mass spectra of unphotolyzed SOA generated by ozone oxidation of monoterpenes showed qualitatively similar features, and contained largely overlapping subsets of identified compounds. The mass spectra of OH/NOx generated SOA had more unique visual appearance, and indicated a lower extent of products overlap. Furthermore, the fraction of nitrogen containing species (organonitrates and nitroaromatics) was highly sensitive to the SOA precursor. These observations suggest that attribution of high-resolution mass spectra in field SOA samples to specific SOA precursors should be more straightforward under OH/NOx oxidation conditions compared to the ozone driven oxidation. Comparison of the SOA constituents

Single incision laparoscopic surgery (SILS) inguinal hernia repair - recent clinical experiences of this novel technique.

Science.gov (United States)

Yussra, Y; Sutton, P A; Kosai, N R; Razman, J; Mishra, R K; Harunarashid, H; Das, S

2013-01-01

Inguinal hernia remains the most commonly encountered surgical problem. Various methods of repair have been described, and the most suitable one debated. Single port access (SPA) surgery is a rapidly evolving field, and has the advantage of affording 'scarless' surgery. Single incision laparoscopic surgery (SILS) for inguinal hernia repair is seen to be feasible in both total extraperitoneal (TEP) and transabdominal pre-peritoneal (TAPP) approaches. Data and peri-operative information on both of these however are limited. We aimed to review the clinical experience, feasibility and short term complications related to laparoscopic inguinal hernia repair via single port access. A literature search was performed using Google Scholar, Springerlink Library, Highwire Press, Surgical Endoscopy Journal, World Journal of Surgery and Medscape. The following search terms were used: laparoscopic hernia repair, TAPP, TEP, single incision laparoscopic surgery (SILS). Fourteen articles in English language related to SILS inguinal hernia repair were identified. Nine articles were related to TEP repair and the remaining 5 to TAPP. A total of 340 patients were reported within these studies: 294 patients having a TEP repair and 46 a TAPP. Only two cases of recurrence were reported. Various ports have been utilized, including the SILS port, Tri-Port and a custom- made port using conventional laparoscopic instruments. The duration of surgery was 40-100 minutes and the average length of hospital stay was one day. Early outcomes of this novel technique show it to be feasible, safe and with potentially better cosmetic outcome.

Effect of Solar Radiation on the Optical Properties and Molecular Composition of Laboratory Proxies of Atmospheric Brown Carbon

Energy Technology Data Exchange (ETDEWEB)

Lee, Hyun Ji; Aiona, Paige K.; Laskin, Alexander; Laskin, Julia; Nizkorodov, Sergey

2014-09-02

Sources, optical properties, and chemical composition of atmospheric brown carbon (BrC) aerosol are uncertain, making it challenging to estimate its contribution to radiative forcing. Furthermore, optical properties of BrC may change significantly during its atmospheric aging. We examined the effect of solar photolysis on the molecular composition, mass absorption coefficient, and fluorescence of secondary organic aerosol prepared by high-NO_x photooxidation of naphthalene (NAP SOA). The aqueous solutions of NAP SOA was observed to photobleach with an effective half-time of ~15 hours (with sun in its zenith) for the loss of the near-UV (300 -400 nm) absorbance. The molecular composition of NAP SOA was significantly modified by photolysis, with the average SOA formula changing from C_14.1H_14.5O_5.1N_0.08 to C_11.8H_14.9O_4.5N_0.02 after 4 hours of irradiation. The average O/C ratio did not change significantly, however, suggesting that it is not a good metric for assessing the extent of photolysis-driven aging in NAP SOA (and in BrC in general). In contrast to NAP SOA, the photolysis of BrC material produced by aqueous reaction of limonene+O₃ SOA (LIM/O₃ SOA) with ammonium sulfate was much faster, but it did not result in a significant change in the molecular level composition. The characteristic absorbance of the aged LIM/O₃ SOA in the 450-600 nm range decayed with an effective half-time of <0.5 hour. This result emphasizes the highly variable and dynamic nature of different types of atmospheric BrC.

TMSEEG: A MATLAB-Based Graphical User Interface for Processing Electrophysiological Signals during Transcranial Magnetic Stimulation.

Science.gov (United States)

Atluri, Sravya; Frehlich, Matthew; Mei, Ye; Garcia Dominguez, Luis; Rogasch, Nigel C; Wong, Willy; Daskalakis, Zafiris J; Farzan, Faranak

2016-01-01

Concurrent recording of electroencephalography (EEG) during transcranial magnetic stimulation (TMS) is an emerging and powerful tool for studying brain health and function. Despite a growing interest in adaptation of TMS-EEG across neuroscience disciplines, its widespread utility is limited by signal processing challenges. These challenges arise due to the nature of TMS and the sensitivity of EEG to artifacts that often mask TMS-evoked potentials (TEP)s. With an increase in the complexity of data processing methods and a growing interest in multi-site data integration, analysis of TMS-EEG data requires the development of a standardized method to recover TEPs from various sources of artifacts. This article introduces TMSEEG, an open-source MATLAB application comprised of multiple algorithms organized to facilitate a step-by-step procedure for TMS-EEG signal processing. Using a modular design and interactive graphical user interface (GUI), this toolbox aims to streamline TMS-EEG signal processing for both novice and experienced users. Specifically, TMSEEG provides: (i) targeted removal of TMS-induced and general EEG artifacts; (ii) a step-by-step modular workflow with flexibility to modify existing algorithms and add customized algorithms; (iii) a comprehensive display and quantification of artifacts; (iv) quality control check points with visual feedback of TEPs throughout the data processing workflow; and (v) capability to label and store a database of artifacts. In addition to these features, the software architecture of TMSEEG ensures minimal user effort in initial setup and configuration of parameters for each processing step. This is partly accomplished through a close integration with EEGLAB, a widely used open-source toolbox for EEG signal processing. In this article, we introduce TMSEEG, validate its features and demonstrate its application in extracting TEPs across several single- and multi-pulse TMS protocols. As the first open-source GUI-based pipeline

TMSEEG: A MATLAB-Based Graphical User Interface for Processing Electrophysiological Signals during Transcranial Magnetic Stimulation

Science.gov (United States)

Atluri, Sravya; Frehlich, Matthew; Mei, Ye; Garcia Dominguez, Luis; Rogasch, Nigel C.; Wong, Willy; Daskalakis, Zafiris J.; Farzan, Faranak

2016-01-01

Concurrent recording of electroencephalography (EEG) during transcranial magnetic stimulation (TMS) is an emerging and powerful tool for studying brain health and function. Despite a growing interest in adaptation of TMS-EEG across neuroscience disciplines, its widespread utility is limited by signal processing challenges. These challenges arise due to the nature of TMS and the sensitivity of EEG to artifacts that often mask TMS-evoked potentials (TEP)s. With an increase in the complexity of data processing methods and a growing interest in multi-site data integration, analysis of TMS-EEG data requires the development of a standardized method to recover TEPs from various sources of artifacts. This article introduces TMSEEG, an open-source MATLAB application comprised of multiple algorithms organized to facilitate a step-by-step procedure for TMS-EEG signal processing. Using a modular design and interactive graphical user interface (GUI), this toolbox aims to streamline TMS-EEG signal processing for both novice and experienced users. Specifically, TMSEEG provides: (i) targeted removal of TMS-induced and general EEG artifacts; (ii) a step-by-step modular workflow with flexibility to modify existing algorithms and add customized algorithms; (iii) a comprehensive display and quantification of artifacts; (iv) quality control check points with visual feedback of TEPs throughout the data processing workflow; and (v) capability to label and store a database of artifacts. In addition to these features, the software architecture of TMSEEG ensures minimal user effort in initial setup and configuration of parameters for each processing step. This is partly accomplished through a close integration with EEGLAB, a widely used open-source toolbox for EEG signal processing. In this article, we introduce TMSEEG, validate its features and demonstrate its application in extracting TEPs across several single- and multi-pulse TMS protocols. As the first open-source GUI-based pipeline

Renewable municipal waste barometer

International Nuclear Information System (INIS)

2014-01-01

In the European Union the production of primary energy from the incineration of municipal waste increased by only 0.7% in 2013 and reached 8.7 million tep (tonnes of oil equivalent). Germany ranks first with the production of 2729 ktep followed by France with 1246 ktep. A positive point is that the sale of heat to heat networks has strongly increased in some countries which means that primary energy is better used. 2 tables give the production of electricity and heat from the incineration of municipal waste in the E.U. member states in 2012 and 2013. Germany ranks first in the 2 tables. The total production of electricity and heat from the incineration of municipal waste in E.U. in 2013 reached 18741 GWh and 2361 tep respectively. A list reviews the most significant companies working in Europe in the sector of waste incineration, 8 companies are listed, 2 are German: EEW, Remondis, 3 are French: SITA (Suez Environment, Veolia and TIRU (EDF), Urbaser is spanish, Gruppo Hera is Italian and AEB-Amsterdan is dutch. (A.C.)

Pre-operational HTO/HT surveys in the vicinity of the Chalk River Laboratories tritium extraction plant

International Nuclear Information System (INIS)

Workman, W.J.G.; Brown, R.M.

1993-08-01

Surveys of the concentrations of HT and HTO in the atmosphere downwind of the Chalk River Laboratories reactor facilities were carried out in 1986 November, and in 1989 March, April and September under different conditions of air temperature, wind direction, and snow or vegetative cover. HT usually amounted to 1-5% of total tritium, but values up to 20% were observed, probably resulting from preferential removal of HTO. In all of the surveys, the greater persistence in the atmosphere of HT than of HTO was evident. The existing levels of HT are such that they will not be augmented significantly by chronic releases from the Tritium Extraction Plant (TEP) when it comes into operation. Hence, operation of the TEP will not facilitate studies of the environmental behaviour of chronically released HT. However, longer term studies of the distribution of HT from the existing facilities would be worthwhile. Soil and vegetation HTO levels in the study area are reported. Further studies of the distribution of tritium between the air, soil and vegetation in areas subjected to chronic exposure would be valuable

Technology-enhanced practice for patients with chronic cardiac disease: home implementation and evaluation.

Science.gov (United States)

Brennan, Patricia Flatley; Casper, Gail R; Burke, Laura J; Johnson, Kathy A; Brown, Roger; Valdez, Rupa S; Sebern, Marge; Perez, Oscar A; Sturgeon, Billie

2010-01-01

This 3-year field experiment engaged 60 nurses and 282 patients in the design and evaluation of an innovative home-care nursing model, referred to as technology-enhanced practice (TEP). Nurses using TEP augmented the usual care with a web-based resource (HeartCareII) that provided patients with self-management information, self-monitoring tools, and messaging services. Patients exposed to TEP demonstrated better quality of life and self-management of chronic heart disease during the first 4 weeks, and were no more likely than patients in usual care to make unplanned visits to a clinician or hospital. Both groups demonstrated the same long-term symptom management and achievements in health status. This project provides new evidence that the purposeful creation of patient-tailored web resources within a hospital portal is possible; that nurses have difficulty with modifying their practice routines, even with a highly-tailored web resource; and that the benefits of this intervention are more discernable in the early postdischarge stages of care. Copyright © 2010 Elsevier Inc. All rights reserved.

HAT-P-10b: A LIGHT AND MODERATELY HOT JUPITER TRANSITING A K DWARF

International Nuclear Information System (INIS)

Bakos, G. A.; Pal, A.; Torres, G.; Sipocz, B.; Latham, D. W.; Noyes, R. W.; Hartman, J.; Esquerdo, G. A.; Sasselov, D. D.; Kovacs, Gabor; Stefanik, R. P.; Kovacs, Geza; Fischer, D. A.; Johnson, J. A.; Marcy, G. W.; Howard, A. W.; Butler, R. P.; Lazar, J.; Papp, I.; Sari, P.

2009-01-01

We report on the discovery of HAT-P-10b, one of the lowest mass (0.487 ± 0.018 M J ) transiting extrasolar planets (TEPs) discovered to date by transit searches. HAT-P-10b orbits the moderately bright V = 11.89 K dwarf GSC 02340-01714, with a period P = 3.7224747 ± 0.0000065 days, transit epoch T c = 2454759.68683 ± 0.00016 (BJD), and duration 0.1090 ± 0.0008 days. HAT-P-10b has a radius of 1.005 +0.032 -0.027 R J yielding a mean density of 0.594 ± 0.052 g cm -3 . Comparing these observations with recent theoretical models we find that HAT-P-10b is consistent with a ∼4.5 Gyr, almost pure hydrogen and helium gas giant planet with a 10 M + core. With an equilibrium temperature of T eq = 1020 ± 17 K, HAT-P-10b is one of the coldest TEPs. Curiously, its Safronov number θ = 0.053 ± 0.002 falls close to the dividing line between the two suggested TEP populations.

Thermoelectrical power analysis of precipitation in 6013 aluminum alloy

International Nuclear Information System (INIS)

Abdala, M.R.W.S.; Garcia de Blas, J.C.; Barbosa, C.; Acselrad, O.

2008-01-01

The 6013 aluminum alloy was first developed for application in the aircraft industry and, more recently, as a replacement option for the use of the 6061 alloy in the automotive industry. The present work describes the evolution of the process of formation and dissolution of different kinds of precipitates in 6013 aluminum alloy, subjected to different conditions of heat treatment, using for this purpose measurements of thermoelectrical power, Vickers microhardness and differential scanning calorimeter (DSC). Although in the last years many works have been published on the use of thermoelectrical power (TEP) measurements for the analysis of precipitation process in traditional alloys such as 6061, there is still little information related to 6013 alloy. The results obtained are compared with a previous characterization work on the same alloy using transmission electron microscopy. It was observed that TEP measurements are very sensitive to precipitation phenomena in this alloy, and it has been found that there is an inverse relation between TEP and Vickers microhardness values, which allowed proposing a precipitation sequence for 6013 aluminum alloy

Design of the Flow Plates for a Dual Cooled Fuel Assembly

International Nuclear Information System (INIS)

Kim, Jae Yong; Yoon, Kyung Ho; Lee, Young Ho; Lee, Kang Hee; Kim, Hyung Kyu

2009-01-01

In a dual cooled fuel assembly, the array and position of fuels are changed from those of a conventional PWR fuel assembly to achieve a power uprating. The flow plate provides flow holes to direct the heated coolant into/out of the fuel assembly and structural intensity to insure that the fuel rod is axially restrained within the spacer grids. So, flow plates of top/bottom end pieces (TEP/BEP) have to be modified into proper shape. Because the flow holes' area of a flow plate affects pressure drop, the flow holes' area must be larger than/equal to that of conventional flow plates. And design criterion of the TEP/BEP says that the flow plate should withstand a 22.241 kN axial load during handling lest a calculated stress intensity should exceed the Condition I allowable stress. In this paper, newly designed flow plates of a TEP/BEP are suggested and stress analysis is conducted to evaluate strength robustness of the flow plates for the dual cooled fuel assembly

Organic Carbon Reduction in Seawater Reverse Osmosis (SWRO) Plants, Jeddah, Saudi Arabia

KAUST Repository

Alshahri, Abdullah

2015-12-01

Desalination is considered to be a major source of usable water in the Middle East, especially the Gulf countries which lack fresh water resources. A key and sometimes the only solution to produce high quality water in these countries is through the use of seawater reverse osmosis (SWRO) desalination technology. Membrane fouling is an economic and operational defect that impacts the performance of SWRO desalination technology. To limit this fouling phenomenon, it is important to implement the appropriate type of intake and pre-treatment system design. In this study, two types of systems were investigated, a vertical well system and a surface-water intake at a 9m depth. The purpose of this investigation is to study the impact of the different intake systems and pre-treatment stages in minimizing the concentrations of algae, bacteria, natural organic matter (NOM) and transparent exopolymer particles (TEP), in the feed water prior to pre-treatment, through the pre-treatment stages, and in the product water and concentrate. Water samples were collected from the surface seawater, the intakes (wells for site A, 9 m depth open ocean intake at site B), after the media filter, after the cartridge filter, and from the permeate and reject streams. The measured parameters included physical parameters, algae, bacteria, total organic carbon (TOC), fractions of dissolved NOM, particulate and colloidal TEP. The results of this study prove that the natural filtration and biological treatment of the seawater which occur in the aquifer matrix are very effective in improving the raw water quality to a significant degree. The results demonstrated that algae and biopolymers were 100% removed, the bacterial concentrations were significantly removed and roughly 50% or greater of TOC concentrations was eliminated by the aquifer matrix at site A. The aquifer feeding the vertical wells reduced TEP concentrations, but to differing degree. There is a slight decrease in the concentrations of

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available TGVTC Sbjct: 1 ... PNDLIRQAVAAEQAGFDFVEISDHFHPWLDNQGHSPFAWSVLGAIAARTERIGLATGVTC 60 ... Query: 134 IIRLLWQGGYRSYEGKYLQLSDARIFD...LPETPPVIXXXXXXXXXXXXXXXXXXXXXXTEP 193 ... IIRLLWQGGYRSYEGKYLQLSDARIFDLPETPPVI ... ... ... TEP Sbjct: 121 IIRLLWQGGYRSYEGKYLQLSDARIFDLPETPPVIAVAAGGPAAARLAADLGDGLF

CO2-emission trading and green markets for renewable electricity. WILMAR - deliverable 4.1

International Nuclear Information System (INIS)

Azuma-Dicke, N.; Weber, C.; Morthorst, P.E.; Ravn, H.F.; Schmidt, R.

