WorldWideScience

Sample records for shock sha li

  1. Numerical results from a study of LiH: the proposed standard material for the high pressure shock experiment

    International Nuclear Information System (INIS)

    Rogers, F.J.

    1975-01-01

    It is proposed to send a high pressure shock wave through a layer of LiH and then into a sample of high Z-material, resulting in a reflected shock wave back into the LiH. If the Hugoniot and some reflected Hugoniots for LiH are known the EOS of the sample can be obtained from the ''impedance matching method.'' The theory and its range of validity are described

  2. Preimages for Step-Reduced SHA-2

    DEFF Research Database (Denmark)

    Aoki, Kazumaro; Guo, Jian; Matusiewicz, Krystian

    2009-01-01

    In this paper, we present preimage attacks on up to 43-step SHA-256 (around 67% of the total 64 steps) and 46-step SHA-512 (around 57.5% of the total 80 steps), which significantly increases the number of attacked steps compared to the best previously published preimage attack working for 24 steps....... The time complexities are 2^251.9, 2^509 for finding pseudo-preimages and 2^254.9, 2^511.5 compression function operations for full preimages. The memory requirements are modest, around 2^6 words for 43-step SHA-256 and 46-step SHA-512. The pseudo-preimage attack also applies to 43-step SHA-224 and SHA-384...

  3. The first collision for full SHA-1

    NARCIS (Netherlands)

    M.M.J. Stevens (Marc); E. Bursztein (Elie); P. Karpman (Pierre); A. Albertini (Ange); Y. Markov (Yarik)

    2017-01-01

    textabstractSHA-1 is a widely used 1995 NIST cryptographic hash function standard that was officially deprecated by NIST in 2011 due to fundamental security weaknesses demonstrated in various analyses and theoretical attacks. Despite its deprecation, SHA-1 remains widely used in 2017 for document

  4. Shock equation of state of 6LiH to 1.1 TPa

    Science.gov (United States)

    Lazicki, A.; London, R. A.; Coppari, F.; Erskine, D.; Whitley, H. D.; Caspersen, K. J.; Fratanduono, D. E.; Morales, M. A.; Celliers, P. M.; Eggert, J. H.; Millot, M.; Swift, D. C.; Collins, G. W.; Kucheyev, S. O.; Castor, J. I.; Nilsen, J.

    2017-10-01

    Using laser-generated shock waves, we have measured pressure, density, and temperature of LiH on the principal Hugoniot between 260 and 1100 GPa (2.6-11 Mbar) and on a second-shock Hugoniot up to 1400 GPa to near fivefold compression, extending the maximum pressure reached in non-nuclear experiments by a factor of two. We observe the onset of metal-like reflectivity consistent with temperature-induced ionization of the Li 2s electron, and no sign of additional changes in ionization up to the maximum pressure. Our measurements are in good agreement with gas gun, Z-machine, and underground test data and are accurately described by quantum molecular dynamics simulations. The results confirm the validity of equation of state models built on an average-atom description of the electron-thermal contribution to the free energy and a density-dependent Grüneisen parameter to describe shock response of LiH over this pressure range.

  5. Dicty_cDB: SHA665 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT

  6. Roles of putative sodium-hydrogen antiporter (SHA) genes in S. coelicolor A3(2) culture with pH variation.

    Science.gov (United States)

    Kim, Yoon Jung; Moon, Myung Hee; Lee, Jae Sun; Hong, Soon-Kwang; Chang, Yong Keun

    2011-09-01

    Culture pH change has some important roles in signal transduction and secondary metabolism. We have already reported that acidic pH shock enhanced actinorhodin production in Streptomyces coelicolor. Among many potential governing factors on pH variation, the putative Na(+)/H(+) antiporter (sha) genes in S. coelicolor have been investigated in this study to elucidate the association of the sha on pH variation and secondary metabolism. Through the transcriptional analysis and overexpression experiments on 8 sha genes, we observed that most of the sha expressions were promoted by pH shock, and in the opposite way the pH changes and actinorhodin production were enhanced by the overexpression of each sha. We also confirmed that sha8 especially has a main role in maintaining cell viability and pH homeostasis through Na(+) extrusion, in salt effect experiment under the alkaline medium condition by deleting sha8. Moreover, this gene was observed to have a function of pH recovery after pH variation such as the pH shock, being able to cause the sporulation. However, actinorhodin production was not induced by the only pH recovery. The sha8 gene could confer on the host cell the ability to recover pH to the neutral level after pH variation like a pH drop. Sporulation was closely associated with this pH recovery caused by the action of sha8, whereas actinorhodin production was not due to such pH variation patterns alone.

  7. SHA-1, SAT-solving, and CNF

    CSIR Research Space (South Africa)

    Motara, YM

    2017-09-01

    Full Text Available the intersection between the SHA-1 preimage problem, the encoding of that problem for SAT-solving, and SAT-solving. The results demonstrate that SAT-solving is not yet a viable approach to take to solve the preimage problem, and also indicate that some...

  8. Ontogeny of Odor-LiCl vs. Odor-Shock Learning: Similar Behaviors but Divergent Ages of Functional Amygdala Emergence

    Science.gov (United States)

    Raineki, Charlis; Shionoya, Kiseko; Sander, Kristin; Sullivan, Regina M.

    2009-01-01

    Both odor-preference and odor-aversion learning occur in perinatal pups before the maturation of brain structures that support this learning in adults. To characterize the development of odor learning, we compared three learning paradigms: (1) odor-LiCl (0.3M; 1% body weight, ip) and (2) odor-1.2-mA shock (hindlimb, 1sec)--both of which…

  9. X-ray diffraction measurements to determine longitudinal and transverse lattice deformation in shocked LiF

    International Nuclear Information System (INIS)

    Rigg, P.A.; Gupta, Y.M.