2004-06-01

This report is Deliverable 4.1 of the EU project 'Wind Power Integration in Liberalised Electricity Markets' (WILMAR) and de-scribes the application of two policy instruments, Tradable Emissions Permits (TEPs) and Tradable Green Certificates (TGCs) for electricity produced from renewable energy sources in the European Union and the implications for implementation in the Wilmar model. The introduction of a common emission-trading system in the EU is expected to have an upward effect on the spot prices at the electric-ity market. The variations of the spot price imply that some types of power generation may change the situation from earning money to losing money despite the increasing spot price. Heavy restrictions on emissions penalise the fossil-fuelled technologies significantly, and the associated increase in the spot price need not compensate for this. Therefore, a market of TEPs is expected to have a significant influence on the electricity spot price. However, the expected price level of TEPs are met with great uncertainty and a study of a number of economical studies shows a price span between zero and 270 USD per ton of CO 2 depending on the participation or non-participation of countries in the scheme. The price-determination at the TGC market is expected to be closely related to the price at the power spot market as the RE-producers of electricity will have expectations to the total price paid for the energy produced, i.e., for the price of electricity at the spot market plus the price per kWh obtained at the green certificate mar-ket. In the Wilmar model, the TGC market can either be handled exogenously, i.e., the increase in renewable capacity and an average annual TGC price are determined outside the model, or a simple TGC module is developed, including the long-term supply functions for the most relevant renewable technologies and an overall TGC quota. Both solutions are rather simple, but to develop a more advanced model for the TGC market seems to be

Tromboembolismo pulmonar e anticonceptivos orais – a propósito de um caso clínico.

Directory of Open Access Journals (Sweden)

Fernando Matos

1996-05-01

Full Text Available RESUMO: A propósito de um caso de Tromboembolismo Pulmonar (TEP, em mulher jovem a fazer anticonceptivo oral (ACO, os AA fazem uma revisão sumária dos ACO como factor de risco no TEP. SUMMARY: In reference to a clinical case of Pulmonary Thromboembolism (PTE in a young woman taking oral contraceptives (OC, the authors review the role of OC as a risk factor in PTE. Palavras-chave: Contracepção oral, Tromboembolismo pulmonar, Factores de risco vascular, Key-words: Oral contraception, Pulmonary embolism, Vascular risk factors

Tratamento de tromboembolismo pulmonar por aspiração percutânea do trombo: relato de caso

OpenAIRE

Góes Junior,Adenauer Marinho de Oliveira; Mascarenhas,Fabricio; Mourão,Guilherme de Souza; Elkis,Henrique; Pieruccetti,Marco Antônio

2010-01-01

O tromboembolismo pulmonar (TEP) maciço é uma importante causa de mortalidade. A principal causa de óbito é a disfunção do ventrículo direito, provocada pela alta resistência ao seu fluxo de ejeção, e a sobrevida do paciente, nessas situações, depende da pronta desobstrução das artérias pulmonares. A anticoagulação, o uso de trombolíticos e a embolectomia pulmonar representam opções terapêuticas consolidadas para diferentes cenários clínicos de TEP. A Radiologia Intervencionista representa ho...

Towards the Rosetta Stone of planet formation

Directory of Open Access Journals (Sweden)

Schmidt T.O.B.

2011-02-01

Full Text Available Transiting exoplanets (TEPs observed just ~10 Myrs after formation of their host systems may serve as the Rosetta Stone for planet formation theories. They would give strong constraints on several aspects of planet formation, e.g. time-scales (planet formation would then be possible within 10 Myrs, the radius of the planet could indicate whether planets form by gravitational collapse (being larger when young or accretion growth (being smaller when young. We present a survey, the main goal of which is to find and then characterise TEPs in very young open clusters.

Study of thermoelectric power of Co-B liquid quenched amorphous alloys at relatively high temperature

International Nuclear Information System (INIS)

Naqvi, S.M.N.R.; Rizvi, S.D.H.; Raza, S.M.; Rizvi, S.; Hussain, A.; Rehman, F.

1999-01-01

Measurements of thermoelectric power TEP were carried out for the samples of Co-1 alloy with appropriate compositions of constitutions in the temperature range, 350K< T<760K. The analysis of data shows an inverse Gaussian profile. Ziman theoretical model was used to fit the resistivity data which shows an agreement. Dynamic recovery processes as well as formation of vacancies, interstials, intersection of basal dislocations and indeed pyramidal interlocking of dislocations for seeding scattering centers are responsible for residual TEP at relatively high temperatures Co-B LQA alloys also undergo into other structural changes at such temperatures. (author)

Aqueous Photochemistry of Secondary Organic Aerosol of α-Pinene and α-Humulene Oxidized with Ozone, Hydroxyl Radical, and Nitrate Radical

Energy Technology Data Exchange (ETDEWEB)

Romonosky, Dian E.; Li, Ying; Shiraiwa, Manabu; Laskin, Alexander; Laskin, Julia; Nizkorodov, Sergey

2017-01-18

Formation of secondary organic aerosols (SOA) from biogenic volatile organic compounds 13 (BVOC) occurs via O₃^- and OH-initiated reactions during the day and reactions with NO₃ ^{during the 14 night. We explored the effect of these three oxidation conditions on the molecular composition and 15 aqueous photochemistry of model SOA prepared from two common BVOC. A common monoterpene, α- 16 pinene, and sesquiterpene, α-humulene, were used to form SOA in a smog chamber via BVOC + O₃, 17 BVOC + NO₃, and BVOC + OH + NOx oxidation. Samples of SOA were collected, extracted in water, 18 and photolyzed in an aqueous solution in order to simulate the photochemical cloud processing of SOA. 19 The extent of change in the molecular level composition of SOA over 4 hours of photolysis (roughly 20 equivalent to 64 hours of photolysis under ambient conditions) was assessed with high-resolution 21 electrospray ionization mass spectrometry. The analysis revealed significant differences in the molecular 22 composition between monoterpene and sesquiterpene SOA formed by the different oxidation pathways. 23 The composition further evolved during photolysis with the most notable change corresponding to the 24 nearly-complete removal of nitrogen-containing organic compounds. Hydrolysis of SOA compounds also 25 occurred in parallel with photolysis. The preferential loss of larger SOA compounds during photolysis 26 and hydrolysis made the SOA compounds more volatile on average. This study suggests that cloud- and 27 fog-processing may under certain conditions lead to a reduction in the SOA loading as opposed to an 28 increase in SOA loading commonly assumed in the literature.}

Photodegradation of the azole fungicide climbazole by ultraviolet irradiation under different conditions: Kinetics, mechanism and toxicity evaluation

Energy Technology Data Exchange (ETDEWEB)

Liu, Wang-Rong; Ying, Guang-Guo, E-mail: guang-guo.ying@gig.ac.cn; Zhao, Jian-Liang; Liu, You-Sheng; Hu, Li-Xin; Yao, Li; Liang, Yan-Qiu; Tian, Fei

2016-11-15

Highlights: • Climbazole (CZ) could be effectively degraded under UV-254 irradiation. • CZ underwent direct and self-sensitized photolysis involving ROS. • The main photodegradation by-products of CZ were identified and semi-quantitated. • Pathway includes hydroxylative dechlorination, dechlorination, and de-pinacolone. • The toxicity of the photodegradation system reduced after UV-254 irradiation. - Abstract: Climbazole (CZ) has been known to persist in various environmental media, and may cause potential risks to aquatic organisms. This study investigated the photodegradation of CZ by ultraviolet (UV, 254 nm) under different conditions. The results revealed that CZ could be effectively degraded in aqueous solutions under UV-254 irradiation with a half-life of 9.78 min (pH = 7.5), and the photodegradation followed pseudo-first-order kinetics. pH had almost no effect on its rate constants and quantum yields; but the water quality of natural waters could affect the photolysis of CZ, and the coexisting constituents such as Fe{sup 3+}, NO{sub 3}{sup −}, and HA obviously inhibited its photolysis. The addition of different radical scavengers also inhibited the photodegradation of CZ due to the reduction of reactive oxygen species (ROS). CZ underwent direct and self-sensitized photolysis involving ROS. Based on the identified photodegradation by-products, the proposed pathways included hydroxylative dechlorination, dechlorination and de-pinacolone. Moreover, toxicity evaluation using duckweed found significant toxicity reduction in the photodegradation system of CZ after the irradiation of UV-254, and the remaining by-products did not pose extra toxicity compared with CZ itself. These findings from present study suggest that CZ in effluent could be further reduced by applying UV photolysis treatment.

Kinetics of polymer degradation in solution. 6. Laser flash photolysis and pulse radiolysis studies of polymethylvinylketone in solution using the light scattering detection method

Energy Technology Data Exchange (ETDEWEB)

Lindenau, D; Beavan, S W; Beck, G; Schnabel, W [Hahn-Meitner-Institut fuer Kernforschung Berlin G.m.b.H. (Germany, F.R.)

1977-01-01

Polymethylvinylketone (PMVK) was irradiated in solution with 2 ..mu..s pulses of 15 MeV electrons or with 15 ns flashes of 262 nm light. The change of the intensity of the light scattered by the solution (LSI) after the irradiation was measured. For the radiolysis experiments, a main chain scission process tausub(1/2) (decr) approximately 20 ..mu..s) and a subsequent crosslinking process (tausub(1/2) (incr) approximately 0.4 sec) could be discriminated. The LSI change pertaining to the main chain degradation was found to be due to disentanglement diffusion, whereas the LSI change pertaining to the crosslinking process could be correlated to a chemical reaction. The rate constant for combination of lateral macroradicals in acetone solution was estimated as 2 k/sub 2/ - (4.5 +- 1.5)10/sup 6/ M/sup -1/ sec/sup -1/. Stationary irradiation with /sup 60/Co-..gamma..-rays showed that PMVK is predominantly crosslinked to form a macrogel when irradiated in the solid state or in solution at concentrations greater than 100 g/l. At lower concentrations, microgel formation occurred. Photolysis of PMVK in solution yielded only main chain degradation. The LSI change was found to be due to disentanglement diffusion as during radiolysis. It was concluded that the same mechanism for main chain rupture is operative as in radiolysis. Stationary irradiations with uv light (lambda > 260 nm ) resulted in main chain degradation; no indication of crosslinking was obtained.

Combination of AC Transmission Expansion Planning and Reactive Power Planning in the restructured power system

International Nuclear Information System (INIS)

Hooshmand, Rahmat-Allah; Hemmati, Reza; Parastegari, Moein

2012-01-01

Highlights: ► To overcome the disadvantages of DC model in Transmission Expansion Planning, AC model should be used. ► The Transmission Expansion Planning associated with Reactive Power Planning results in fewer new transmission lines. ► Electricity market concepts should be considered in Transmission Expansion Planning problem. ► Reliability aspects should be considered in Transmission Expansion Planning problem. ► Particle Swarm Optimization is a suitable optimization method to solve Transmission Expansion Planning problem. - Abstract: Transmission Expansion Planning (TEP) is an important issue in power system studies. It involves decisions on location and number of new transmission lines. Before deregulation of the power system, the goal of TEP problem was investment cost minimization. But in the restructured power system, nodal prices, congestion management, congestion surplus and so on, have been considered too. In this paper, an AC model of TEP problem (AC-TEP) associated with Reactive Power Planning (RPP) is presented. The goals of the proposed planning problem are to minimize investment cost and maximize social benefit at the same time. In the proposed planning problem, in order to improve the reliability of the system the Expected Energy Not Supplied (EENS) index of the system is limited by a constraint. For this purpose, Monte Carlo simulation method is used to determine the EENS. Particle Swarm Optimization (PSO) method is used to solve the proposed planning problem which is a nonlinear mixed integer optimization problem. Simulation results on Garver and RTS systems verify the effectiveness of the proposed planning problem for reduction of the total investment cost, EENS index and also increasing social welfare of the system.

Size-effect features on the magnetothermopower of bismuth nanowires

International Nuclear Information System (INIS)

Condrea, E.; Nicorici, A.

2011-01-01

Full text: In this work we have studied the magnetic field dependence of the thermopower (TEP) and resistance of glass-coated Bi wires with diameter (d) from 100 nm to at 1.5 μm below 80 K. Nanowires have anomalously large values of the thermopower (+100 μV K.1) and relatively high effective resistivities, but their frequencies of SdH oscillations remain those of bulk Bi. The TEP stays positive in longitudinal magnetic fields up to 15 T, where the surface scattering of charge carriers is negligible. Our analysis shows that the anomalous thermopower has a diffusion origin and is a consequence of the microstructure rather than the result of the strong scattering of electrons by the wire walls. The intensities of field at which the size-effect features appear on the magnetothermopower curves correspond to a value at which the diameter of the hole cyclotron orbit equals d. Size-effect features were observed only for set of nanowires with d = 100-350 nm, where diffusion TEP is dominant. The contribution of the phonon-drag effect was observed in a wire with diameter larger than 400 nm and becomes dominant at diameter of 1 μm. (authors)

Turbulent equipartitions in two dimensional drift convection

International Nuclear Information System (INIS)

Isichenko, M.B.; Yankov, V.V.

1995-01-01

Unlike the thermodynamic equipartition of energy in conservative systems, turbulent equipartitions (TEP) describe strongly non-equilibrium systems such as turbulent plasmas. In turbulent systems, energy is no longer a good invariant, but one can utilize the conservation of other quantities, such as adiabatic invariants, frozen-in magnetic flux, entropy, or combination thereof, in order to derive new, turbulent quasi-equilibria. These TEP equilibria assume various forms, but in general they sustain spatially inhomogeneous distributions of the usual thermodynamic quantities such as density or temperature. This mechanism explains the effects of particle and energy pinch in tokamaks. The analysis of the relaxed states caused by turbulent mixing is based on the existence of Lagrangian invariants (quantities constant along fluid-particle or other orbits). A turbulent equipartition corresponds to the spatially uniform distribution of relevant Lagrangian invariants. The existence of such turbulent equilibria is demonstrated in the simple model of two dimensional electrostatically turbulent plasma in an inhomogeneous magnetic field. The turbulence is prescribed, and the turbulent transport is assumed to be much stronger than the classical collisional transport. The simplicity of the model makes it possible to derive the equations describing the relaxation to the TEP state in several limits

Generation of Free Oxygen Atoms O(³P) in Solution by Photolysis of 4-Benzoylpyridine N-Oxide

Energy Technology Data Exchange (ETDEWEB)

Carraher, Jack M. [Ames Lab., Ames, IA (United States); Iowa State Univ., Ames, IA (United States); Bakac, Andreja [Ames Lab., Ames, IA (United States); Iowa State Univ., Ames, IA (United States)

2014-08-04

Laser flash photolysis of 4-benzoylpyridine N-oxide (BPyO) at 308 nm in aqueous solutions generates a triplet excited state ³BPyO* that absorbs strongly in the visible, λ_max 490 and 380 nm. ³BPyO* decays with the rate law k_decay/s^-1 = (3.3 ± 0.9) × 10⁴ + (1.5 ± 0.2) × 10⁹ [BPyO] to generate a mixture of isomeric hydroxylated benzoylpyridines, BPy(OH), in addition to small amounts of oxygen atoms, O(³P). Molecular oxygen quenches ³BPyO*, k_Q = 1.4 × 10⁹ M^-1 s^-1, but the yields of O(³P) increase in O₂-saturated solutions to 36%. Other triplet quenchers have a similar effect, which rules out the observed ³BPyO* as a source of O(³P). It is concluded that O(³P) is produced from either ¹BPyO* or a short-lived, unobserved, higher energy triplet generated directly from ¹BPyO*. ³BPyO* is reduced by Fe²⁺ and by ABTS^2- to the radical anion BPyO^.- which exhibits a maximum at 510 nm, ε = 2200 M^-1 cm^-1. The anion engages in back electron transfer with ABTS^.- with k = 1.7 × 109 M^-1 s^-1. The same species can be generated by reducing ground state BPyO with ^.C(CH₃)₂OH. The photochemistry of BPyO in acetonitrile is similar to that in aqueous solutions.

Technical Note: VUV photodesorption rates from water ice in the 120–150 K temperature range – significance for Noctilucent Clouds

Directory of Open Access Journals (Sweden)

M. Yu. Kulikov

2011-02-01

Full Text Available Laboratory studies have been carried out with the aim to improve our understanding of physicochemical processes which take place at the water ice/air interface initiated by solar irradiation with a wavelength of 121.6 nm. It was intended to mimic the processes of ice particles characteristic of Noctilucent Clouds (NLCs. The experimental set-up used includes a high-vacuum chamber, a gas handling system, a cryostat with temperature controller, an FTIR spectrometer, a vacuum ultraviolet hydrogen lamp, and a microwave generator. We report the first results of measurements of the absolute photodesorption rate (loss of substance due to the escape of photoproducts into gas phase from thin (20–100 nm water ice samples kept in the temperature range of 120–150 K. The obtained results show that a flow of photoproducts into the gas phase is considerably lower than presumed in the recent study by Murray and Plane (2005. The experiments indicate that almost all photoproducts remain in the solid phase, and the principal chemical reaction between them is the recombination reaction H + OH → H₂O which is evidently very fast. This means that direct photolysis of mesospheric ice particles seems to have no significant impact on the gas phase chemistry of the upper mesosphere.

Evolution of the Deep-space Galactic Cosmic Ray Lineal Energy Transfer Spectrum through Tissue Equivalent Plastic

Science.gov (United States)

Case, A. W.; Kasper, J. C.; Spence, H. E.; Golightly, M. J.; Schwadron, N. A.; Mazur, J. E.; Blake, J. B.; Looper, M. D.; Townsend, L.; Zeitlin, C. J.

2011-12-01

The Cosmic Ray Telescope for the Effects of Radiation is an energetic particle telescope that resides on the Lunar Reconnaissance Orbiter spacecraft, currently in a 50 km circular lunar polar orbit. The telescope consists of 6 silicon semi-conductor detectors placed in pairs that surround two pieces of Tissue Equivalent Plastic (TEP), which serve to absorb energy from particles as they transit through the instrument. Particles with energies greater than 12 MeV/nucleon can penetrate the outermost shield and be measured by the instrument. The primary measurement made by the instrument is of the Linear Energy Transfer (LET) of energetic particles as they transit through the telescope. CRaTER measures the LET spectrum with unprecedented energy resolution and has done so during a period of historically low solar activity that led to record high intensities of Galactic Cosmic Rays (GCR). These LET spectra are used to study changes in the properties of the incoming particles, and to make detailed measurements of the radiation doses human explorers will experience in deep space on missions to the moon, to asteroids, or to Mars. We present LET spectra accumulated during 2009 and 2010. We show how the LET spectrum evolves through the instrument as the GCR interact with the TEP. Due to the importance of these measurements for human effects, our extensive absolute calibration procedures are presented. Of particular note is a significant reduction in the flux of particles with LET greater than 10 keV/um for detectors that lie deeper within the telescope stack, due to the attenuation of high LET particles within the TEP. By measuring this attenuation we can estimate the depth in human tissue where the highest LET particles that are most likely to cause genetic damage pose the greatest threat to humans in space.

Pressure dependent photolysis quantum yields for CH3C(O)CH3 at 300 and 308 nm and at 298 and 228 K.

Science.gov (United States)

Khamaganov, V G; Crowley, J N

2013-07-07

The quantum yield of formation of CH3 and CH3CO in the pulsed laser photo-excitation of acetone at 300 and 308 nm was investigated at several pressures (60 to 740 Torr) and at either 298 or 228 K. The organic radicals generated were monitored indirectly following conversion (by reaction with Br2) to Br atoms, which were detected by resonance fluorescence. The photolysis of Cl2 in back-to-back experiments at the same wavelength and under identical experimental conditions served as chemical actinometer. The pressure and temperature dependent quantum yields obtained with this method are in good agreement with previous literature values and are reproduced using the parameterisation developed by Blitz et al. The Br formation kinetics deviated from that expected from reactions of CH3 and CH3CO alone and Br atoms were still observed at high yield even when the quantum yield of formation of CH3 and CH3CO was low. This is explained by the reactive quenching of thermalized triplet acetone (T1) by Br2. High yields of T1 (>80%) at the highest pressure in this study indicate that any dissociation from the first excited singlet state (S1) occurs in competition with intersystem crossing, and that physical quenching of S1 to the electronic ground (S0) is not a major process at these wavelengths. The rate coefficient for reaction of T1 with Br2 was found to be ∼3 × 10(-10) cm(3) molecule(-1) s(-1), independent of pressure or temperature.

Swarm Intelligence-Enhanced Detection of Non-Small-Cell Lung Cancer Using Tumor-Educated Platelets.

Science.gov (United States)

Best, Myron G; Sol, Nik; In 't Veld, Sjors G J G; Vancura, Adrienne; Muller, Mirte; Niemeijer, Anna-Larissa N; Fejes, Aniko V; Tjon Kon Fat, Lee-Ann; Huis In 't Veld, Anna E; Leurs, Cyra; Le Large, Tessa Y; Meijer, Laura L; Kooi, Irsan E; Rustenburg, François; Schellen, Pepijn; Verschueren, Heleen; Post, Edward; Wedekind, Laurine E; Bracht, Jillian; Esenkbrink, Michelle; Wils, Leon; Favaro, Francesca; Schoonhoven, Jilian D; Tannous, Jihane; Meijers-Heijboer, Hanne; Kazemier, Geert; Giovannetti, Elisa; Reijneveld, Jaap C; Idema, Sander; Killestein, Joep; Heger, Michal; de Jager, Saskia C; Urbanus, Rolf T; Hoefer, Imo E; Pasterkamp, Gerard; Mannhalter, Christine; Gomez-Arroyo, Jose; Bogaard, Harm-Jan; Noske, David P; Vandertop, W Peter; van den Broek, Daan; Ylstra, Bauke; Nilsson, R Jonas A; Wesseling, Pieter; Karachaliou, Niki; Rosell, Rafael; Lee-Lewandrowski, Elizabeth; Lewandrowski, Kent B; Tannous, Bakhos A; de Langen, Adrianus J; Smit, Egbert F; van den Heuvel, Michel M; Wurdinger, Thomas

2017-08-14

Blood-based liquid biopsies, including tumor-educated blood platelets (TEPs), have emerged as promising biomarker sources for non-invasive detection of cancer. Here we demonstrate that particle-swarm optimization (PSO)-enhanced algorithms enable efficient selection of RNA biomarker panels from platelet RNA-sequencing libraries (n = 779). This resulted in accurate TEP-based detection of early- and late-stage non-small-cell lung cancer (n = 518 late-stage validation cohort, accuracy, 88%; AUC, 0.94; 95% CI, 0.92-0.96; p swarm intelligence may also benefit the optimization of diagnostics readout of other liquid biopsy biosources. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

At the Turning Point of the Current Techno-Economic Paradigm: Commons-Based Peer Production, Desktop Manufacturing and the Role of Civil Society in the Perezian Framework

Directory of Open Access Journals (Sweden)

Vasilis Kostakis

2013-01-01

Full Text Available Following the theory of techno-economic paradigm shifts (TEPS, this paper calls attention to the phenomenon of Commons-based peer production (CBPP. In the context of the current paradigm, it argues that civil society can play an important role in creating favourable conditions for a more sustainable global knowledge society. Approaching tentatively the ways in which 3D printing and other desktop manufacturing technologies can be used in CBPP, it also explores the ways in which the partnership with the state may provide a supportive innovative institutional basis for taking the maximum advantage of the emerging synergies in the vein of TEPS theory.

A novel UV-photolysis approach with acetone and isopropyl alcohol for the rapid determination of fluoride in organofluorine-containing drugs by spectrophotometry.

Science.gov (United States)

Mullapudi, Venkata Balarama Krishna; Dheram, Karunasagar

2018-01-01

A UV photolysis decomposition (UVPD) method for the determination of fluoride in fluorine containing pharmaceuticals by spectrophotometry is reported. It is based on the use of high intensity UV-irradiation in the presence of a digesting solution comprising a mixture of acetone and isopropanol. For the optimization of the UVPD procedure, three bulk drugs (levofloxacin, nebivolol and efavirenz) were chosen as representatives of three diverse compounds containing a single fluorine atom, two fluorine atoms, and trifluoromethyl groups respectively. Operational conditions of the UVPD method, such as concentration and volume of reagents (acetone and isopropyl alcohol), and UV irradiation time (1-6 minutes) were optimized. The efficiency of digestion was evaluated by the determination of fluoride in sample digests. Using the developed method, it was possible for complete conversion of the organofluoride to free fluoride ion for its subsequent determination by spectrophotometry based on bleaching of Zr-xylenol orange-color complex. Quantitative recovery (>98%) of the fluorine in the drug samples could be achieved using a mixture of 2% acetone + 2% isopropyl alcohol + 0.003% Na 2 CO 3 in just 5 minutes of UV irradiation, which can be considered an important aspect considering the difficulties involved in the cleavage of the CF bond. Accuracy was evaluated by comparison of results obtained by the UVPD method with the values estimated using formula weight of the compound and no statistical difference was observed between the results. Therefore, the proposed method is suitable for application in routine analysis of fluoride in organofluorine-containing drugs. Copyright © 2016. Published by Elsevier B.V.

Prototype Tsunami Evacuation Park in Padang, West Sumatra, Indonesia

Science.gov (United States)

Tucker, B. E.; Cedillos, V.; Deierlein, G.; Di Mauro, M.; Kornberg, K.

2012-12-01

Padang, Indonesia, a city of some 900,000 people, half of whom live close to the coast and within a five-meter elevation above sea level, has one of the highest tsunami risks in the world due to its close offshore thrust-fault seismic hazard, flat terrain and dense population. There is a high probability that a tsunami will strike the shores of Padang, flooding half of the area of the city, within the next 30 years. If that tsunami occurred today, it is estimated that several hundred thousand people would die, as they could not reach safe ground in the ~30 minute interval between the earthquake's occurrence and the tsunami's arrival. Padang's needs have been amply demonstrated: after earthquakes in 2007, 2009, 2011 and 2012, citizens, thinking that those earthquakes might cause a tsunami, tried to evacuate in cars and motorbikes, which created traffic jams, and most could not reach safe ground in 30 minutes. Since 2008, GeoHazards International (GHI) and Stanford University have studied a range of options for improving this situation, including ways to accelerate evacuation to high ground with pedestrian bridges and widened roads, and means of "vertical" evacuation in multi-story buildings, mosques, pedestrian overpasses, and Tsunami Evacuation Parks (TEPs), which are man-made hills with recreation facilities on top. TEPs proved most practical and cost-effective for Padang, given the available budget, technology and time. The Earth Observatory Singapore (EOS) developed an agent-based model that simulates pedestrian and vehicular evacuation to assess tsunami risk and risk reduction interventions in Southeast Asia. EOS applied this model to analyze the effectiveness in Padang of TEPs over other tsunami risk management approaches in terms of evacuation times and the number of people saved. The model shows that only ~24,000 people (20% of the total population) in the northern part of Padang can reach safe ground within 30 minutes, if people evacuate using cars and

Photo release of nitrous oxide from the hyponitrite ion studied by infrared spectroscopy. Evidence for the generation of a cobalt-N2O complex. Experimental and DFT calculations.

Science.gov (United States)

Chacón Villalba, M Elizabeth; Franca, Carlos A; Güida, Jorge A

2017-04-05

The solid state photolysis of sodium, silver and thallium hyponitrite (M 2 N 2 O 2 , M=Na, Ag, Tl) salts and a binuclear complex of cobalt bridged by hyponitrite ([Co(NH 3 ) 5 -N(O)-NO-Co(NH 3 ) 5 ] 4+ ) were studied by irradiation with visible and UV light in the electronic absorption region. The UV-visible spectra for free hyponitrite ion and binuclear complex of cobalt were interpreted in terms of Density Functional Theory calculations in order to explain photolysis behavior. The photolysis of each compound depends selectively on the irradiation wavelength. Irradiation with 340-460nm light and with the 488nm laser line generates photolysis only in silver and thallium hyponitrite salts, while 253.7nm light photolyzed all the studied compounds. Infrared spectroscopy was used to follow the photolysis process and to identify the generated products. Remarkably, gaseous N 2 O was detected after photolysis in the infrared spectra of sodium, silver, and thallium hyponitrite KBr pellets. The spectra for [Co(NH 3 ) 5 -N(O)-NO-Co(NH 3 ) 5 ] 4+ suggest that one cobalt ion remains bonded to N 2 O from which the generation of a [(NH 3 ) 5 CoNNO] +3 complex is inferred. Density Functional Theory (DFT) based calculations confirm the stability of this last complex and provide the theoretical data which are used in the interpretation of the electronic spectra of the hyponitrite ion and the cobalt binuclear complex and thus in the elucidation of their photolysis behavior. Carbonate ion is also detected after photolysis in all studied compounds, presumably due to the reaction of atmospheric CO 2 with the microcrystal surface reaction products. Kinetic measurements for the photolysis of the binuclear complex suggest a first order law for the intensity decay of the hyponitrite IR bands and for the intensity increase in the N 2 O generation. Predicted and experimental data are in very good agreement. Copyright © 2017 Elsevier B.V. All rights reserved.

Single site and conventional totally extraperitoneal techniques for uncomplicated inguinal hernia repair: A comparative study.

Science.gov (United States)

de Araújo, Felipe Brandão Corrêa; Starling, Eduardo Simão; Maricevich, Marco; Tobias-Machado, Marcos

2014-10-01

To demonstrate the feasibility of endoscopic extraperitoneal single site (EESS) inguinal hernia repair and compare it outcomes with the conventional totally extraperitoneal (TEP) technique. TEP inguinal hernia repair is a widely accepted alternative to conventional open technique with several perioperative advantages. Transumbilical laparoendoscopic singlesite surgery (LESS) is an emerging approach and has been reported for a number of surgical procedures with superior aesthetic results but other advantages need to be proven. Thirty-eight uncomplicated inguinal hernias were repaired by EESS approach between January 2010 and January 2011. All procedures were performed through a 25 cm infraumbilical incision using the Alexis wound retractor attached to a surgical glove and three trocars. Body mass index, age, operative time, blood loss, complications, conversion rate, analgesia requirement, hospital stay, return to normal activities and patient satisfaction with aesthetic results were analysed and compared with the last 38 matched-pair group of patients who underwent a conventional TEP inguinal hernia repair by the same surgeon. All procedures were performed successfully with no conversion. In both unilateral and bilateral EESS inguinal repairs, the mean operative time was longer than conventional TEP (55± 20 vs. 40± 15 min, P = 0.049 and 70± 15 vs. 55± 10 min, P = 0.014). Aesthetic result was superior in the EESS group (2.88± 0.43 vs. 2.79± 0.51, P = 0.042). There was no difference between the two approaches regarding blood loss, complications, hospital stay, time until returns to normal activities and analgesic requirement. EESS inguinal hernia repair is safe and effective, with superior cosmetic results in the treatment of uncomplicated inguinal hernias. Other advantages of this new technique still need to be proven.

Colossal thermoelectric power in charge ordered lanthanum calcium manganites (La{sub 0.5}Ca{sub 0.5}MnO{sub 3})

Energy Technology Data Exchange (ETDEWEB)

Joy, Lija K.; Anantharaman, M. R., E-mail: mraiyer@yahoo.com [Department of Physics, Cochin University of Science and Technology, Cochin 682022 (India); Shanmukharao Samatham, S.; Ganesan, V. [Low temperature division, UGC-DAE Consortium for Scientific Research, Indore (India); Thomas, Senoy [Material Science and Technology Division, National Institute for Interdisciplinary Science and Technology, Thiruvananthapuram–695019 (India); Al-Harthi, Salim [Department of Physics, Sultan Qaboos University, Muscat PC 123, Sultanate of Oman (Oman); Liebig, A.; Albrecht, M. [Institute of Physics, University of Augsburg, Augsburg 86135 (Germany)

2014-12-07

Lanthanum calcium manganites (La{sub 0.5}Ca{sub 0.5}MnO{sub 3}) with a composition close to charge ordering, synthesized by high energy ball milling, was found to exhibit colossal thermoelectric power. Thermoelectric power (TEP) data was systematically analyzed by dividing the entire temperature range (5 K–300 K) into three different regimes to explore different scattering mechanisms involved. Mandal's model has been applied to explain TEP data in the region below the Curie temperature (T{sub C}). It has been found that the variation of thermoelectric power with temperature is pronounced when the system enters the charge ordered region at T < 200 K. For temperatures lower than 120 K, due to the co-existence of charge ordered state with a spin-glass state, the variation of thermoelectric power is maximum and exhibited a peak value of −80 mV/K at 58 K. This has been explained by incorporating Kondo properties of the spin-glass along with magnon scattering. FC-ZFC magnetization measurements indicate the existence of a glassy state in the region corresponding to a maximum value of thermoelectric power. Phonon drag contribution instead of spin-glass contribution is taken into account to explain TEP in the region 120 K < T < T{sub C}. Mott's polaronic contribution of charge carriers are considered to interpret TEP in the high temperature region (T > T{sub C}). The optimal Mn{sup 4+}-Mn{sup 3+} concentration in charge ordered La{sub 0.5}Ca{sub 0.5}MnO{sub 3} was examined by X-ray Photoelectron Spectroscopy analysis which confirms the charge ordered nature of this compound.