    2000-01-01

    Experimental methods using both single and multiple x-ray diffraction were developed to determine real time, lattice deformation in directions parallel and perpendicular to shock wave propagation in single crystals subjected to plate impact loading. Initial experiments used single diffraction to monitor the interplanar spacing change, parallel to the shock propagation direction, in LiF crystals shocked along the [111] and [100] directions. These measurements, in combination with the macroscopic volume compression, were used to determine the state of compression of the unit cell. Subsequent development of a multiple diffraction technique permitted simultaneous determination of both the longitudinal and transverse lattice deformations. The present results showed that shock compression, below 4 GPa, along the [111] orientation--which results in macroscopic elastic deformation - produced one-dimensional unit cell compression. In contrast, shock compression along the [100] orientation - which results in macroscopic elastic-plastic deformation--produced isotropic unit cell compression. The implications of the present results and the ability to make quantitative x-ray diffraction measurements under shock loading are discussed

  10. Dicty_cDB: SHA393 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict

  11. 76 FR 11433 - Federal Transition To Secure Hash Algorithm (SHA)-256

    Science.gov (United States)

    2011-03-02

    ... ADMINISTRATION [FAR-N-2011-01; Docket No. 2011-0083; Sequence 1] Federal Transition To Secure Hash Algorithm (SHA... acquisition community to transition to Secure Hash Algorithm SHA-256. SHA-256 is a cryptographic hash function... persons attending. Please cite ``Federal Transition to Secure Hash Algorithm SHA-256'' in all...

  12. Shock compression experiments on Lithium Deuteride (LiD) single crystals

    Science.gov (United States)

    Knudson, M. D.; Desjarlais, M. P.; Lemke, R. W.

    2016-12-01

    Shock compression experiments in the few hundred GPa (multi-Mbar) regime were performed on Lithium Deuteride single crystals. This study utilized the high velocity flyer plate capability of the Sandia Z Machine to perform impact experiments at flyer plate velocities in the range of 17-32 km/s. Measurements included pressure, density, and temperature between ˜190 and 570 GPa along the Principal Hugoniot—the locus of end states achievable through compression by large amplitude shock waves—as well as pressure and density of reshock states up to ˜920 GPa. The experimental measurements are compared with density functional theory calculations, tabular equation of state models, and legacy nuclear driven results that have been reanalyzed using modern equations of state for the shock wave standards used in the experiments.

  13. LDPC and SHA based iris recognition for image authentication

    Directory of Open Access Journals (Sweden)

    K. Seetharaman

    2012-11-01

    Full Text Available We introduce a novel way to authenticate an image using Low Density Parity Check (LDPC and Secure Hash Algorithm (SHA based iris recognition method with reversible watermarking scheme, which is based on Integer Wavelet Transform (IWT and threshold embedding technique. The parity checks and parity matrix of LDPC encoding and cancellable biometrics i.e., hash string of unique iris code from SHA-512 are embedded into an image for authentication purpose using reversible watermarking scheme based on IWT and threshold embedding technique. Simply by reversing the embedding process, the original image, parity checks, parity matrix and SHA-512 hash are extracted back from watermarked-image. For authentication, the new hash string produced by employing SHA-512 on error corrected iris code from live person is compared with hash string extracted from watermarked-image. The LDPC code reduces the hamming distance for genuine comparisons by a larger amount than for the impostor comparisons. This results in better separation between genuine and impostor users which improves the authentication performance. Security of this scheme is very high due to the security complexity of SHA-512, which is 2256 under birthday attack. Experimental results show that this approach can assure more accurate authentication with a low false rejection or false acceptance rate and outperforms the prior arts in terms of PSNR.

  14. Second-Preimage Analysis of Reduced SHA-1

    DEFF Research Database (Denmark)

    Rechberger, Christian

    2010-01-01

    Many applications using cryptographic hash functions do not require collision resistance, but some kind of preimage resistance. That's also the reason why the widely used SHA-1 continues to be recommended in all applications except digital signatures after 2010. Recent work on preimage and second...

  15. D.SYM.4 SHA-3 Design and Cryptanalysis Report

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Thomsen, Søren Steffen

    2011-01-01

    The competition to select a new secure hash function standard SHA-3 was initiated in response to surprising progress in the cryptanalysis of existing hash function constructions that started in 2004. In this report we survey design and cryptanalytic results of those 14 candidates that remain in t...

  16. On security arguments of the second round SHA-3 candidates

    DEFF Research Database (Denmark)

    Andreeva, Elena; Bogdanov, Andrey; Mennink, Bart

    2012-01-01

    of which got accepted to the first round. 14 candidates were left in the second round, out of which five candidates have been recently chosen for the final round. An important criterion in the selection process is the SHA-3 hash function security. We identify two important classes of security arguments...... for the new designs: (1) the possible reductions of the hash function security to the security of its underlying building blocks and (2) arguments against differential attack on building blocks. In this paper, we compare the state of the art provable security reductions for the second round candidates...... and review arguments and bounds against classes of differential attacks.We discuss all the SHA-3 candidates at a high functional level, analyze, and summarize the security reduction results and bounds against differential attacks. Additionally, we generalize the well-known proof of collision resistance...

  17. Mapping PetaSHA Applications to TeraGrid Architectures

    Science.gov (United States)

    Cui, Y.; Moore, R.; Olsen, K.; Zhu, J.; Dalguer, L. A.; Day, S.; Cruz-Atienza, V.; Maechling, P.; Jordan, T.

    2007-12-01

    The Southern California Earthquake Center (SCEC) has a science program in developing an integrated cyberfacility - PetaSHA - for executing physics-based seismic hazard analysis (SHA) computations. The NSF has awarded PetaSHA 15 million allocation service units this year on the fastest supercomputers available within the NSF TeraGrid. However, one size does not fit all, a range of systems are needed to support this effort at different stages of the simulations. Enabling PetaSHA simulations on those TeraGrid architectures to solve both dynamic rupture and seismic wave propagation have been a challenge from both hardware and software levels. This is an adaptation procedure to meet specific requirements of each architecture. It is important to determine how fundamental system attributes affect application performance. We present an adaptive approach in our PetaSHA application that enables the simultaneous optimization of both computation and communication at run-time using flexible settings. These techniques optimize initialization, source/media partition and MPI-IO output in different ways to achieve optimal performance on the target machines. The resulting code is a factor of four faster than the orignial version. New MPI-I/O capabilities have been added for the accurate Staggered-Grid Split-Node (SGSN) method for dynamic rupture propagation in the velocity-stress staggered-grid finite difference scheme (Dalguer and Day, JGR, 2007), We use execution workflow across TeraGrid sites for managing the resulting data volumes. Our lessons learned indicate that minimizing time to solution is most critical, in particular when scheduling large scale simulations across supercomputer sites. The TeraShake platform has been ported to multiple architectures including TACC Dell lonestar and Abe, Cray XT3 Bigben and Blue Gene/L. Parallel efficiency of 96% with the PetaSHA application Olsen-AWM has been demonstrated on 40,960 Blue Gene/L processors at IBM TJ Watson Center. Notable

  18. [Diagnosis and treatment characteristics of head-wind sha in She medicine].