Determination of aluminium nitride or free nitrogen in low carbon steel

International Nuclear Information System (INIS)

Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.

2001-01-01

As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by

UV and condensation technology for applications in the UOG for removal of air contaminants

Energy Technology Data Exchange (ETDEWEB)

De Visscher, A.; Langford, C.H. [Calgary Univ., AB (Canada)

2008-07-01

Canadian emissions of volatile organic compounds (VOC) are significant. In 2006, the upstream oil and gas (UOG) industry in Canada emitted over 500,000 tonnes of volatile organic compounds per year. 2002 benzene emissions from glycol dehydration units in Canada were estimated at 1,988 tonnes. These emissions are from a large number of sources typically emitting a few tonnes per year. Although condensation systems can reduce emissions, they leave residual emissions. New technologies to reduce emissions would have to be fairly inexpensive and simple given the large number of sources. This presentation addressed two research questions, notably how to predict condensation unit efficiency; and the feasibility of photolysis in UOG waste gas treatment, including glycol dehydration emissions. The presentation discussed the objectives of the study, which were to develop capability to predict efficiencies of condensation units; to develop proof-of-concept of effective ultraviolet technology for treating benzene and other VOCs from upstream oil and gas; and to test the technique for hydrogen sulphide. The presentation discussed the prediction of benzene condensation including the problem, hypothesis, and proposed approach. An introduction to photolysis was also provided. Some chemical reactions of benzene photolysis were demonstrated. Several illustrations were used to show a benzene photolysis reactor; a photocatalytic alternative; and a radiation field simulation model. It was concluded that a predictive model for efficiency of condensation for benzene emission reduction from glycol dehydration units will be developed accounting for non-steady behaviour. 4 figs.

A search for transit timing variation

Directory of Open Access Journals (Sweden)

Kramm U.

2011-02-01

Full Text Available Photometric follow-ups of transiting exoplanets (TEPs may lead to discoveries of additional, less massive bodies in extrasolar systems. This is possible by detecting and then analysing variations in transit timing of transiting exoplanets. In 2009 we launched an international observing campaign, the aim of which is to detect and characterise signals of transit timing variation (TTV in selected TEPs. The programme is realised by collecting data from 0.6-2.2-m telescopes spread worldwide at different longitudes. We present our observing strategy and summarise first results for WASP-3b with evidence for a 15 Earth-mass perturber in an outer 2:1 orbital resonance.

Carbenes and Nitrenes: Recent Developments in Fundamental Chemistry.

Science.gov (United States)

Wentrup, Curt

2018-05-29

There has been significant progress in the direct observation of carbenes, nitrenes, and many other reactive intermediates in recent years due to the application of matrix photolysis and flash vacuum pyrolysis linked with matrix isolation at cryogenic temperatures. Our understanding of singlet and triplet states has improved through the interplay of spectroscopy and computations. Bistable carbenes and nitrenes as well as many examples of tunneling have been discovered. Numerous rearrangements and fragmentations have been documented. This minireview aims to give an overview of some of these developments but will not generally cover laser flash photolysis and chemical reactions in liquid solution. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

78 FR 74825 - Medicare and Medicaid Programs: Hospital Outpatient Prospective Payment and Ambulatory Surgical...

Science.gov (United States)

2013-12-10

... site to view public comments. Comments received timely will also be available for public inspection... Radiosurgery TEP Technical Expert Panel TMS Transcranial Magnetic Stimulation Therapy TOPs Transitional...

The invasive snowflake coral (Carijoa riisei in the Tropical Eastern Pacific, Colombia

Directory of Open Access Journals (Sweden)

Juan Armando Sánchez

2014-02-01

Full Text Available Carijoa riisei (Octocorallia: Cnidaria, a western Atlantic species, has been reported in the Pacific as an invasive species for nearly forty years. C. riisei has been recently observed overgrowing native octocorals at several rocky-coral littorals in the Colombian Tropical Eastern Pacific-(TEP. C. riisei has inhabited these reefs for at least 15 years but the aggressive overgrowth on other octocorals have been noted until recently. Here, we surveyed for the first time the distribution and inter-specific aggression by C. riisei in both coastal and oceanic areas colonized in the Colombian TEP (Malpelo, Gorgona and Cabo Corrientes, including preliminary multiyear surveys during 2007-2013. We observed community-wide octocoral mortalities (including local extinction of some Muricea spp. and a steady occurrence of competing and overgrowing Pacifigorgia seafans and Leptogorgia seawhips. In Gorgona Island, at two different sites, over 87% (n=77 tagged colonies of octocorals (Pacifigorgia spp. and Leptogorgia alba died as a result of C. riisei interaction and/or overgrowth between 2011 and 2013. C. riisei overgrows octocorals with an estimate at linear growth rate of about 1cm m-1. The aggressive overgrowth of this species in TEP deserves more attention and regular monitoring programs. Rev. Biol. Trop. 62 (Suppl. 1: 199-207. Epub 2014 February 01.

Is the phototransformation of pharmaceuticals a natural purification process that decreases ecological and human health risks?

International Nuclear Information System (INIS)

Wang, Xiao-Huan; Lin, Angela Yu-Chen

2014-01-01

Sunlight photodegradation has long been considered a significant process in lowering the concentrations of pharmaceuticals in surface waters and thus decreasing the ecological risk. For the first time, this study identified the significance of investigating the environmental photodegradation of a pharmaceutical residue mixture (rather than a single compound) and the associated toxicity of transformation byproducts in environmental waters, including rivers, hospital wastewaters, and effluents from wastewater treatment plants and pharmaceutical production facilities. Pharmaceuticals undergo phototransformation rather than mineralization (11–23% in 34 h). Pharmaceutical mixtures could possibly act as dissolved organic matter for each individual compound and subsequently affect the photolysis rates. The increased toxicity of irradiated pharmaceutical mixtures challenges the validity of the current understanding of sunlight photolysis. The implications of this work suggest that current knowledge concerning the occurrence, natural attenuation, ecotoxicity, and human health risks of pharmaceuticals is far from complete; photolysis is not necessarily a purification process. -- Highlights: • Pharmaceutical mixtures could possibly act as DOMs for each other. • Pharmaceuticals underwent merely phototransformation rather than mineralization. • Increased toxicity from photo byproducts associated with the pharmaceutical mixture. • Phototransformation does not necessary mitigate the risk to human and the ecosystem. -- Transformation byproducts associated with a pharmaceutical mixture could be more toxic, and phototransformation does not necessary mitigate the risk to humans and the ecosystem

A radiative transfer module for calculating photolysis rates and solar heating in climate models: Solar-J v7.5

Science.gov (United States)

Hsu, Juno; Prather, Michael J.; Cameron-Smith, Philip; Veidenbaum, Alex; Nicolau, Alex

2017-07-01

Solar-J is a comprehensive radiative transfer model for the solar spectrum that addresses the needs of both solar heating and photochemistry in Earth system models. Solar-J is a spectral extension of Cloud-J, a standard in many chemical models that calculates photolysis rates in the 0.18-0.8 µm region. The Cloud-J core consists of an eight-stream scattering, plane-parallel radiative transfer solver with corrections for sphericity. Cloud-J uses cloud quadrature to accurately average over correlated cloud layers. It uses the scattering phase function of aerosols and clouds expanded to eighth order and thus avoids isotropic-equivalent approximations prevalent in most solar heating codes. The spectral extension from 0.8 to 12 µm enables calculation of both scattered and absorbed sunlight and thus aerosol direct radiative effects and heating rates throughout the Earth's atmosphere.The Solar-J extension adopts the correlated-k gas absorption bins, primarily water vapor, from the shortwave Rapid Radiative Transfer Model for general circulation model (GCM) applications (RRTMG-SW). Solar-J successfully matches RRTMG-SW's tropospheric heating profile in a clear-sky, aerosol-free, tropical atmosphere. We compare both codes in cloudy atmospheres with a liquid-water stratus cloud and an ice-crystal cirrus cloud. For the stratus cloud, both models use the same physical properties, and we find a systematic low bias of about 3 % in planetary albedo across all solar zenith angles caused by RRTMG-SW's two-stream scattering. Discrepancies with the cirrus cloud using any of RRTMG-SW's three different parameterizations are as large as about 20-40 % depending on the solar zenith angles and occur throughout the atmosphere.Effectively, Solar-J has combined the best components of RRTMG-SW and Cloud-J to build a high-fidelity module for the scattering and absorption of sunlight in the Earth's atmosphere, for which the three major components - wavelength integration, scattering, and

Solar-TEP - Development of materials for thermo-electric power generators; SOLAR-TEP - Materialentwicklung fuer solarthermoelektrische Stromerzeuger - Schlussbericht 2008

Energy Technology Data Exchange (ETDEWEB)

Robert, R.; Weidenkaff, A.

2008-06-15

This final report for the Swiss Federal Office of Energy (SFOE) reports on the development of materials for thermo-electric power generators. Cobaltate phases are discussed as being suitable materials for thermoelectric applications at high temperatures. These potential thermoelectric materials are characterised with respect to their crystal structure, microstructure, composition, and thermal stability. The Seebeck coefficient, thermal conductivity and electrical resistivity of polycrystalline cobaltates with perovskite-type and layered-cobaltite structure are evaluated for a wide temperature range. The large Seebeck coefficient exhibited by both perovskite-type and layered cobaltite phases is analysed using the Heikes formula. The work is illustrated with results obtained for various materials in graphical form.

Primary photochemical processes for Pt(iv) diazido complexes prospective in photodynamic therapy of tumors.

Science.gov (United States)

Shushakov, Anton A; Pozdnyakov, Ivan P; Grivin, Vjacheslav P; Plyusnin, Victor F; Vasilchenko, Danila B; Zadesenets, Andrei V; Melnikov, Alexei A; Chekalin, Sergey V; Glebov, Evgeni M

2017-07-25

Diazide diamino complexes of Pt(iv) are considered as prospective prodrugs in oxygen-free photodynamic therapy (PDT). Primary photophysical and photochemical processes for cis,trans,cis-[Pt(N 3 ) 2 (OH) 2 (NH 3 ) 2 ] and trans,trans,trans-[Pt(N 3 ) 2 (OH) 2 (NH 3 ) 2 ] complexes were studied by means of stationary photolysis, nanosecond laser flash photolysis and ultrafast kinetic spectroscopy. The process of photolysis is multistage. The first stage is the photosubstitution of an azide ligand to a water molecule. This process was shown to be a chain reaction involving redox stages. Pt(iv) and Pt(iii) intermediates responsible for the chain propagation were recorded using ultrafast kinetic spectroscopy and nanosecond laser flash photolysis. The mechanism of photosubstitution is proposed.

Combined heat and power in the Swedish district heating sector-impact of green certificates and CO2 trading on new investments

International Nuclear Information System (INIS)

Knutsson, David; Werner, Sven; Ahlgren, Erik O.

2006-01-01

Combined heat and power (CHP) has been identified by the EU administration as an important means of reducing CO 2 -emissions and increasing the energy efficiency. In Sweden, only about one third of the demand for district heat (DH) is supplied from CHP. This share could be significantly larger if the profitability of CHP generation increased. The objective of this study was to analyse the extent to which the profitability for investments in new CHP plants in the Swedish DH sector have changed thanks to the recently implemented trading schemes for green certificates (TGCs) and CO 2 emissions (TEPs). The analysis was carried out using a simulation model of the Swedish DH sector in which the profitability of CHP investments for all DH systems, with and without the two trading schemes applied, is compared. In addition, a comparison was made of the changes in CHP generation, CO 2 emissions, and operation costs if investments are made in the CHP plant shown to be most profitable in each system according to the model. The study shows that the profitability of investments in CHP plants increased significantly with the introductions of TGC and TEP schemes. If all DH utilities also undertook their most profitable CHP investments, the results indicate a major increase in power generation which, in turn, would reduce the CO 2 emissions from the European power sector by up to 13 Mton/year, assuming that coal condensing power is displaced

Lifetimes and reactivities of some 1,2-didehydroazepines commonly used in photoaffinity labeling experiments in aqueous solutions.

Science.gov (United States)

Rizk, Mary S; Shi, Xiaofeng; Platz, Matthew S

2006-01-17

The reactive 1,2-didehydroazepine (cyclic ketenimine) intermediates produced upon photolysis of phenyl azide, 3-hydroxyphenyl azide, 3-methoxyphenyl azide, and 3-nitrophenyl azide in water and in HEPES buffer were studied by laser flash photolysis techniques with UV-vis detection of the transient intermediates. The lifetimes of the 1,2-didehydroazepines were obtained along with the absolute rate constants of their reactions with typical amino acids, nucleosides, and other simple reagents present in a biochemical milieu. The nitro substituent greatly accelerates the bimolecular reactions of the cyclic ketenimines, and the 3-methoxy group greatly decelerates the absolute reactivity of 1,2-didehydroazepines. The intermediate produced by photolysis of 3-hydroxyphenyl azide is much more reactive than the intermediate produced by photolysis of 3-methoxyphenyl azide. We propose that the hydroxyl-substituted 1,2-didehydoazepines rapidly (ketenimines undergo hydrolysis. Azepinones react more rapidly with nucleophiles than do methoxy-substituted 1,2-didehydroazepines and are the active species present upon the photolysis of 3-hydroxyphenyl azide in aqueous solution.

Degradation of Paraquat in Gramoxone Pesticide with Addition of ZnO

Directory of Open Access Journals (Sweden)

Febrina Arfi

2017-11-01

Full Text Available Paraquat is the most toxic herbicide, the main agricultural crops and plantations that use them are cloves, cocoa, oil palm, rubber, coffee, and pepper. Therefore, it is necessary to study to degrade paraquat compounds by photolysis method with using ZnO. Photolysis is a process of UV irradiation with a wavelength of 200-400 nm. In this study Photolysis method used UV light with λ = 365 nm. Degradation of paraquat compound was done with the influence of variation of time without the addition ZnO, the influence of ZnO additional variations, and the effect of combination between variations of time and optimization of ZnO addition. The result of the study shows that photolysis degradation product without the addition of ZnO for 120 minutes has been degraded by 12.56%. While the optimum addition of 0.1 grams ZnO increased the percentage of degradation which is about 57.64%. This is proved that the addition of ZnO with photolysis method can degrade more paraquat compounds.

A study of the inhibiton of copper corrosion by triethyl phosphate and triphenyl phosphate self-assembled monolayers

Directory of Open Access Journals (Sweden)

HOUYI MA

2006-02-01

Full Text Available Two kinds of phosphates, triethyl phosphate (TEP and triphenyl phosphate (TPP, were used to form self-assembled monolayers for the inhibition of the corrosion of copper in 0.2 mol dm–3 NaCl solution. Electrochemical impedance spectroscopy (EIS was applied to investigate the inhibition effects. The results showed that their inhibition ability first increased with increasing immersion time in ethanolic solutions of the corresponding compounds. However, when the immersion time was increased over some critical point, the inhibition effect decreased. For the same immersion time, the inhibition effect of the TPP monolayer was more pronounced than that of the TEP monolayer. Thus, ab initio calculations were used to interpret the relationship between the inhibition effects and the structures of the compounds.

Advanced testing and validation centre gets electric vehicle technology to market faster

Energy Technology Data Exchange (ETDEWEB)

Astil, T.; Girard, F. [National Research Council of Canada, Vancouver, BC (Canada). Inst. for Fuel Cell Innovation

2010-07-01

The National Research Council (NRC) Institute for Fuel Cell Innovation is advancing Canada's clean energy advantage through NRC's technology cluster initiatives, which help Canadian small and medium enterprises achieve commercialization breakthroughs in key sectors. This presentation discussed the technology evaluation program (TEP) offered by the NRC Institute for Fuel Cell Innovation. The presentation discussed the TEPs mission, advanced testing and validation centre (ATVC), previous ATVC clients, environmental chamber, dynamometer, vibration table, electrochemical battery testing, and electrochemical testing laboratory. The ATVC is a specialized and safe environment for objective, reliable and accurate standardized testing applications of electric vehicle technologies. It offers independent test services to external organizations, making it easier to prove that electric vehicle technologies will perform under specific operating conditions. figs.