    Science.gov (United States)

    Zou, Guangyi; Xu, Xiangdong; Zheng, Songming; Yan, Lianhe; Lei, Houxing; Zhang, Qiao-ling; Xiang, Yingmei; Ye, Yiping; Song, Liwei

    2015-03-01

    The diagnosis and treatment characteristics of head-wind sha in She medicine were analyzed and summarized. By visiting She-nationality villages and towns in Zhejiang province and Fujian province and interviewing hundreds of doctors of She medicine, the sha diagnosis, sha differentiation, experience and theory of treatment were arranged, and a comprehensive summary on theory and application of head-wind sha in She medicine such as pathogeny, name of disease, mechanism, diagnosis, differential diagnosis and treatment was made. It is believed that the methods of diagnosis and treatment in She medicine for head-wind sha could effectively enhance curative effect, safety and patients' quality of life, and the further research should be carried out.

  19. A one-time pad color image cryptosystem based on SHA-3 and multiple chaotic systems

    Science.gov (United States)

    Wang, Xingyuan; Wang, Siwei; Zhang, Yingqian; Luo, Chao

    2018-04-01

    A novel image encryption algorithm is proposed that combines the SHA-3 hash function and two chaotic systems: the hyper-chaotic Lorenz and Chen systems. First, 384 bit keystream hash values are obtained by applying SHA-3 to plaintext. The sensitivity of the SHA-3 algorithm and chaotic systems ensures the effect of a one-time pad. Second, the color image is expanded into three-dimensional space. During permutation, it undergoes plane-plane displacements in the x, y and z dimensions. During diffusion, we use the adjacent pixel dataset and corresponding chaotic value to encrypt each pixel. Finally, the structure of alternating between permutation and diffusion is applied to enhance the level of security. Furthermore, we design techniques to improve the algorithm's encryption speed. Our experimental simulations show that the proposed cryptosystem achieves excellent encryption performance and can resist brute-force, statistical, and chosen-plaintext attacks.

  20. Data harmonization and federated analysis of population-based studies : the BioSHaRE project

    NARCIS (Netherlands)

    Doiron, Dany; Burton, Paul; Marcon, Yannick; Gaye, Amadou; Wolffenbuttel, Bruce H R; Perola, Markus; Stolk, Ronald P; Foco, Luisa; Minelli, Cosetta; Waldenberger, Melanie; Holle, Rolf; Kvaløy, Kirsti; Hillege, Hans L; Tassé, Anne-Marie; Ferretti, Vincent; Fortier, Isabel

    2013-01-01

    ABSTRACTS BACKGROUND: Individual-level data pooling of large population-based studies across research centres in international research projects faces many hurdles. The BioSHaRE (Biobank Standardisation and Harmonisation for Research Excellence in the European Union) project aims to address these

  1. Side channel analysis of some hash based MACs: A response to SHA-3 requirements

    DEFF Research Database (Denmark)

    Gauravaram, Praveen; Okeya, Katsuyuki

    2008-01-01

    The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...

  2. Effects of Gua-Sha therapy on breast engorgement: a randomized controlled trial.

    Science.gov (United States)

    Chiu, Jin-Yu; Gau, Meei-Ling; Kuo, Shu-Yu; Chang, Yung-Hsien; Kuo, Su-Chen; Tu, Hui-Chuan

    2010-03-01

    Breast engorgement is a common problem that affects the initiation and duration of breastfeeding. Limited solutions are available to relieve the discomfort associated with breast engorgement. Thus, further investigation of methods to achieve effective relief of symptoms is critical to promote breastfeeding success. : The purpose of this study was to determine the effects of two breast care methods, that is, scraping (Gua-Sha) therapy (administered to the experimental group) and traditional breast care (i.e., massage and heating; administered to the control group). A randomized controlled trial was conducted on 54 postpartum women at a Level III medical teaching hospital. Participant inclusion criteria included postpartum breastfeeding women (a) who had an uncomplicated delivery and (b) who were experiencing breast engorgement problems. The Gua-Sha protocol selected appropriate acupoint positions, which included ST16, ST18, SP17, and CV17. Each position was lightly scraped seven times in two cycles. For the control group, we used hot packs and massage for 20 min in accordance with recommendations given in an obstetrical technique textbook. Results showed no statistical differences between the two groups at baseline. Body temperature, breast temperature, breast engorgement, pain levels, and discomforting levels were statistically different between the two groups at 5 and 30 min after intervention (p account. Our findings provided empirical evidence supporting that Gua-Sha therapy may be used as an effective technique in the management of breast engorgement. By using Gua-Sha therapy, nurses can handle breast engorgement problems more effectively in primary care and hence help patients both physically and psychologically.

  3. A comparative study of Message Digest 5(MD5) and SHA256 algorithm

    Science.gov (United States)

    Rachmawati, D.; Tarigan, J. T.; Ginting, A. B. C.

    2018-03-01

    The document is a collection of written or printed data containing information. The more rapid advancement of technology, the integrity of a document should be kept. Because of the nature of an open document means the document contents can be read and modified by many parties so that the integrity of the information as a content of the document is not preserved. To maintain the integrity of the data, it needs to create a mechanism which is called a digital signature. A digital signature is a specific code which is generated from the function of producing a digital signature. One of the algorithms that used to create the digital signature is a hash function. There are many hash functions. Two of them are message digest 5 (MD5) and SHA256. Those both algorithms certainly have its advantages and disadvantages of each. The purpose of this research is to determine the algorithm which is better. The parameters which used to compare that two algorithms are the running time and complexity. The research results obtained from the complexity of the Algorithms MD5 and SHA256 is the same, i.e., ⊖ (N), but regarding the speed is obtained that MD5 is better compared to SHA256.

  4. Insight into the mechanism of action of temporin-SHa, a new broad-spectrum antiparasitic and antibacterial agent.

    Directory of Open Access Journals (Sweden)

    Zahid Raja

    Full Text Available Antimicrobial peptides (AMPs are promising drugs to kill resistant pathogens. In contrast to bacteria, protozoan parasites, such as Leishmania, were little studied. Therefore, the antiparasitic mechanism of AMPs is still unclear. In this study, we sought to get further insight into this mechanism by focusing our attention on temporin-SHa (SHa, a small broad-spectrum AMP previously shown to be active against Leishmania infantum. To improve activity, we designed analogs of SHa and compared the antibacterial and antiparasitic mechanisms. [K3]SHa emerged as a highly potent compound active against a wide range of bacteria, yeasts/fungi, and trypanosomatids (Leishmania and Trypanosoma, with leishmanicidal intramacrophagic activity and efficiency toward antibiotic-resistant strains of S. aureus and antimony-resistant L. infantum. Multipassage resistance selection demonstrated that temporins-SH, particularly [K3]SHa, are not prone to induce resistance in Escherichia coli. Analysis of the mode of action revealed that bacterial and parasite killing occur through a similar membranolytic mechanism involving rapid membrane permeabilization and depolarization. This was confirmed by high-resolution imaging (atomic force microscopy and field emission gun-scanning electron microscopy. Multiple combined techniques (nuclear magnetic resonance, surface plasmon resonance, differential scanning calorimetry allowed us to detail peptide-membrane interactions. [K3]SHa was shown to interact selectively with anionic model membranes with a 4-fold higher affinity (KD = 3 x 10-8 M than SHa. The amphipathic α-helical peptide inserts in-plane in the hydrophobic lipid bilayer and disrupts the acyl chain packing via a detergent-like effect. Interestingly, cellular events, such as mitochondrial membrane depolarization or DNA fragmentation, were observed in L. infantum promastigotes after exposure to SHa and [K3]SHa at concentrations above IC50. Our results indicate that these

  5. How to apply SHA 2011 at a subnational level in China's practical situation: take children health expenditure as an example.

    Science.gov (United States)

    Li, Mingyang; Zheng, Ang; Duan, Wenjuan; Mu, Xin; Liu, Chunli; Yang, Yang; Wang, Xin

    2018-06-01

    System of Health Accounts 2011 (SHA 2011) is a new health care accounts system, revised from SHA 1.0 by the Organisation for Economic Co-operation and Development (OECD), the World Health Organization (WHO) and Eurostat. It keeps the former tri-axial relationship and develops three analytical interfaces, in order to fix the existing shortcomings and make it more convenient for analysis and comparison across countries. SHA 2011 was introduced in China in 2014, and little about its application in China has been reported. This study takes children as an example to study how to apply SHA 2011 at the subnational level in the practical situation of China's health system. Multistage random sampling method was applied and 3 532 517 samples from 252 institutions were included in the study. Official yearbooks and account reports helped the estimation of provincial data. The formula to calculate Current Health Expenditure (CHE) was introduced step-by-step. STATA 10.0 was used for statistics. Under the frame of SHA 2011, the CHE for children in Liaoning was calculated as US$ 0.74 billion in 2014; 98.56% of the expenditure was spent in hospital and the allocation to primary health care institutions was insufficient. Infection, maternal and prenatal diseases cost the most in terms of Global Burden of Disease (GBD), and respiratory system diseases took the leading place in terms of International Classification of Disease Tenth Revision (ICD-10). In addition, medical income contributed most to the health financing. The method to apply SHA 2011 at the subnational level is feasible in China. It makes health accounts more adaptable to rapidly developing health systems and makes the financing data more readily available for analytical use. SHA 2011 is a better health expenditure accounts system to reveal the actual burden on residents and deserves further promotion in China as well as around the world.

  6. BioShaDock: a community driven bioinformatics shared Docker-based tools registry.

    Science.gov (United States)

    Moreews, François; Sallou, Olivier; Ménager, Hervé; Le Bras, Yvan; Monjeaud, Cyril; Blanchet, Christophe; Collin, Olivier

    2015-01-01

    Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.

  7. Metal complexes of salicylhydroxamic acid (H2Sha), anthranilic hydroxamic acid and benzohydroxamic acid. Crystal and molecular structure of [Cu(phen)2(Cl)]Cl x H2Sha, a model for a peroxidase-inhibitor complex.

    Science.gov (United States)

    O'Brien, E C; Farkas, E; Gil, M J; Fitzgerald, D; Castineras, A; Nolan, K B

    2000-04-01

    Stability constants of iron(III), copper(II), nickel(II) and zinc(II) complexes of salicylhydroxamic acid (H2Sha), anthranilic hydroxamic acid (HAha) and benzohydroxamic acid (HBha) have been determined at 25.0 degrees C, I=0.2 mol dm(-3) KCl in aqueous solution. The complex stability order, iron(III) > copper(II) > nickel(II) approximately = zinc(II) was observed whilst complexes of H2Sha were found to be more stable than those of the other two ligands. In the preparation of ternary metal ion complexes of these ligands and 1,10-phenanthroline (phen) the crystalline complex [Cu(phen)2(Cl)]Cl x H2Sha was obtained and its crystal structure determined. This complex is a model for hydroxamate-peroxidase inhibitor interactions.

  8. Characterization of biocomposites of sheep hydroxyapatite (SHA)/shellac/sugar as bone filler material

    Science.gov (United States)

    Triyono, Joko; Rizha, Yushak; Triyono, Teguh

    2018-04-01

    The use of biomaterials in orthopedics is increasing. This led to the growth of innovations in the field of medicine, one of them is the development of biomaterials. Study of Sheep Hydroxyapatite (SHA)/shellac/sugar biocomposite characterization was to determine the phase of the material, porosity, hardness and compressive strength of them. This research was conducted to develop new types of biomaterials that can be used as bone filler material. The analysis that used in this research was dry methods. The results showed that observation of XRD (X-Ray Diffraction) shows the pattern of diffraction 2θ: 31.6472°, 32.7753°, 32.0723°, The highest hardness of SHA/shellac/sugar ratio was 70:30% (7.38±0.1395 VHN) and the lowest at 50:50% (4.91±0.37 VHN). The highest Diametral Tensile Strength (DTS) test was 70:30% (5.43±1.395 MPa) and the lowest at 50:50% (3.10±0.26 MPa). SEM observations are performed to see the material porosity.