Quantitative Method for the Detection of Triethyl Phosphate in Aqueous Solutions

National Research Council Canada - National Science Library

Bagalawis, Rosa

2003-01-01

...) at the parts per million level in aqueous solution. TEP was used as a chemical agent simulant to evaluate the penetration characteristics of clothing, gloves, boots and items of personal equipment...

Single photon excimer laser photodissociation of highly vibrationally excited polyatomic molecules

International Nuclear Information System (INIS)

Tiee, J.J.; Wampler, F.B.; Rice, W.W.

1980-01-01

The ir + uv photodissociation of SF 6 has been performed using CO 2 and ArF lasers. The two-color photolysis significantly enhances the photodissociation process over ArF irradiation alone and is found to preserve the initial isotopic specificity of the ir excitation process

Application of nuclear activation analysis (NAA) and low-level gamma counting to determine the radionuclide and trace element pollutant releases from coal-fired power plants in Vietnam

International Nuclear Information System (INIS)

Vanduong, P.; Thanh, V.T.; Dien, P.Q.; Binh, N.T.

1995-01-01

Results are reported of the application of NAA using research reactors TRIGA II in Dalat, Vietnam, and Vienna, Austria (with pyrolysis separation for Hg, Se, and As before irradiation), to determine As, Cd, Cu, Hg, Ni, Co, Pb, Sn and Zn. Low-level gamma counting was used to measure Ra-226, Th-228 and K-40, released from coal-fired power plants in Vietnam. Results showed that: (1) the content of the air pollutants in the vicinity of the operating power plants (in 1991, the Phalai plant produced 1700 million kWh, and the Ninhbinh plant 100 million kWh) depends on the coal combustion which is used for their applied operation technology, both plants used Quangninh anthracite as fuel. The content of trace elements pollutants (TEP) in the environment of the Ninhbinh plant is higher than in the Phalai plant. (2) In the vicinity of both plants, rain water is highly polluted by trace elements such as As, Cu, Pb, Hg, Ni, Co, Cd, Se, U, Th and sulphuric acid. Therefore, this kind of water is not acceptable for human consumption. (3) The algae growing in the waterfield in the vicinity of the power plants can be used to monitor TEP. Four NAA methods, in combination with low-level gamma counting and AAS, can be successfully used to monitor TEP released from power plants

A novel strategy to improve protein secretion via overexpression of the SppA signal peptide peptidase in Bacillus licheniformis.

Science.gov (United States)

Cai, Dongbo; Wang, Hao; He, Penghui; Zhu, Chengjun; Wang, Qin; Wei, Xuetuan; Nomura, Christopher T; Chen, Shouwen

2017-04-24

Signal peptide peptidases play an important role in the removal of remnant signal peptides in the cell membrane, a critical step for extracellular protein production. Although these proteins are likely a central component for extracellular protein production, there has been a lack of research on whether protein secretion could be enhanced via overexpression of signal peptide peptidases. In this study, both nattokinase and α-amylase were employed as prototypical secreted target proteins to evaluate the function of putative signal peptide peptidases (SppA and TepA) in Bacillus licheniformis. We observed dramatic decreases in the concentrations of both target proteins (45 and 49%, respectively) in a sppA deficient strain, while the extracellular protein yields of nattokinase and α-amylase were increased by 30 and 67% respectively in a strain overexpressing SppA. In addition, biomass, specific enzyme activities and the relative gene transcriptional levels were also enhanced due to the overexpression of sppA, while altering the expression levels of tepA had no effect on the concentrations of the secreted target proteins. Our results confirm that SppA, but not TepA, plays an important functional role for protein secretion in B. licheniformis. Our results indicate that the sppA overexpression strain, B. licheniformis BL10GS, could be used as a promising host strain for the industrial production of heterologous secreted proteins.

DFT investigations of phosphotriesters hydrolysis in aqueous solution: a model for DNA single strand scission induced by N-nitrosoureas.

Science.gov (United States)

Liu, Tingting; Zhao, Lijiao; Zhong, Rugang

2013-02-01

DNA phosphotriester adducts are common alkylation products of DNA phosphodiester moiety induced by N-nitrosoureas. The 2-hydroxyethyl phosphotriester was reported to hydrolyze more rapidly than other alkyl phosphotriesters both in neutral and in alkaline conditions, which can cause DNA single strand scission. In this work, DFT calculations have been employed to map out the four lowest activation free-energy profiles for neutral and alkaline hydrolysis of triethyl phosphate (TEP) and diethyl 2-hydroxyethyl phosphate (DEHEP). All the hydrolysis pathways were illuminated to be stepwise involving an acyclic or cyclic phosphorane intermediate for TEP or DEHEP, respectively. The rate-limiting step for all the hydrolysis reactions was found to be the formation of phosphorane intermediate, with the exception of DEHEP hydrolysis in alkaline conditions that the decomposition process turned out to be the rate-limiting step, owing to the extraordinary low formation barrier of cyclic phosphorane intermediate catalyzed by hydroxide. The rate-limiting barriers obtained for the four reactions are all consistent with the available experimental information concerning the corresponding hydrolysis reactions of phosphotriesters. Our calculations performed on the phosphate triesters hydrolysis predict that the lower formation barriers of cyclic phosphorane intermediates compared to its acyclic counter-part should be the dominant factor governing the hydrolysis rate enhancement of DEHEP relative to TEP both in neutral and in alkaline conditions.

Non-mass-dependent fractionation of sulfur and oxygen isotopes during UV photolysis of sulfur dioxide

Science.gov (United States)

Pen, Aranh

Since the discovery of anomalous sulfur isotope abundance in the geological record in sulfate and sulfide minerals (Farquhar et al., 2000), much effort has been put into understanding their origin to provide new insights into the environmental conditions on the early Earth (Farquhar et al., 2001; Pavlov and Kasting, 2002; Ono et al., 2003; Zahnle et al., 2006; Farquhar et al., 2007; Lyons, 2007; Lyons, 2008). This discovery gained immense interest because of its implications for both the lack of oxygen in the atmosphere during the Archean era 2.5-3.8 Gya (billion years ago), and for rise of oxygen, or the "Great Oxidation Event", that occurred 2.2-2.4 Gya (Holland, 2002). These signatures are believed to be produced in an anticorrelation to oxygen abundance in the early atmosphere, which will aid in quantifying the rate of oxygenation during the "Great Oxidation Event". According to Farquhar et al. (2000), the non-mass-dependent (NMD), or anomalous, fractionation signatures were produced by photochemical reactions of volcanic sulfur species in Earth's early atmosphere (> 2.3 Gya) due to the lack of an oxygen and ozone shield, resulting in an atmosphere transparent to solar ultraviolet (UV) radiation (Farquhar et al., 2001). Interpretation of the anomalous rock records, though, depends on the identification of (1) chemical reactions that can produce the NMD signature (Farquhar and Wing, 2003); and (2) conditions necessary for conversion of the gas-phase products into solid minerals (Pavlov and Kasting, 2002). The focus of my research addresses the first step, which is to determine whether the chemical reactions that occurred in Earth's early atmosphere, resulting in NMD fractionation of sulfur isotopes, were due to broadband UV photochemistry, and to test isotopic self-shielding as the possible underlying mechanism. In this project, our goals were to test isotopic self-shielding during UV photolysis as a possible underlying mechanism for anomalous sulfur isotopic

Avaliação do ventrículo direito pelo ecocardiograma com doppler tecidual na embolia pulmonar aguda

Directory of Open Access Journals (Sweden)

Ana Clara Tude Rodrigues

2013-06-01

Full Text Available FUNDAMENTO: A avaliação da função Ventricular Direita (VD pelo ecocardiograma em pacientes com Tromboembolismo Pulmonar (TEP é complexa, frequentemente qualitativa; o Doppler tecidual tem sido utilizado para avaliação semiquantitativa dessa câmara, com algumas limitações. OBJETIVO: Avaliar a função do VD no TEP pelo ecocardiograma com Doppler tecidual, complementando com o peptídeo atrial natriurético (BNP. MÉTODOS: Foram estudados pacientes com TEP pelo ecocardiograma com Doppler tecidual e BNP até 24 horas do diagnóstico, obtendo-se as velocidades miocárdicas (s', strain, strain rate e índice de performance miocárdica do VD; disfunção do VD foi iagnosticada por hipocinesia da câmara, movimento anormal septal e relação VD/VE >1. De acordo com o BNP os pacientes foram divididos em Grupo I, BNP 50 pg/mL. RESULTADOS: De 118 pacientes, 100 (60 homens, idade = 55 ± 17 anos foram analisados; observou-se disfunção do VD em 28%, mais frequentemente no grupo II (19 vs. 9 pacientes, p < 0,001. O grupo II era mais idoso (64 ± 19 vs. 50 ± 15 anos, apresentava menor velocidade de s' (10,5 ± 3,5 vs. 13,2 ± 3,1 cm/s e maior pressão pulmonar (48 ± 11 vs. 35 ± 11 mmHg, p < 0,001 para todos. O ponto de corte de s' para disfunção do VD foi de 10,8 cm/s (especificidade = 85%, sensibilidade = 54%, com moderada correlação entre o BNP e a onda s'(r = -0,39. CONCLUSÃO: No TEP, a disfunção do VD pelo ecocardiograma se acompanha de elevação do BNP; apesar confirmar adequadamente a presença de disfunção do VD, o Doppler tecidual apresenta sensibilidade limitada para este diagnóstico.

Contribution of the modulation of intensity and the optimization to deliver a dose adapted to the biological heterogeneities

International Nuclear Information System (INIS)

Kubs, F.

2007-10-01

The recent progress in functional imaging by Positron Emission Tomography (TEP) opens new perspectives in the delineation of target volumes in radiotherapy. The functional data is major; we can intend to adapt the irradiation doses on the tumor activity (TA) and to perform a dose escalation. Our objectives were (i) to characterize the TEP threshold, by quantifying the uncertainties of the target volume contour according to the lesion size and the threshold contour level, (ii) to set up the geometry suited to perform a high-precision irradiation based on the TA, (iii) to estimate the dosimetric impact of this new protocol and (iv) to verify that dosimetry is perfectly distributed. Three original phantoms were specially created to satisfy the constraints met, as well as two virtual phantoms containing 3 dose levels (dose level 3 = TA). Our results showed the importance of the effect threshold-volume on the planning in radiotherapy. To use this irradiation method, the diameter of 1 cm for the third level was able to be reached. A dose escalation of 20 Gy was possible between the second (70 Gy) and the third level (90 Gy). The dosimetric impact estimated on two real cases was suitable - increase of COIN (conformal index) from 0.6 to 0.8 and decrease of NTCP (normal tissue complication probability) of a factor 5 -. In absolute and relative dosimetry, the clinical tolerances were respected. So all the treatment process, going from the diagnosis with the TEP to reveal the TA, to the patient treatment made beforehand on phantom, and going through the ballistic and the dose calculation, was estimated and validated according to our objective to adapt the irradiation to the biological heterogeneities. However such high doses should be carefully estimated before being prescribed clinically and progress is also expected in imaging, because the minimal size which we can irradiate is on the limit of the resolution TEP. (author)

Contribution of the modulation of intensity and the optimization to deliver a dose adapted to the biological heterogeneities; Apport de la modulation d'intensite et de l'optimisation pour delivrer une dose adaptee aux heterogeneites biologiques

Energy Technology Data Exchange (ETDEWEB)

Kubs, F

2007-10-15

The recent progress in functional imaging by Positron Emission Tomography (TEP) opens new perspectives in the delineation of target volumes in radiotherapy. The functional data is major; we can intend to adapt the irradiation doses on the tumor activity (TA) and to perform a dose escalation. Our objectives were (i) to characterize the TEP threshold, by quantifying the uncertainties of the target volume contour according to the lesion size and the threshold contour level, (ii) to set up the geometry suited to perform a high-precision irradiation based on the TA, (iii) to estimate the dosimetric impact of this new protocol and (iv) to verify that dosimetry is perfectly distributed. Three original phantoms were specially created to satisfy the constraints met, as well as two virtual phantoms containing 3 dose levels (dose level 3 = TA). Our results showed the importance of the effect threshold-volume on the planning in radiotherapy. To use this irradiation method, the diameter of 1 cm for the third level was able to be reached. A dose escalation of 20 Gy was possible between the second (70 Gy) and the third level (90 Gy). The dosimetric impact estimated on two real cases was suitable - increase of COIN (conformal index) from 0.6 to 0.8 and decrease of NTCP (normal tissue complication probability) of a factor 5 -. In absolute and relative dosimetry, the clinical tolerances were respected. So all the treatment process, going from the diagnosis with the TEP to reveal the TA, to the patient treatment made beforehand on phantom, and going through the ballistic and the dose calculation, was estimated and validated according to our objective to adapt the irradiation to the biological heterogeneities. However such high doses should be carefully estimated before being prescribed clinically and progress is also expected in imaging, because the minimal size which we can irradiate is on the limit of the resolution TEP. (author)

TMSEEG: A MATLAB-Based Graphical User Interface for Processing Electrophysiological Signals during Transcranial Magnetic Stimulation

Directory of Open Access Journals (Sweden)

Sravya Atluri

2016-10-01

Full Text Available Concurrent recording of electroencephalography (EEG during transcranial magnetic stimulation (TMS is an emerging and powerful tool for studying brain health and function. Despite a growing interest in adaptation of TMS-EEG across neuroscience disciplines, its wide-spread utility is limited by signal processing challenges. These challenges arise due to the nature of TMS and the sensitivity of EEG to artifacts that often mask TMS-evoked potentials (TEPs. With an increase in the complexity of data processing methods and a growing interest in multi-site data integration, analysis of TMS-EEG data requires the development of a standardized method to recover TEPs from various sources of artifacts. This paper introduces TMSEEG, an open-source MATLAB application comprised of multiple algorithms organized to facilitate a step-by-step procedure for TMS-EEG signal processing. Using a modular design and interactive GUIs, this toolbox aims to streamline TMS-EEG signal processing for both novice and experienced users. Specifically, TMSEEG provides (i targeted removal of TMS-induced and general EEG artifacts, (ii a step-by-step modular workflow with flexibility to modify existing algorithms and add customized algorithms, (iii a comprehensive display and quantification of artifacts, (iv quality control check points with visual feedback of TEPs throughout the data processing workflow, and (v capability to label and store a database of artifacts. In addition to these features, the software architecture of TMSEEG ensures minimal user effort in initial setup and configuration of parameters for each processing step. This is partly accomplished through a close integration with EEGLAB, a widely used open-source toolbox for EEG signal processing. In this paper we introduce TMSEEG, validate its features, and demonstrate its application in extracting TEPs across several single- and multi-pulse TMS protocols. As the first open-source GUI-based pipeline for TMS-EEG signal

Water supply as a constraint on transmission expansion planning in the Western interconnection

Science.gov (United States)

Tidwell, Vincent C.; Bailey, Michael; Zemlick, Katie M.; Moreland, Barbara D.