  9. Dealing with completeness, structural hierarchy, and seismic coupling issues: three major challenges for #Fault2SHA

    Science.gov (United States)

    Valensise, Gianluca; Barba, Salvatore; Basili, Roberto; Bonini, Lorenzo; Burrato, Pierfrancesco; Carafa, Michele; Kastelic, Vanja; Fracassi, Umberto; Maesano, Francesco Emanuele; Tarabusi, Gabriele; Tiberti, Mara Monica; Vannoli, Paola

    2016-04-01

    The vast majority of active faulting studies are performed at the scale of individual, presumably seismogenic faults or fault strands. Most SHA approaches and models, however, require homogeneus information on potential earthquake sources over the entire tectonic domain encompassing the site(s) of interest. Although it is out of question that accurate SHA must rely on robust investigations of individual potential earthquake sources, it is only by gathering this information in regionally extensive databases that one can address some of the most outstanding issues in the use of #Fault2SHA. We will briefly recall three issues that are particularly relevant in the investigation of seismogenic faulting in southern Europe. A fundamental challenge is the completeness of the geologic record of active faulting. In most tectonic environments many potential seismogenic faults are blind or hidden, or deform the lower crust without leaving a discernible signal at the surface, or occur offshore, or slip so slowly that nontectonic erosional-depositional processes easily outpace their surface effects. Investigating only well-expressed faults is scientifically rewarding but also potentially misleading as it draws attention on the least insidious faults, leading to a potential underestimation of the regional earthquake potential. A further issue concerns the hierarchy of fault systems. Most active faults do not comprise seismogenic sources per se but are part of larger systems, and slip only in conjunction with the master fault of each system. In the most insidious cases, only secondary faults are expressed at the surface while the master fault lies hidden beneath them. This may result in an overestimation of the true number of seismogenic sources that occur in each region and in a biased identification of the characteristics of the main player in each system. Recent investigations of geologic and geodetic vs earthquake release budgets have shown that the "seismic coupling", which

  10. Side channel analysis of some hash based MACs:A response to SHA-3 requirements

    DEFF Research Database (Denmark)

    The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...... function which is more resistant to known side channel attacks (SCA) when plugged into HMAC, or that has an alternative MAC mode which is more resistant to known SCA than the other submitted alternatives. In response to this, we perform differential power analysis (DPA) on the possible smart card...... implementations of some of the recently proposed MAC alternatives to NMAC (a fully analyzed variant of HMAC) and HMAC algorithms and NMAC/HMAC versions of some recently proposed hash and compression function modes. We show that the recently proposed BNMAC and KMDP MAC schemes are even weaker than NMAC...

  11. A high speed low power low offset dynamic comparator used in SHA-less pipelined ADC

    Science.gov (United States)

    Shubin, Liu; Zhangming, Zhu; Yintang, Yang; Lianxi, Liu

    2014-05-01

    A novel fully differential high speed high resolution low offset CMOS dynamic comparator has been implemented in the SMIC 0.18 μm process used for a sample-and-hold amplifier (SHA)-less pipelined analog-to-digital converters (ADC). Based on the analysis and optimization between delay time and offset, an enhanced reset architecture with transmission gate was introduced to speed up the comparison and reset procedure. Four inputs with two cross coupled differential pairs, reconstituted bias circuit for tail current transistor and common centroid layouts make the comparator more robust against mismatch and process variations. The simulation results demonstrate that the proposed design achieves 1 mV sensitivity at 2.2 GHz sampling rate with a power consumption of 510 μW, while the mean offset voltage is equal to 10.244 mV.

  12. A Novel Digital Background Calibration Technique for 16 bit SHA-less Multibit Pipelined ADC

    Directory of Open Access Journals (Sweden)

    Swina Narula

    2016-01-01

    Full Text Available In this paper, a high resolution of 16 bit and high speed of 125MS/s, multibit Pipelined ADC with digital background calibration is presented. In order to achieve low power, SHA-less front end is used with multibit stages. The first and second stages are used here as a 3.5 bit and the stages from third to seventh are of 2.5 bit and last stage is of 3-bit flash ADC. After bit alignment and truncation of total 19 bits, 16 bits are used as final digital output. To precise the remove linear gain error of the residue amplifier and capacitor mismatching error, a digital background calibration technique is used, which is a combination of signal dependent dithering (SDD and butterfly shuffler. To improve settling time of residue amplifier, a special circuit of voltage separation is used. With the proposed digital background calibration technique, the spurious-free dynamic range (SFDR has been improved to 97.74 dB @30 MHz and 88.9 dB @150 MHz, and the signal-to-noise and distortion ratio (SNDR has been improved to 79.77 dB @ 30 MHz, and 73.5 dB @ 150 MHz. The implementation of the Pipelined ADC has been completed with technology parameters of 0.18μm CMOS process with 1.8 V supply. Total power consumption is 300 mW by the proposed ADC.

  13. Design Approach and Implementation of Application Specific Instruction Set Processor for SHA-3 BLAKE Algorithm

    Science.gov (United States)

    Zhang, Yuli; Han, Jun; Weng, Xinqian; He, Zhongzhu; Zeng, Xiaoyang

    This paper presents an Application Specific Instruction-set Processor (ASIP) for the SHA-3 BLAKE algorithm family by instruction set extensions (ISE) from an RISC (reduced instruction set computer) processor. With a design space exploration for this ASIP to increase the performance and reduce the area cost, we accomplish an efficient hardware and software implementation of BLAKE algorithm. The special instructions and their well-matched hardware function unit improve the calculation of the key section of the algorithm, namely G-functions. Also, relaxing the time constraint of the special function unit can decrease its hardware cost, while keeping the high data throughput of the processor. Evaluation results reveal the ASIP achieves 335Mbps and 176Mbps for BLAKE-256 and BLAKE-512. The extra area cost is only 8.06k equivalent gates. The proposed ASIP outperforms several software approaches on various platforms in cycle per byte. In fact, both high throughput and low hardware cost achieved by this programmable processor are comparable to that of ASIC implementations.

  14. Weixue Li

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Weixue Li. Articles written in Bulletin of Materials Science. Volume 29 Issue 3 June 2006 pp 313-316 Composites. Anisotropic properties of aligned SWNT modified poly (methyl methacrylate) nanocomposites · Weixue Li Qing Wang Jianfeng Dai · More Details Abstract Fulltext ...

  15. BioShaDock: a community driven bioinformatics shared Docker-based tools registry [version 1; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    François Moreews

    2015-12-01

    Full Text Available Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.

  16. A geochemical evaluation of the Ash Sha'ib mineral prospect, Asir quadrangle, Kingdom of Saudi Arabia

    Science.gov (United States)

    Allcott, Glenn H.

    1970-01-01

    The mineralized zone at the remotely located Ash Sha'ib ancient mine contains only a small tonnage of moderately low grade sulfide- bearing rock. Based on present data the gross value of the deposit, with a value of $25.00 or more per ton, is $20,000,000. A belt of metasedimentary rocks, intruded by gabbro to the south and granite to the north, was the host for fissure vein-replacement type mineralization. Most of the mineralization is in a siliceous dolomite transected by fissures. The main sulfide mineral is sphalerite, but minor amounts of chalcopyrlte and argentlferous galena contribute to the value of the mineralized sections.

  17. Hyperenhanced Li - Li Chemonuclear Fusion

    International Nuclear Information System (INIS)

    Ikegami, Hidetsugu

    2006-01-01

    A new fusion scheme, the Li - Li chemonuclear fusion is presented, where nuclear fusion reactions are linked to atomic fusion reactions. Lithium ions are implanted on a surface of metallic Li liquid at an energy of nuclear stopping (several keV/amu). The ions collide slowly with liquid Li atoms without electronic excitation and lead to the Li - Li chemonuclear fusion through the formation of united atoms or quasi-C atoms at their turning points. Inside the quasi-atoms twin nuclei are confined within respective sub-pm scale spheres of zero-point oscillation and form themselves into ultradense intermediate nuclear complexes. Their density is million times as large as the solar interior density and close to densities of white dwarfs or white-dwarf progenitors of supernovae. This confinement of nuclear complexes is enormously prolonged towards the pycno-nuclear reactions induced by the zero-point oscillation under the presence of thermodynamic force specified by the Gibbs energy change in the quasi-atom formation in the liquid. Resulted rate enhancement of nuclear fusion by a factor of 10 48 has been anticipated. The enhancement is also argued in connection with the Bose-Einstein condensation

  18. Shock absorber

    International Nuclear Information System (INIS)

    Nemeth, J.D.

    1981-01-01

    A shock absorber for the support of piping and components in a nuclear power plant is described. It combines a high degree of stiffness under sudden shocks, e.g. seismic disturbances, with the ability to allow for thermal expansion without resistance when so required. (JIW)

  19. Temperature measurement of tin under shock compression

    International Nuclear Information System (INIS)

    Hereil, Pierre-Louis; Mabire, Catherine

    2002-01-01

    The results of pyrometric measurements performed at the interface of a tin target with a LiF window material are presented for stresses ranging from 38 to 55 GPa. The purpose of the study is to analyze the part of the interface in the temperature measurement by a multi-channel pyrometric device. The results show that the glue used at target/window interface remains transparent under shock. The values of temperature measured at the tin/LiF interface are consistent with the behavior of tin under shock

  20. Shock induced melting of lead (experimental study)

    International Nuclear Information System (INIS)

    Mabire, Catherine; Hereil, Pierre L.

    2002-01-01

    To investigate melting on release of lead, two shock compression measurements have been carried out at 51 GPa. In the first one, a pyrometric measurement has been performed at the Pb/LiF interface. In the second one, the Pb/LiF interface velocity has been recorded using VISAR measurement technique. VISAR and radiance profile are in good agreement and seem to show melting on release of lead

  1. demystifying the shock of shocking

    African Journals Online (AJOL)

    (with a pulse), atrial fibrillation and atrial flutter. The energy dose in cardioversion is less (0.5. - 2 J/kg) than in defibrillation (2 - 4 J/kg). In cardioversion the shock is discharged synchronously with the native R wave of the patient. Without synchronisation,. VF can be induced if a shock is delivered during the refractory period ...

  2. Theatre as a Vortex of Behaviour in Dutch Multicultural Society: A Discourse Analysis of "Aïsha" in the Public Sphere

    NARCIS (Netherlands)

    van Heugten, L.

    2013-01-01

    In 2001, a music theatre production exploring Islam’s early history from a female perspective was shut down before it reached the stage. The cancellation of Aïsha and the Women of Madina by Rotterdam’s Independent Theatre (O.T.) generated a media storm as speculations about censorship mounted. To

  3. Hypovolemic shock

    Science.gov (United States)

    ... the person's position unless they are in immediate danger. Do not give fluids by mouth. If person ... the patient with shock. In: Goldman L, Schafer AI, eds. Goldman-Cecil Medicine . 25th ed. Philadelphia, PA: ...

  4. Shock absorber

    International Nuclear Information System (INIS)

    Housman, J.J.

    1978-01-01

    A shock absorber is described for use in a hostile environment at the end of a blind passage for absorbing impact loads. The shock absorber includes at least one element which occupies the passage and which is comprised of a porous brittle material which is substantially non-degradable in the hostile environment. A void volume is provided in the element to enable the element to absorb a predetermined level of energy upon being crushed due to impact loading

  5. RANCANG BANGUN APLIKASI ANTIVIRUS KOMPUTER DENGAN MENGGUNAKAN METODE SECURE HASH ALGORITHM 1 (SHA1 DAN HEURISTIC STRING

    Directory of Open Access Journals (Sweden)

    I Gusti Made Panji Indrawinatha

    2016-12-01

    Full Text Available Virus komputer merupakan perangkat lunak berbahaya yang dapat merusak data dan menggandakan diri pada sistem komputer. Untuk mendeteksi dan membersihkan virus dari sistem komputer, maka dibuatlah aplikasi antivirus. Dalam mendeteksi berbagai jenis virus sebuah aplikasi antivirus biasanya menggunakan beberapa metode. Pada penelitian ini akan membahas perancangan sebuah aplikasi antivirus menggunakan metode Secure Hash Algorithm 1 (SHA1 dan heuristic string sebagai metode pendeteksian virus. Dari pengujian yang dilakukan diperoleh hasil dimana saat tidak menggunakan heuristic, antivirus hanya mendeteksi 12 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 35%. sedangkan saat menggunakan heuristic, antivirus berhasil mendeteksi 31 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 91%.