2016-12-01

Consideration of water supply in transmission expansion planning (TEP) provides a valuable means of managing impacts of thermoelectric generation on limited water resources. Toward this opportunity, thermoelectric water intensity factors and water supply availability (fresh and non-fresh sources) were incorporated into a recent TEP exercise conducted for the electric interconnection in the Western United States. The goal was to inform the placement of new thermoelectric generation so as to minimize issues related to water availability. Although freshwater availability is limited in the West, few instances across five TEP planning scenarios were encountered where water availability impacted the development of new generation. This unexpected result was related to planning decisions that favored the development of low water use generation that was geographically dispersed across the West. These planning decisions were not made because of their favorable influence on thermoelectric water demand; rather, on the basis of assumed future fuel and technology costs, policy drivers and the topology of electricity demand. Results also projected that interconnection-wide thermoelectric water consumption would increase by 31% under the business-as-usual case, while consumption would decrease by 42% under a scenario assuming a low-carbon future. Except in a few instances, new thermoelectric water consumption could be accommodated with less than 10% of the local available water supply; however, limited freshwater supplies and state-level policies could increase use of non-fresh water sources for new thermoelectric generation. Results could have been considerably different if scenarios favoring higher-intensity water use generation technology or potential impacts of climate change had been explored. Conduct of this exercise highlighted the importance of integrating water into all phases of TEP, particularly joint management of decisions that are both directly (e.g., water

Predominant constitutive CFTR conductance in small airways

Directory of Open Access Journals (Sweden)

Lytle Christian

2005-01-01

Full Text Available Abstract Background The pathological hallmarks of chronic obstructive pulmonary disease (COPD are inflammation of the small airways (bronchiolitis and destruction of lung parenchyma (emphysema. These forms of disease arise from chronic prolonged infections, which are usually never present in the normal lung. Despite the fact that primary hygiene and defense of the airways presumably requires a well controlled fluid environment on the surface of the bronchiolar airway, very little is known of the fluid and electrolyte transport properties of airways of less than a few mm diameter. Methods We introduce a novel approach to examine some of these properties in a preparation of minimally traumatized porcine bronchioles of about 1 mm diameter by microperfusing the intact bronchiole. Results In bilateral isotonic NaCl Ringer solutions, the spontaneous transepithelial potential (TEP; lumen to bath of the bronchiole was small (mean ± sem: -3 ± 1 mV; n = 25, but when gluconate replaced luminal Cl-, the bionic Cl- diffusion potentials (-58 ± 3 mV; n = 25 were as large as -90 mV. TEP diffusion potentials from 2:1 NaCl dilution showed that epithelial Cl- permeability was at least 5 times greater than Na+ permeability. The anion selectivity sequence was similar to that of CFTR. The bionic TEP became more electronegative with stimulation by luminal forskolin (5 μM+IBMX (100 μM, ATP (100 μM, or adenosine (100 μM, but not by ionomycin. The TEP was partially inhibited by NPPB (100 μM, GlyH-101* (5–50 μM, and CFTRInh-172* (5 μM. RT-PCR gave identifying products for CFTR, α-, β-, and γ-ENaC and NKCC1. Antibodies to CFTR localized specifically to the epithelial cells lining the lumen of the small airways. Conclusion These results indicate that the small airway of the pig is characterized by a constitutively active Cl- conductance that is most likely due to CFTR.

A comparison of the resistance of Temporary Edge Protection Systems to static and dynamic loads

Directory of Open Access Journals (Sweden)

González, M. N.

2015-06-01

Full Text Available Temporary Edge Protection Systems (TEPS are designed to withstand the impact of a worker that walks, stumbles, and falls against them. This is by nature a dynamic action; however, many standards evaluate TEPS when the surface or slope is slightly inclined (less than 10°, applying static requirements. The performance requirements demanded by these standards are assumed to be equivalent to the impact of a worker, however this point has not been tested. In this study, TEPS with tubular steel guardrails and wooden boards of different quality under two types of loads are evaluated using the static requirements detailed in standard EN 13374. TEPS are subjected to an impact energy of 180 J, simulating a worker of 90 kg walking at a speed of 2 m/s. The results demonstrate that the static requirements of EN 13374 are more demanding than the impact of 180 J in all the systems under study.Los sistemas provisionales de protección de borde (SPPB están diseñados para detener el impacto de un trabajador que camina, tropieza y golpea contra ellas. Esto supone una acción de naturaleza dinámica. Sin embargo, muchas normas evalúan SPPB utilizando requisitos de tipo estático cuando la superficie de trabajo está poco inclinada (menos de 10° suponiendo que equivalen al impacto de un trabajador. No obstante, este aspecto no se ha confirmado experimentalmente. En este trabajo SPPB con barandillas de tubos de acero y de tablas de madera se han evaluado usando los requisitos estáticos definidos por la norma EN 13374. Posteriormente, se han sometido a una energía de impacto de 180 J, que simula a un trabajador de 90 kg caminando a una velocidad de 2 m/s. Los resultados demuestran que los requisitos estáticos de la norma EN 13374 son más exigentes que el impacto de 180 J en todos los sistemas estudiados.

Insights into the photochemical transformation pathways of triclosan and 2′-HO-BDE-28

Energy Technology Data Exchange (ETDEWEB)

Zhang, Ya-nan; Xie, Qing; Chen, Jingwen, E-mail: jwchen@dlut.edu.cn; Li, Yingjie; Fu, Zhiqiang

2015-12-30

Highlights: • Direct photolysis of anionic HO-PXDEs occurs through excited singlet states. • Dioxin products are formed from excited singlet states of HO-PXDEs. • Self-sensitized photolysis is involved in the phototransformation of HO-PXDEs. • {sup 1} O{sub 2} and ·OH can be generated in energy or electron transfer reactions between excited HO-PXDEs and dissolved O{sub 2}. - Abstract: Hydroxylated polyhalogenated diphenyl ethers (HO-PXDEs) have been recognized as a group of widely detected emerging contaminants in natural waters. Photolysis was proved to be an important transformation pathway for these compounds and their direct phototransformation results in highly toxic dioxins. However, the roles of excited states and reactive oxygen species in the photochemical transformation of these compounds are still unclear. In this study, 2′-HO-2,4,4′-trichlorodiphenyl ether (triclosan) and 2′-HO-2,4,4′-tribromodiphenyl ether (2′-HO-BDE-28) were selected as model compounds to investigate their phototransformation processes. Results showed that the direct photolysis reactions of both triclosan and 2′-HO-BDE-28 occurred via their respective excited singlet states, leading to the generation of dioxins. In addition, the energy and electron transfer reactions between excited states of model compounds and molecular O{sub 2} can lead to the generation of {sup 1}O{sub 2} and ·OH, which results in self-sensitized photolysis. We also found that both the k, Φ dioxin yield for anionic triclosan were higher than those of anionic 2′-HO-BDE-28. This study revealed the roles of the excited states in direct photolysis and the generation pathway of reactive oxygen species in self-sensitized photolysis of HO-PXDEs, which is important for understanding the phototransformation mechanisms of HO-PXDEs.

Transformations of dissolved organic matter induced by UV photolysis, Hydroxyl radicals, chlorine radicals, and sulfate radicals in aqueous-phase UV-Based advanced oxidation processes.

Science.gov (United States)

Varanasi, Lathika; Coscarelli, Erica; Khaksari, Maryam; Mazzoleni, Lynn R; Minakata, Daisuke

2018-05-15

Considering the increasing identification of trace organic contaminants in natural aquatic environments, the removal of trace organic contaminants from water or wastewater discharge is an urgent task. Ultraviolet (UV) and UV-based advanced oxidation processes (AOPs), such as UV/hydrogen peroxide (UV/H 2 O 2 ), UV/free chlorine and UV/persulfate, are attractive and promising approaches for the removal of these contaminants due to the high reactivity of active radical species produced in these UV-AOPs with a wide variety of organic contaminants. However, the removal efficiency of trace contaminants is greatly affected by the presence of background dissolved organic matter (DOM). In this study, we use ultrahigh resolution mass spectrometry to evaluate the transformation of a standard Suwanee River fulvic acid DOM isolate in UV photolysis and UV-AOPs. The use of probe compounds allows for the determination of the steady-state concentrations of active radical species in each UV-AOP. The changes in the H/C and O/C elemental ratios, double bond equivalents, and the low-molecular-weight transformation product concentrations of organic acids reveal that different DOM transformation patterns are induced by each UV-AOP. By comparison with the known reactivities of each radical species with specific organic compounds, we mechanistically and systematically elucidate the molecular-level DOM transformation pathways induced by hydroxyl, chlorine, and sulfate radicals in UV-AOPs. We find that there is a distinct transformation in the aliphatic components of DOM due to HO• in UV/H 2 O 2 and UV/free chlorine. Cl• induced transformation of olefinic species is also observed in the UV/free chlorine system. Transformation of aromatic and olefinic moieties by SO 4 •- are the predominant pathways in the UV/persulfate system. Copyright © 2018 Elsevier Ltd. All rights reserved.

Product channels in the 193-nm photodissociation of HCNO (fulminic acid)

Energy Technology Data Exchange (ETDEWEB)

Feng, Wenhui; Hershberger, John F., E-mail: john.hershberger@ndsu.edu

2016-06-15

IR diode laser spectroscopy was used to detect the products of HCNO (fulminic acid) photolysis at 193 nm. Six product channels are energetically possible at this photolysis wavelength: O + HCN, H + NCO/CNO, CN + OH, CO + NH, NO + CH and HNCO. In some experiments, isotopically labeled {sup 15}N{sup 18}O, C{sub 2}D{sub 6} or C{sub 6}H{sub 12} reagents were included into the photolysis mixture in order to suppress and/or redirect possible secondary reactions. HCN, OC{sup 18}O, {sup 15}N{sup 15}NO, CO, DCN and HNCO molecules were detected upon laser photolysis of HCNO/reagents/buffer gas mixtures. Analysis of the yields of product molecules leads to the following photolysis quantum yields: ϕ{sub 1a} (O + HCN) = 0.38 ± 0.04, ϕ{sub 1b} (H + (NCO)) = 0.07 ± 0.02, ϕ{sub 1c} (CN + OH) = 0.24 ± 0.03, ϕ{sub 1d} (CO + NH(a{sup 1}Δ)) < 0.22 ± 0.1, ϕ{sub 1e} (HNCO) = 0.02 ± 0.01 and ϕ{sub 1f} (CH + NO) = 0.21 ± 0.1, respectively.

Click It or Ticket Evaluation, 2010

Science.gov (United States)

2013-05-01

The 201 Click It or Ticket (CIOT) mobilization followed a typical elective traffic enforcement program TEP) sequence, involving paid media, earned media, and enforcement. A nationally representative telephone survey indicated that the mobilization wa...

A radiative transfer module for calculating photolysis rates and solar heating in climate models: Solar-J v7.5

Directory of Open Access Journals (Sweden)

J. Hsu

2017-07-01

Full Text Available Solar-J is a comprehensive radiative transfer model for the solar spectrum that addresses the needs of both solar heating and photochemistry in Earth system models. Solar-J is a spectral extension of Cloud-J, a standard in many chemical models that calculates photolysis rates in the 0.18–0.8 µm region. The Cloud-J core consists of an eight-stream scattering, plane-parallel radiative transfer solver with corrections for sphericity. Cloud-J uses cloud quadrature to accurately average over correlated cloud layers. It uses the scattering phase function of aerosols and clouds expanded to eighth order and thus avoids isotropic-equivalent approximations prevalent in most solar heating codes. The spectral extension from 0.8 to 12 µm enables calculation of both scattered and absorbed sunlight and thus aerosol direct radiative effects and heating rates throughout the Earth's atmosphere.The Solar-J extension adopts the correlated-k gas absorption bins, primarily water vapor, from the shortwave Rapid Radiative Transfer Model for general circulation model (GCM applications (RRTMG-SW. Solar-J successfully matches RRTMG-SW's tropospheric heating profile in a clear-sky, aerosol-free, tropical atmosphere. We compare both codes in cloudy atmospheres with a liquid-water stratus cloud and an ice-crystal cirrus cloud. For the stratus cloud, both models use the same physical properties, and we find a systematic low bias of about 3 % in planetary albedo across all solar zenith angles caused by RRTMG-SW's two-stream scattering. Discrepancies with the cirrus cloud using any of RRTMG-SW's three different parameterizations are as large as about 20–40 % depending on the solar zenith angles and occur throughout the atmosphere.Effectively, Solar-J has combined the best components of RRTMG-SW and Cloud-J to build a high-fidelity module for the scattering and absorption of sunlight in the Earth's atmosphere, for which the three major components – wavelength

Test and evaluation of the Navy half-watt RTG

International Nuclear Information System (INIS)

Rosell, F.E. Jr.; Eggers, P.E.; Gawthrop, W.E.; Rouklove, P.G.; Truscello, V.C.

1976-01-01

In the autumn of 1975 the Navy took delivery of eight small-sized, plutonium-fueled radioisotope thermoelectric generators (RTGs) from four contractors (each contractor provided two RTGs). The purpose of these demonstration models is to prove conclusively that it is possible with state-of-the-art technology and materials to produce a super-battery with a 15-year life for use in the form of distributed power sources for remote undersea applications. It is easy to determine the RTG's beginning-of-life performance by actual measurements, but to forecast accurately its end-of-life performance requires rigorous determination of its reliability. This article discusses the test and evaluation program (TEP) used and the results obtained in determining that reliability. The TEP is divided into three general areas: mechanical-electrical, thermochemical-physical, and thermoelectric

R and D of tritium technology for fusion in CAEP: progress and prospect

International Nuclear Information System (INIS)

Jiangfeng, Song; Daqiao, Meng; Rong, Li; Zhiyong, Huang; Guoqiang, Huang; Chang-an, Chen; Xiaojun, Deng; Cheng, Qin; Xiaojing, Qian; Guikai, Zhang

2015-01-01

China has decided to develop its own fusion engineering test reactor and has also joined ITER. Tritium plant is one of the key systems of fusion system. Programs supposed by China ministry of Science and technology named 'Conceptual design and key technologies research on TBM tritium system' and 'Conceptual design and key technologies research on tritium plant for fusion reactor' were finished in 2013 and 2014. After several years of research, we have finished the design of TBM tritium system, TEP, SDS, WDS, ISS and tritium safety system. The key technologies such as TES, CPS, hydrogen storage materials for SDS, catalysts for WDS, palladium alloy membranes for TEP are under research. In this paper, the progress and prospect of tritium technology for R and D of fusion is introduced. (author)

Authoritarian Parenting and Asian Adolescent School Performance: Insights from the US and Taiwan.

Science.gov (United States)

Pong, Suet-Ling; Johnston, Jamie; Chen, Vivien

2010-01-01

Our study re-examines the relationship between parenting and school performance among Asian students. We use two sources of data: wave I of the Adolescent Health Longitudinal Survey (Add Health), and waves I and II of the Taiwan Educational Panel Survey (TEPS). Analysis using Add Health reveals that the Asian-American/European-American difference in the parenting-school performance relationship is due largely to differential sample sizes. When we select a random sample of European-American students comparable to the sample size of Asian-American students, authoritarian parenting also shows no effect for European-American students. Furthermore, analysis of TEPS shows that authoritarian parenting is negatively associated with children's school achievement, while authoritative parenting is positively associated. This result for Taiwanese Chinese students is similar to previous results for European-American students in the US.

Organic Carbon Reduction in Seawater Reverse Osmosis (SWRO) Plants, Jeddah, Saudi Arabia

KAUST Repository

Alshahri, Abdullah

2015-01-01

intake systems and pre-treatment stages in minimizing the concentrations of algae, bacteria, natural organic matter (NOM) and transparent exopolymer particles (TEP), in the feed water prior to pre-treatment, through the pre-treatment stages

Mini MAX - Medicaid Sample

Data.gov (United States)

U.S. Department of Health & Human Services — To facilitate wider use of MAX, CMS contracted with Mathematica to convene a technical expert panel (TEP) and determine the feasibility of creating a sample file for...

Picosecond transient absorption study of photodissociated carboxy hemoglobin and myoglobin

International Nuclear Information System (INIS)

Janes, S.M.; Dalickas, G.A.; Eaton, W.A.; Hochstrasser, R.M.

1988-01-01

The optical transient absorption spectra at 30 ps and 6.5 ns after photolysis are compared for both carboxy hemoglobin (HbCO) and carboxy myoglobin (MbCO). Both 355- and 532-nm excitation pulses were used. In all cases the shapes of the optical difference spectra thus generated are stationary over the complete time-scale studied. The photolysis spectra for MbCO are not significantly different from the equilibrium difference spectra generated on the same picosecond spectrometer when measured to an accuracy of +/- 0.5 nm. In addition, spectral parameters for delegated HbCO generated on the same spectrometer but detected by two different techniques, either by a Vidicon detector or point by point with photomultiplier tubes, are reported; the results are different from some of the previously reported picosecond experiments

Photochemical transformation of phenylurea herbicides in surface waters: a model assessment of persistence, and implications for the possible generation of hazardous intermediates.

Science.gov (United States)

Fabbri, Debora; Minella, Marco; Maurino, Valter; Minero, Claudio; Vione, Davide

2015-01-01

This work models the phototransformation kinetics in surface waters of five phenylurea herbicides (diuron, fenuron, isoproturon, metoxuron and chlortoluron), for which important photochemical parameters are available in the literature (direct photolysis quantum yields and reaction rate constants with ·OH, CO3(-·) and the triplet states of chromophoric dissolved organic matter, (3)CDOM*). Model calculations suggest that isoproturon and metoxuron would be the least photochemically persistent and diuron the most persistent compound. Reactions with ·OH and (3)CDOM* would be the main phototransformation pathways for all compounds in the majority of environmental conditions. Reaction with CO3(-) could be important in waters with low dissolved organic carbon (DOC), while direct photolysis would be negligible for fenuron, quite important for chlortoluron, and somewhat significant for the other compounds. The direct photolysis of metoxuron and diuron is known to increase toxicity, and such a photoreaction pathway would be enhanced at intermediate DOC values (1-4 mg C L(1)). The reaction between phenylureas and ·OH is known to produce toxic intermediates, differently from (3)CDOM*. Therefore, the shift of reactivity from ·OH to (3)CDOM* with increasing DOC could reduce the environmental impact of photochemical transformation. Copyright © 2014 Elsevier Ltd. All rights reserved.

Investigating Photosensitized Properties of Natural Organic Matter and Effluent Organic Matter

KAUST Repository

Niu, Xi-Zhi

2013-05-01

The photosensitized processes significantly enhance photolysis of various chemicals in the aqueous system with dissolved organic matter (DOM) as sensitizer. The excitation of chromophores on the DOM molecule further generates reactive species as triplet states DOM, singlet oxygen, hydroxyl radical, carbonate radical etc. We investigated the photosensitization properties of Beaufort Fulvic Acid, Suwannee River Fulvic Acid, South Platte River Fulvic Acid, and Jeddah wastewater treatment plant effluent organic matter with a sunlight simulator. DOM photochemical properties were characterized by observing their performances in 3DOM*, singlet oxygen, hydroxyl radical production with indirect probing protocols. Sensitized degradation of 0.1 μM and 0.02 μM 2, 4, 6- Trimethylphenol exhibited higher pseudo-first-order rate constant than that of 10 μM. Pre-irradiated DOMs were found to be depressed in photochemical properties. Photolysis of 5 different contaminants: ibuprofen, bisphenol A, acetaminophen, cimetidine, and caffeine were found to be enhanced in the presence of sensitizers. The possible reaction pathways were revealed. Long time irradiance induced change in contaminants degradation kinetics in some DOM solutions, which was proposed to be due to the irradiation initiated indirect transformation of DOMs. Key Words: Photolysis Dissolved Organic Matter, Triplet State DOM, Singlet Oxygen, Hydroxyl Radical, Contaminants Degradation.

Impact of the spectral and spatial properties of natural light on indoor gas-phase chemistry: Experimental and modeling study.

Science.gov (United States)

Blocquet, M; Guo, F; Mendez, M; Ward, M; Coudert, S; Batut, S; Hecquet, C; Blond, N; Fittschen, C; Schoemaecker, C

2018-05-01

The characteristics of indoor light (intensity, spectral, spatial distribution) originating from outdoors have been studied using experimental and modeling tools. They are influenced by many parameters such as building location, meteorological conditions, and the type of window. They have a direct impact on indoor air quality through a change in chemical processes by varying the photolysis rates of indoor pollutants. Transmittances of different windows have been measured and exhibit different wavelength cutoffs, thus influencing the potential of different species to be photolysed. The spectral distribution of light entering indoors through the windows was measured under different conditions and was found to be weakly dependent on the time of day for indirect cloudy, direct sunshine, partly cloudy conditions contrary to the light intensity, in agreement with calculations of the transmittance as a function of the zenithal angle and the calculated outdoor spectral distribution. The same conclusion can be drawn concerning the position within the room. The impact of these light characteristics on the indoor chemistry has been studied using the INCA-Indoor model by considering the variation in the photolysis rates of key indoor species. Depending on the conditions, photolysis processes can lead to a significant production of radicals and secondary species. © 2018 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Production of organic compounds in plasmas - A comparison among electric sparks, laser-induced plasmas, and UV light

Science.gov (United States)

Scattergood, Thomas W.; Mckay, Christopher P.; Borucki, William J.; Giver, Lawrence P.; Van Ghyseghem, Hilde

1989-01-01

In order to ascertain the features of organic compound-production in planetary atmospheres under the effects of plasmas and shocks, various mixtures of N2, CH4, and H2 modeling the atmosphere of Titan were subjected to discrete sparks, laser-induced plasmas, and UV radiation. The experimental results obtained suggest that UV photolysis from the plasma is an important organic compound synthesis process, as confirmed by the photolysis of gas samples that were exposed to the light but not to the shock waves emitted by the sparks. The thermodynamic equilibrium theory is therefore incomplete in the absence of photolysis.

Eficacia de un programa de intervención individual y breve para el trastorno por estrés postraumático en mujeres víctimas de violencia doméstica

Directory of Open Access Journals (Sweden)

Francisco Javier Labrador

2006-01-01

Full Text Available El objetivo del presente estudio es determinar la eficacia de un programa de tratamiento breve del trastorno por estrés postraumático (TEP en mujeres víctimas de violencia doméstica. La muestra estuvo constituida por 20 participantes, todas cumplían los criterios DSM-IV-TR para el diagnóstico de TEP, constituyendo 10 el grupo de control de lista de espera y 10 el grupo de tratamiento. El programa de tratamiento, derivado del de Labrador y Rincón, se aplicó de forma individual y constaba de 8 sesiones (2 meses, siendo sus componentes fundamentales la psicoeducación, técnicas de desactivación, terapia cognitiva y terapia de exposición. Se utilizó un diseño cuasiexperimental con dos grupos independientes de medidas repetidas (en el pretratamiento y en el postratamiento. Los resultados en el postratamiento indican que el programa fue efectivo para la reducción del TEP en el 100% de los casos. Se produjo además una mejora significativa en otras variables concomitantes: depresión, autoestima, inadaptación y cogniciones postraumáticas. No se encontraron, sin embargo, diferencias significativas en función de que se alterara el orden de aplicación de la terapia cognitiva y la terapia de exposición. Se discuten las implicaciones de este estudio para la práctica clínica y futuras investigaciones.

Nonmedical interventions for children with ASD: recommended guidelines and further research needs.

Science.gov (United States)

Maglione, Margaret A; Gans, Daphna; Das, Lopamudra; Timbie, Justin; Kasari, Connie

2012-11-01

To use the findings of a systematic review of scientific evidence to develop consensus guidelines on nonmedical interventions that address cognitive function and core deficits in children with autism spectrum disorders (ASDs) and to recommend priorities for future research. The guidelines were developed by a Technical Expert Panel (TEP) consisting of practitioners, researchers, and parents. A systematic overview of research findings was presented to the TEP; guideline statements were drafted, discussed, debated, edited, reassessed, and presented for formal voting. The strength of evidence of efficacy varied by intervention type from insufficient to moderate. There was some evidence that greater intensity of treatment (hours per week) and greater duration (in months) led to better outcomes. The TEP agreed that children with ASD should have access to at least 25 hours per week of comprehensive intervention to address social communication, language, play skills, and maladaptive behavior. They agreed that applied behavioral analysis, integrated behavioral/developmental programs, the Picture Exchange Communication System, and various social skills interventions have shown efficacy. Based on identified gaps, they recommend that future research focus on assessment and monitoring of outcomes, addressing the needs of pre/nonverbal children and adolescents, and identifying the most effective strategies, dose, and duration to improve specific core deficits. The creation of treatment guidelines and recommendations for future research represents an effort by leading experts to improve access to services for children with ASDs while acknowledging that the research evidence has many gaps.

Pulmonary embolism: Prospective comparison of spiral CT with ventilation - perfusion scintigraphy

International Nuclear Information System (INIS)

Mayo Jhon R; Remi Jardin, Martine; Muller Mestor I

1999-01-01

The pulmonary thromboembolism (PTE) it is an entity common with great morbidity and mortality that it requires a diagnosis soon and specify. Commonly the ventilation gammagraphy - perfusion has been the used exam of first more frequent line when one suspects the PTE but unfortunately a great quantity of reports is called of intermediate probability, for what requires complementary studies, to confirm or to discard the diagnosis. A prospective study was made with 142 patients that had suspicion of TEP in the hospital of Vancouver (Canada) and in the hospital of Calmette (France), being carried out in all gammagraphy of ventilation-perfusion and helical CT, being only taken to lung angiography to those that not had high clinical suspicion of TEP with gammagraphy or helical CT very suggestive or tuneless, undergoing the results valuation for different observers

An update to the multitasking thermalhydraulics evaluation package

Energy Technology Data Exchange (ETDEWEB)

Guo, Y.; Leung, L.K.H.; Vasic, A. [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada)

2007-07-01

An update of the multitasking Thermalhydraulics Evaluation Package (TEP) was implemented to improve the prediction accuracy of critical heat flux (CHF) and post-dryout (PDO) heat transfer for 37-element fuel bundles. The improvement of prediction accuracy was achieved using the latest correlations for CHF and PDO heat transfer derived from fullscale bundle tests. The predictions of TEP were assessed against experimental data and good agreement has been observed. In addition to the improvement, the prediction capability of the package has been expanded to capture the effect of radial power profile on CHF for 37-element bundles. A correlation for the radial power profile effect on CHF has been implemented. It accounts for the deviation in CHF between the bundle of radial power profile of interest and the equivalent bundle of the natural uranium profile. (author)

Authoritarian Parenting and Asian Adolescent School Performance: Insights from the US and Taiwan

Science.gov (United States)

Pong, Suet-ling; Johnston, Jamie; Chen, Vivien

2014-01-01

Our study re-examines the relationship between parenting and school performance among Asian students. We use two sources of data: wave I of the Adolescent Health Longitudinal Survey (Add Health), and waves I and II of the Taiwan Educational Panel Survey (TEPS). Analysis using Add Health reveals that the Asian-American/European-American difference in the parenting–school performance relationship is due largely to differential sample sizes. When we select a random sample of European-American students comparable to the sample size of Asian-American students, authoritarian parenting also shows no effect for European-American students. Furthermore, analysis of TEPS shows that authoritarian parenting is negatively associated with children's school achievement, while authoritative parenting is positively associated. This result for Taiwanese Chinese students is similar to previous results for European-American students in the US. PMID:24850978

First record and impact of the crown-of-thorns starfish, Acanthaster planci (Spinulosida: Acanthasteridae on corals of Malpelo Island, Colombian Pacific

Directory of Open Access Journals (Sweden)

Krupskaya Narváez

2010-05-01

Full Text Available The crown-of-thorns starfish, Acanthaster planci, is a major coral predator widely distributed in the Indo-Pacific region, where population outbreaks have caused dramatic impacts on coral reefs. In the Tropical Eastern Pacific (TEP A. planci occurs at low population densities; it has been significantly abundant only in Panama and Cocos Island. We have recently found two individuals of A. planci at Malpelo Island, a small oceanic island with significant coral communities located off the Colombian Pacific coast. The recent discovery of A. planci at Malpelo is significant in light of recent reports of its increased frequency of observation at Cocos Island and occurrence at the Galapagos Islands. The individuals found at Malpelo have been repeatedly sighted since 2004, actively feeding on nine species of coral. Although densities of A. planci are low at Malpelo and other oceanic islands of the TEP, these islands may act as stepping stones for the colonization of other coral reef areas in the region. However, the low densities of A. planci suggest that it currently poses no threat to coral reefs in the TEP. Rev. Biol. Trop. 58 (Suppl. 1: 139-143. Epub 2010 May 01.La estrella de mar corona de espinas Acanthaster planci, es un importante depredador de coral ampliamente distribuido en la región del Indo-Pacifico, donde explosiones poblacionales han causado dramáticos impactos sobre los arrecifes coralinos. En el Pacifico Oriental Tropical (POT A. planci ocurre con densidades poblacionales bajas; solamente en Panamá e Isla de Cocos su abundancia ha sido significativa. Nosotros encontramos recientemente al menos dos individuos de A. planci en la Isla de Malpelo, una pequeña isla oceánica con comunidades coralinas importantes localizada en el Pacífico Colombiano. El hallazgo de A. planci en Malpelo es significativo a la luz de reportes recientes de un incremento en su frecuencia de observación en Isla de Cocos y su registro en Galápagos. Los

Flash photolysis of cutinase

DEFF Research Database (Denmark)

Neves Petersen, Teresa; Klitgaard, Søren; Skovsen, Esben

2009-01-01

Aromatic amino acids play an important role in ultraviolet (UV)-induced photochemical reactions in proteins. In this work, we aim at gaining insight into the photochemical reactions induced by near-UV light excitation of aromatic residues that lead to breakage of disulfide bridges in our model en...... of the formed species and their lifetimes is important for the understanding of UV-induced reactions in humans that lead to light-induced diseases, e.g., skin cancer and cataract formation.......Aromatic amino acids play an important role in ultraviolet (UV)-induced photochemical reactions in proteins. In this work, we aim at gaining insight into the photochemical reactions induced by near-UV light excitation of aromatic residues that lead to breakage of disulfide bridges in our model...... of RSSR *-. Additional mechanisms that may lead to the near disappearance of Trp(*) are discussed. Our study provides insight into one key UV-light-induced reaction in cutinase, i.e., light-induced disruption of disulphide bridges mediated by the excitation of aromatic residues. Knowledge about the nature...

Sequelae of Endoscopic Inguinal Hernia Repair : Incidence, evaluation and management

NARCIS (Netherlands)

Burgmans, J.P.J.

2015-01-01

The endoscopic preperitoneal technique (TEP) is an appealing inguinal hernia repair technique, theoretically superior to other approaches. In practice some problems remain unsolved. Real incidences of chronic postoperative inguinal pain (CPIP) and other important sequelae of endoscopic hernia repair

Pan African Medical Journal - Vol 28, No 1 (2017)

African Journals Online (AJOL)

Intérêt de la TEP-TDM dans le cancer broncho-pulmonaire primitif non à petite ..... of Nigerian children: effects of socio-economic, nutritional and housing factors ... among antenatal attendees at health facilities in West Pokot county, Kenya ...

Pan African Medical Journal

African Journals Online (AJOL)

Intérêt de la TEP-TDM dans le cancer broncho-pulmonaire primitif non à petite ..... framework governing herbal medicine use and practice in Kenya: a review ... of Nigerian children: effects of socio-economic, nutritional and housing factors ...

Swarm Intelligence-Enhanced Detection of Non-Small-Cell Lung Cancer Using Tumor-Educated Platelets

NARCIS (Netherlands)

Best, Myron G.; Sol, Nik; In ‘t Veld, Sjors G.J.G.; Vancura, Adrienne; Muller, Mirte; Niemeijer, Anna Larissa N.; Fejes, Aniko V.; Tjon Kon Fat, Lee Ann; Huis in 't Veld, Anna E; Leurs, Cyra; Le Large, Tessa Y.; Meijer, Laura L.; Kooi, Irsan E.; Rustenburg, François; Schellen, Pepijn; Verschueren, Heleen; Post, Edward; Wedekind, Laurine E.; Bracht, Jillian; Esenkbrink, Michelle; Wils, Leon; Favaro, Francesca; Schoonhoven, Jilian D.; Tannous, Jihane; Meijers-Heijboer, Hanne; Kazemier, Geert; Giovannetti, Elisa; Reijneveld, Jaap C.; Idema, Sander; Killestein, Joep; Heger, Michal; de Jager, Saskia C.; Urbanus, Rolf T.; Hoefer, Imo E.; Pasterkamp, Gerard; Mannhalter, Christine; Gomez-Arroyo, Jose; Bogaard, Harm-Jan; Noske, David P.; Vandertop, W. Peter; van den Broek, Daan; Ylstra, Bauke; Nilsson, R. Jonas A; Wesseling, Pieter; Karachaliou, Niki; Rosell, Rafael; Lee-Lewandrowski, Elizabeth; Lewandrowski, Kent B.; Tannous, Bakhos A.; de Langen, Adrianus J.; Smit, Egbert F.; van den Heuvel, Michel M; Wurdinger, Thomas

2017-01-01

Blood-based liquid biopsies, including tumor-educated blood platelets (TEPs), have emerged as promising biomarker sources for non-invasive detection of cancer. Here we demonstrate that particle-swarm optimization (PSO)-enhanced algorithms enable efficient selection of RNA biomarker panels from

Tank 241-SY-101 surface level rise remediation test and evaluation plan for transfer system

International Nuclear Information System (INIS)

BAUER, R.E.

1999-01-01

The purpose of this testing and evaluation plan (TEP) is to provide the high level guidance on testing requirements for ensuring that the equipment and systems to be implemented for remediation of the SY-101 waste level rise USQ are effective

Purification of silane via laser-induced chemistry

International Nuclear Information System (INIS)

Clark, J.H.; Anderson, R.G.

1979-01-01

Impurities such as PH 3 , AsH 3 , and B 2 H 6 may be removed from SiH 4 by means of selective photolysis with ultraviolet radiation of the appropriate wavelength. An ArF laser operating at 193 nm provides an efficient and effective radiation source for the photolysis

Rate Constant of the Reaction between CH3O2 Radicals and OH Radicals Revisited.