  6. Toxic shock syndrome

    Science.gov (United States)

    Staphylococcal toxic shock syndrome; Toxic shock-like syndrome; TSLS ... Toxic shock syndrome is caused by a toxin produced by some types of staphylococcus bacteria. A similar problem, called toxic shock- ...

  7. Quaternary system LiF-LiCl-LiVO3-Li2MoO4

    International Nuclear Information System (INIS)

    Anipchenko, B.V.; Garkushin, I.K.

    2000-01-01

    Interactions in the LiF-LiCl-LiVO 3 -Li 2 MoO 4 system are studied by differential thermal analysis. Rate of heating/cooling of the samples comprised 15 Grad/min, mass of sample composed 0.2 g. The system was investigated in the 300-650 Deg C range. X-ray diffraction method was used for determination of purity of the reagents. Composition and temperature of quaternary component eutectics are determined: 16.5 mol. % of LiF, 47.0 mol. % of LiCl, 28.8 mol. % of LiVO 3 , 7.6 mol. % of Li 2 MoO 4 ; 387 Deg C. Mean value of melting enthalpy of quaternary eutectics mixture in the LiF-LiCl-LiVO 3 -Li 2 MoO 4 system on the results of the tests was in the range of 222 kJ/kg [ru

  8. Application of the ReNuMa model in the Sha He river watershed: tools for watershed environmental management.

    Science.gov (United States)

    Sha, Jian; Liu, Min; Wang, Dong; Swaney, Dennis P; Wang, Yuqiu

    2013-07-30

    Models and related analytical methods are critical tools for use in modern watershed management. A modeling approach for quantifying the source apportionment of dissolved nitrogen (DN) and associated tools for examining the sensitivity and uncertainty of the model estimates were assessed for the Sha He River (SHR) watershed in China. The Regional Nutrient Management model (ReNuMa) was used to infer the primary sources of DN in the SHR watershed. This model is based on the Generalized Watershed Loading Functions (GWLF) and the Net Anthropogenic Nutrient Input (NANI) framework, modified to improve the characterization of subsurface hydrology and septic system loads. Hydrochemical processes of the SHR watershed, including streamflow, DN load fluxes, and corresponding DN concentration responses, were simulated following calibrations against observations of streamflow and DN fluxes. Uncertainty analyses were conducted with a Monte Carlo analysis to vary model parameters for assessing the associated variations in model outputs. The model performed accurately at the watershed scale and provided estimates of monthly streamflows and nutrient loads as well as DN source apportionments. The simulations identified the dominant contribution of agricultural land use and significant monthly variations. These results provide valuable support for science-based watershed management decisions and indicate the utility of ReNuMa for such applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. An herbal medicine, Go-sha-jinki-gan (GJG, increases muscle weight in severe muscle dystrophy model mice

    Directory of Open Access Journals (Sweden)

    Yusei Takemoto

    2017-12-01

    Full Text Available Go-sha-jinki-gan (GJG, a traditional Japanese herbal medicine has a clinical implication to alleviate age-related symptoms, especially in some motor disorders. However, the scientific evidence is limited, and there is a possibility to expand the medical application range of GJG. Using senescence-accelerated mice, our group showed that GJG exerted an effect to prevent sarcopenia, the aged-related loss of skeletal muscle. Because muscular dystrophy is characterized by a progressive loss of skeletal muscle, we examined the effects of GJG on a mouse model of muscular dystrophy. Using a newly established mouse model for Duchenne muscular dystrophy (DMD, DBA/2-mdx, we showed that GJG significantly increased the body and skeletal muscle weights in comparison to the control DBA/2-mdx mice, regardless of gender. The increased skeletal muscle mass resulted from an increment in the myofiber size, but not from the myofiber number. Both the skeletal muscle regenerative ability and the accumulation of fibrosis (the dystrophic pathology in GJG-fed DBA/2-mdx mice were comparable to those in control DBA/2-mdx mice, suggesting that the cellular target of GJG is myofibers, with no contribution from the muscle satellite cells neither in an direct nor in an indirect manner. Taken together, GJG increased the skeletal muscle mass in a mouse model of muscular dystrophy, in addition to our previously tested sarcopenia mouse model.

  10. Shock Waves

    CERN Document Server

    Jiang, Z

    2005-01-01

    The International Symposium on Shock Waves (ISSW) is a well established series of conferences held every two years in a different location. A unique feature of the ISSW is the emphasis on bridging the gap between physicists and engineers working in fields as different as gas dynamics, fluid mechanics and materials sciences. The main results presented at these meetings constitute valuable proceedings that offer anyone working in this field an authoritative and comprehensive source of reference.

  11. Qanun raqam 68 li-sanat 1968 fi sha'n al-ta'lim al-am (Law No. 68 of 1968 Concerning General Education).

    Science.gov (United States)

    United Arab Republic.

    This document is an English-language abstract (approximately 1,500 words) of a law passed by the UAR legislation covering elementary, preparatory, and secondary education. This law covers general regulations common to all three stages of education, the objectives of which are defined as the general intellectual, physical, moral, civic and national…

  12. Laser shock peening of titanium 6-4 alloy

    International Nuclear Information System (INIS)

    Brar, N.S.; Hopkins, A.; Laber, M.W.

    2000-01-01

    Laser shock peening of titanium 6-4 has been shown to improve its high cycle fatigue life. Residual compressive stresses generated on the surface of titanium 6-4, as a result of laser shocking, have shown dramatic improvement in the performance of aircraft turbine blades. Laser shocking of titanium was carried out with a 20 ns pulse width, 50 joule pulsed laser, operated by LSP Technologies, Columbus, OH. Titanium disks, 20-mm in diameter, and ranging in thicknesses from zero (bare LiF) to 3-mm were subjected to laser shock to monitor amplitude and temporal stress profiles of the pulsed laser. Laser shock stress amplitudes on the back of titanium disks were monitored with VISAR using LiF as the window material. The peak shock stress produced in LiF (titanium thickness zero) was measured to be 16±1 GPa. The laser shock amplitude decays to about 2.7 GPa while propagating through 3-mm thick disk of titanium 6-4

  13. A contribution to the SHA of Eastern Thessaly, Central Greece: archaeological and historical evidences

    Science.gov (United States)

    Helly, B.; Caputo, R.; Tsafalias, A.