Science.gov (United States)

Assaf, Emmanuel; Song, Bo; Tomas, Alexandre; Schoemaecker, Coralie; Fittschen, Christa

2016-11-17

The reaction between CH 3 O 2 and OH radicals has been studied in a laser photolysis cell using the reaction of F atoms with CH 4 and H 2 O for the simultaneous generation of both radicals, with F atoms generated through 248 nm photolysis of XeF 2 . An experimental setup combining cw-Cavity Ring Down Spectroscopy (cw-CRDS) and high repetition rate laser-induced fluorescence (LIF) to a laser photolysis cell has been used. The absolute concentration of CH 3 O 2 was measured by cw-CRDS, while the relative concentration of OH(v = 0) radicals was determined by LIF. To remove dubiety from the quantification of CH 3 O 2 by cw-CRDS in the near-infrared, its absorption cross section has been determined at 7489.16 cm -1 using two different methods. A rate constant of k 1 = (1.60 ± 0.4) × 10 -10 cm 3 s -1 has been determined at 295 K, nearly a factor of 2 lower than an earlier determination from our group ((2.8 ± 1.4) × 10 -10 cm 3 s -1 ) using CH 3 I photolysis as a precursor. Quenching of electronically excited I atoms (from CH 3 I photolysis) in collision with OH(v = 0) is suspected to be responsible for a bias in the earlier, fast rate constant.

Ceramic Membrane combined with Powdered Activated Carbon (PAC) or Coagulation for Treatment of Impaired Quality Waters

KAUST Repository

Hamad, Juma Z.

2013-08-29

Ceramic membranes (CM) are robust membranes attributed with high production, long life span and stability against critical conditions. While capital costs are high, these are partially offset by lower operation and maintenance costs compared to polymeric membranes. Like any other low-pressure membrane (LPM), CM faces problems of fouling, low removal of organic matter and poor removal of trace organic compounds (TOrCs). Current pretreatment approaches that are mainly based on coagulation and adsorption can remove some organic matter but with a low removal of the biopolymers component which is responsible for fouling. Powdered activated carbon (PAC) accompanied with a LPM maintains good removal of TOrCs. However, enhanced removal of TOrCs to higher level is required. Submicron powdered activated carbon (SPAC), obtained after crushing commercial activated carbon into very fine particle, and novel activated carbon (KCU 6) which is characterized with larger pores and high surface area were employed. A pre-coating approach, which provides intimated contact between PAC and contaminants, was adopted for wastewater and (high DOC) surface water treatment. For seawater, in-line coagulation with iron III chloride was adopted. Both SPAC and KCU 6 showed good removal of biopolymers at a dose of 30 mg/L with > 85 % and 90 %, respectively. A dose of 40 mg/L of SPAC and 30 mg/L KCU 6 pre-coats were successful used in controlling membrane fouling. SPAC is suggested to remove biopolymers by physical means and adsorption while KCU 6 removed biopolymers through adsorption. Both KCU 6 and SPAC attained high removal of TOrCs whereas KCU 6 showed outstanding performance. Out of 29 TOrCs investigated, KCU 6 showed > 87 % TOrCs rejection for 28 compounds. In seawater pretreatment, transparent exopolymer particles (TEP) were found to be an important foulant. TEP promoted both reversible and irreversible fouling. TEP are highly electronegative while alumina CM is positively charged which

An Overview of Governance and Accountability of Tahfiz Institutions in Malaysian: Religious Councils Perspective

Directory of Open Access Journals (Sweden)

Bani Hamidah

2017-01-01

Full Text Available Tahfiz education is one of the popular streams of education in Malaysia and well accepted by Muslim community. Originally the education is being offered in “pondok”, a traditional religious school. Developing through times, it is now also being offered in tahfiz centers as well as in modern tahfiz institutions. These entities specialize in producing tahfiz graduates who can memorize and recite the whole Al-Quran and more than 91% of them are privately owned. The applicability of good governance and accountability measures is indeed highly desirable in these Islamic entities as it deals with the responsibility in fulfilling sacred religious obligation. Though the number of tahfiz education providers (TEP has grown up tremendously from only 58 in 1999 to 278 in 2011, literatures on governance and accountability of TEP are still lacking as the areas are rarely examined directly. The lacking may lead to unfavorable inferences that TEP are behaving in the manners contrary to the interest of the stakeholders. An ideally accountable governance of tahfiz centers will gain trust from parents and various stakeholders and will indicate the achievement in fulfilling one of the objective of Maqasid Shariah to preserve and promote the religious faith through preserving the memorization and knowledge of Al Quran (the primary source of Islamic Law by the huffaz. The objective of this research is to investigate external governance mechanism and the accountability of Tahfiz centers as viewed by religious regulatory bodies. A qualitative research approach is undertaken by interviewing representatives from selected State Islamic Religious Councils, State Islamic Foundation and National Religious Departments in Malaysia. Using thematic analysis, findings of this study revealed that there are two-tier governance infrastructures of tahfiz institutions in Malaysia. However, the enforcement of the governance structure is still at infancy level. The accountability

Hydroxyl radical reactivity at the air-ice interface

Directory of Open Access Journals (Sweden)

T. F. Kahan

2010-01-01

Full Text Available Hydroxyl radicals are important oxidants in the atmosphere and in natural waters. They are also expected to be important in snow and ice, but their reactivity has not been widely studied in frozen aqueous solution. We have developed a spectroscopic probe to monitor the formation and reactions of hydroxyl radicals in situ. Hydroxyl radicals are produced in aqueous solution via the photolysis of nitrite, nitrate, and hydrogen peroxide, and react rapidly with benzene to form phenol. Similar phenol formation rates were observed in aqueous solution and bulk ice. However, no reaction was observed at air-ice interfaces, or when bulk ice samples were crushed prior to photolysis to increase their surface area. We also monitored the heterogeneous reaction between benzene present at air-water and air-ice interfaces with gas-phase OH produced from HONO photolysis. Rapid phenol formation was observed on water surfaces, but no reaction was observed at the surface of ice. Under the same conditions, we observed rapid loss of the polycyclic aromatic hydrocarbon (PAH anthracene at air-water interfaces, but no loss was observed at air-ice interfaces. Our results suggest that the reactivity of hydroxyl radicals toward aromatic organics is similar in bulk ice samples and in aqueous solution, but is significantly suppressed in the quasi-liquid layer (QLL that exists at air-ice interfaces.

Rhodium, iridium and nickel complexes with a 1,3,5-triphenylbenzene tris-MIC ligand. Study of the electronic properties and catalytic activities

Directory of Open Access Journals (Sweden)

Carmen Mejuto

2015-12-01

Full Text Available The coordination versatility of a 1,3,5-triphenylbenzene-tris-mesoionic carbene ligand is illustrated by the preparation of complexes with three different metals: rhodium, iridium and nickel. The rhodium and iridium complexes contained the [MCl(COD] fragments, while the nickel compound contained [NiCpCl]. The preparation of the tris-MIC (MIC = mesoionic carbene complex with three [IrCl(CO2] fragments, allowed the estimation of the Tolman electronic parameter (TEP for the ligand, which was compared with the TEP value for a related 1,3,5-triphenylbenzene-tris-NHC ligand. The electronic properties of the tris-MIC ligand were studied by cyclic voltammetry measurements. In all cases, the tris-MIC ligand showed a stronger electron-donating character than the corresponding NHC-based ligands. The catalytic activity of the tri-rhodium complex was tested in the addition reaction of arylboronic acids to α,β-unsaturated ketones.

Project W-314 specific test and evaluation plan for AZ tank farm upgrades

International Nuclear Information System (INIS)

Hays, W.H.

1998-01-01

The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-631 transfer line from the AZ-O1A pit to the AZ-02A pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation P1 an (TEP). Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities, etc), Factory Tests and Inspections (FTIs), installation tests and inspections, Construction Tests and Inspections (CTIs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). The STEP will be utilized in conjunction with the TEP for verification and validation

Field Performance of Photovoltaic Systems in the Tucson Desert

Science.gov (United States)

Orsburn, Sean; Brooks, Adria; Cormode, Daniel; Greenberg, James; Hardesty, Garrett; Lonij, Vincent; Salhab, Anas; St. Germaine, Tyler; Torres, Gabe; Cronin, Alexander

2011-10-01

At the Tucson Electric Power (TEP) solar test yard, over 20 different grid-connected photovoltaic (PV) systems are being tested. The goal at the TEP solar test yard is to measure and model real-world performance of PV systems and to benchmark new technologies such as holographic concentrators. By studying voltage and current produced by the PV systems as a function of incident irradiance, and module temperature, we can compare our measurements of field-performance (in a harsh desert environment) to manufacturer specifications (determined under laboratory conditions). In order to measure high-voltage and high-current signals, we designed and built reliable, accurate sensors that can handle extreme desert temperatures. We will present several benchmarks of sensors in a controlled environment, including shunt resistors and Hall-effect current sensors, to determine temperature drift and accuracy. Finally we will present preliminary field measurements of PV performance for several different PV technologies.

Nuclear Fusion Fuel Cycle Research Perspectives

International Nuclear Information System (INIS)

Chung, Hongsuk; Koo, Daeseo; Park, Jongcheol; Kim, Yeanjin; Yun, Sei-Hun

2015-01-01

As a part of the International Thermonuclear Experimental Reactor (ITER) Project, we at the Korea Atomic Energy Research Institute (KAERI) and our National Fusion Research Institute (NFRI) colleagues are investigating nuclear fusion fuel cycle hardware including a nuclear fusion fuel Storage and Delivery System (SDS). To have a better knowledge of the nuclear fusion fuel cycle, we present our research efforts not only on SDS but also on the Fuel Supply System (FS), Tokamak Exhaust Processing System (TEP), Isotope Separation System (ISS), and Detritiation System (DS). To have better knowledge of the nuclear fusion fuel cycle, we presented our research efforts not only on SDS but also on the Fuel Supply System (FS), Tokamak Exhaust Processing System (TEP), Isotope Separation System (ISS), and Detritiation System (DS). Our efforts to enhance the tritium confinement will be continued for the development of cleaner nuclear fusion power plants

Fiber Optic Coupled Raman Based Detection of Hazardous Liquids Concealed in Commercial Products

Directory of Open Access Journals (Sweden)

Michael L. Ramírez-Cedeño

2012-01-01

Full Text Available Raman spectroscopy has been widely proposed as a technique to nondestructively and noninvasively interrogate the contents of glass and plastic bottles. In this work, Raman spectroscopy is used in a concealed threat scenario where hazardous liquids have been intentionally mixed with common consumer products to mask its appearance or spectra. The hazardous liquids under consideration included the chemical warfare agent (CWA simulant triethyl phosphate (TEP, hydrogen peroxide, and acetone as representative of toxic industrial compounds (TICs. Fiber optic coupled Raman spectroscopy (FOCRS and partial least squares (PLS algorithm analysis were used to quantify hydrogen peroxide in whiskey, acetone in perfume, and TEP in colored beverages. Spectral data was used to evaluate if the hazardous liquids can be successfully concealed in consumer products. Results demonstrated that FOC-RS systems were able to discriminate between nonhazardous consumer products and mixtures with hazardous materials at concentrations lower than 5%.

Savannah River Site TEP-SET tests uncertainty report

International Nuclear Information System (INIS)

Taylor, D.J.N.

1993-09-01

This document presents a measurement uncertainty analysis for the instruments used for the Phase I, II and III of the Savannah River One-Fourth Linear Scale, One-Sixth Sector, Tank/Muff/Pump (TMP) Separate Effects Tests (SET) Experiment Series. The Idaho National Engineering Laboratory conducted the tests for the Savannah River Site (SRS). The tests represented a range of hydraulic conditions and geometries that bound anticipated Large Break Loss of Coolant Accidents in the SRS reactors. Important hydraulic phenomena were identified from experiments. In addition, code calculations will be benchmarked from these experiments. The experimental system includes the following measurement groups: coolant density; absolute and differential pressures; turbine flowmeters (liquid phase); thermal flowmeters (gas phase); ultrasonic liquid level meters; temperatures; pump torque; pump speed; moderator tank liquid inventory via a load cells measurement; and relative humidity meters. This document also analyzes data acquisition system including the presampling filters as it relates to these measurements

Off-great-circle paths in transequatorial propagation: 2. Nonmagnetic-field-aligned reflections

Science.gov (United States)

Tsunoda, Roland T.; Maruyama, Takashi; Tsugawa, Takuya; Yokoyama, Tatsuhiro; Ishii, Mamoru; Nguyen, Trang T.; Ogawa, Tadahiko; Nishioka, Michi

2016-11-01

There is considerable evidence that plasma structure in nighttime equatorial F layer develops from large-scale wave structure (LSWS) in bottomside F layer. However, crucial details of how this process proceeds, from LSWS to equatorial plasma bubbles (EPBs), remain to be sorted out. A major obstacle to success is the paucity of measurements that provide a space-time description of the bottomside F layer over a broad geographical region. The transequatorial propagation (TEP) experiment is one of few methods that can do so. New findings using a TEP experiment, between Shepparton (SHP), Australia, and Oarai (ORI), Japan, are presented in two companion papers. In Paper 1 (P1), (1) off-great-circle (OGC) paths are described in terms of discrete and diffuse types, (2) descriptions of OGC paths are generalized from a single-reflection to a multiple-reflection process, and (3) discrete type is shown to be associated with an unstructured but distorted upwelling, whereas the diffuse type is shown to be associated with EPBs. In Paper 2 (P2), attention is placed on differences in east-west (EW) asymmetry, found between OGC paths from the SHP-ORI experiment and those from another near-identical TEP experiment. Differences are reconciled by allowing three distinct sources for the EW asymmetries: (1) reflection properties within an upwelling (see P1), (2) OGC paths that depend on magnetic declination of geomagnetic field (B), and (3) OGC paths supported by non-B-aligned reflectors at latitudes where inclination of B is finite.

Identifying real and perceived barriers to therapeutic education programs for individuals with inflammatory arthritis.

Science.gov (United States)

Bain, Lorna; Sangrar, Ruheena; Bornstein, Carolyn; Lukmanji, Sara; Hapuhennedige, Sandani; Thorne, Carter; Beattie, Karen A

2016-09-01

Therapeutic Education Programs (TEPs) grounded in self-management principles have been shown to improve quality of life of patients with chronic conditions and reduce patient-related healthcare costs. Though these programs are becoming more readily available, patients often experience barriers in participating. This study sought to identify barriers faced by inflammatory arthritis (IA) patients in attending a TEP and understand how patients overcame perceived barriers. A mixed-method study design was used. Questionnaires were distributed to individuals with IA who were invited to attend a TEP between 2010 and 2013. Respondents were those that chose not to attend (group A), individuals who attended ≤4 of 10 sessions (group B), individuals who attended ≥5 of 10 sessions prior to May 2013 (group C), and individuals who attended ≥5 of 10 sessions from June 2013 to November 2013 (group D). Individuals in group D were also invited to participate in focus groups to discuss how they had overcome perceived barriers. Real barriers identified by individuals in groups A and B included time, distance, and cost associated with attendance. Individuals who overcame perceived barriers (groups C and D) discussed strategies they used to do so. Aspects of the overall program experience and access to clinic and program also contributed to patients being able to overcome barriers. Time, distance, and cost are external barriers that prevented individuals from utilizing self-management education opportunities. These barriers were overcome if and when individuals had resources available to them. Readiness for behavior change also influenced commitment to participate in the program.

The experience and awareness of laparoendoscopic procedures among Polish surgeons in everyday clinical practice.

Science.gov (United States)

Mitura, Kryspin; Dąbrowiecki, Stanisław; Śmietański, Maciej; Matyja, Andrzej

2017-01-01

In 2012, a total of 56 647 inguinal hernia repairs were performed in Poland. However, the absence of a uniform hernia repair register obscures the current herniology status in Poland, especially regarding laparoendoscopic procedures. To determine the awareness of laparoendoscopic procedures among Polish surgeons and to ascertain their everyday clinical practice. The data were collected at the national hernia conference in 2016, during an interactive session for surgeons with a special interest in herniology. They could respond to the survey items using the VoxVote application. All items and response options were displayed on participants' smartphones. The questions were related to transabdominal preperitoneal/totally extraperitoneal (TAPP/TEP) hernia repair. The surgeons responded to 27 questions regarding routine inguinal hernia repair. One hundred and six surgeons from all regions of Poland participated in the survey. 19.2% of respondents never inform patients about the possibility of performing laparoendoscopic repair. 45.2% admitted that they had referred a patient with a difficult inguinal hernia to another hospital or surgeon. Seventy-five percent stated they would be willing to perform TAPP/TEP if the reimbursement rates were more favourable. In bilateral hernias, 61.6% of the respondents perform a two-step open repair, while only 25% perform a single-stage laparoendoscopic repair of bilateral hernia. In women, only 13.3% perform laparoendoscopic hernia repairs, and 19.0% do not use mesh. The skill level to perform TAPP/TEP repair is still inadequate among Polish surgeons. The absence of accurate data makes it impossible to verify whether the treatment methods used are compliant with the guidelines.