    2003-04-01

    Emperor August, to Tiberius as "benefactor and founder". During the excavations of the theatre, several evidences of damages of the building have been observed. Probably the most important and more impressive damages are represented by the displacement of some of the blocks of the walls and the rupture of some of the blocks. For example, some of the blocks show a typical concoid fracture clearly induced by a strong mechanical shock occurred in one of its corners. These rupture conditions are likely to be associated to the dynamic motion of the overlying block which acted as a hammer due to a strong acceleration. Numerous blocks are also dislocated and rotated. According to the size of the shifted blocks, their weight and the amount of displacement they suffered, we can tentatively estimate the peak acceleration occurred in the area and possibly the direction of the seismic waves. The collected archaeological and historical data, have been also compared with the available palaeoseismological data, while possible inferences for the seismic hazard of the region will be discussed.

  14. Changes in urinary Cu, Zn, and Se levels in cancer patients after treatment with Sha Shen Mai Men Dong Tang

    Directory of Open Access Journals (Sweden)

    Tung-Yuan Lai

    2016-04-01

    Full Text Available Sha Shen Mai Men Dong Tang (SMD-2; 沙參麥冬湯 shā shēn mài dōng tāng is a Chinese medicinal herb (CMH; 中草藥 zhōng cǎo yào used to treat symptoms associated with cancer therapy. The objective of this study was to assess the effect of SMD-2 on the levels of urinary copper (Cu, zinc (Zn, and selenium (Se in lung cancer patients and head and neck cancer patients receiving chemoradiotherapy. Forty-two head and neck cancer patients and 10 lung cancer patients participated in our clinical trial. Each patient received chemoradiotherapy for 4 weeks. In addition, each patient was treated with SMD-2 for 8 weeks, including 2 weeks prior to and after the chemoradiotherapy treatment. Comparison of urinary Cu, Zn, and Se levels and the ratios of Zn to Cu and Se to Cu at three time points in the two types of cancer were assessed using the generalized estimating equations (GEEs. After the patients received chemoradiotherapy for 4 weeks, SMD-2 treatment was found to be associated with a significant decrease in urinary Cu levels, whereas urinary Zn and Se levels increased significantly. In addition, the ratios of Zn to Cu and Se to Cu in the urine samples of these patients also increased significantly. Both the urinary Zn levels and the ratio of Zn to Cu in head and neck cancer patients were significantly higher than in lung cancer patients. Urinary Zn and Se levels and the ratios of Zn to Cu and Se to Cu, but not urinary Cu levels, increased significantly during and after treatment when assessed using the GEE model. The SMD-2 treatments significantly increased Zn and Se levels in the urine of head and neck cancer patients. Increased Zn and Se levels in urine strengthened immune system.

  15. Shock Prevention

    Science.gov (United States)

    1978-01-01

    The electrician pictured is installing a General Electric Ground Fault Interrupter (GFI), a device which provides protection against electrical shock in the home or in industrial facilities. Shocks due to defective wiring in home appliances or other electrical equipment can cause severe burns, even death. As a result, the National Electrical Code now requires GFIs in all new homes constructed. This particular type of GFI employs a sensing element which derives from technology acquired in space projects by SCI Systems, Inc., Huntsville, Alabama, producer of sensors for GE and other manufacturers of GFI equipment. The sensor is based on the company's experience in developing miniaturized circuitry for space telemetry and other spacecraft electrical systems; this experience enabled SCI to package interruptor circuitry in the extremely limited space available and to produce sensory devices at practicable cost. The tiny sensor measures the strength of the electrical current and detects current differentials that indicate a fault in the functioning of an electrical system. The sensing element then triggers a signal to a disconnect mechanism in the GFI, which cuts off the current in the faulty circuit.

  16. Thermophysical properties of multi-shock compressed dense argon.

    Science.gov (United States)

    Chen, Q F; Zheng, J; Gu, Y J; Chen, Y L; Cai, L C; Shen, Z J

    2014-02-21

    In contrast to the single shock compression state that can be obtained directly via experimental measurements, the multi-shock compression states, however, have to be calculated with the aid of theoretical models. In order to determine experimentally the multiple shock states, a diagnostic approach with the Doppler pins system (DPS) and the pyrometer was used to probe multiple shocks in dense argon plasmas. Plasma was generated by a shock reverberation technique. The shock was produced using the flyer plate impact accelerated up to ∼6.1 km/s by a two-stage light gas gun and introduced into the plenum argon gas sample, which was pre-compressed from the environmental pressure to about 20 MPa. The time-resolved optical radiation histories were determined using a multi-wavelength channel optical transience radiance pyrometer. Simultaneously, the particle velocity profiles of the LiF window was measured with multi-DPS. The states of multi-shock compression argon plasma were determined from the measured shock velocities combining the particle velocity profiles. We performed the experiments on dense argon plasmas to determine the principal Hugonoit up to 21 GPa, the re-shock pressure up to 73 GPa, and the maximum measure pressure of the fourth shock up to 158 GPa. The results are used to validate the existing self-consistent variational theory model in the partial ionization region and create new theoretical models.

  17. Collisionless electrostatic shocks

    DEFF Research Database (Denmark)

    Andersen, H.K.; Andersen, S.A.; Jensen, Vagn Orla

    1970-01-01

    An attempt was made in the laboratory to observe the standing collisionless electrostatic shocks in connection with the bow shock of the earth......An attempt was made in the laboratory to observe the standing collisionless electrostatic shocks in connection with the bow shock of the earth...

  18. Geometrical shock dynamics for magnetohydrodynamic fast shocks

    KAUST Repository

    Mostert, W.; Pullin, D. I.; Samtaney, Ravi; Wheatley, V.

    2016-01-01

    We describe a formulation of two-dimensional geometrical shock dynamics (GSD) suitable for ideal magnetohydrodynamic (MHD) fast shocks under magnetic fields of general strength and orientation. The resulting area–Mach-number–shock-angle relation is then incorporated into a numerical method using pseudospectral differentiation. The MHD-GSD model is verified by comparison with results from nonlinear finite-volume solution of the complete ideal MHD equations applied to a shock implosion flow in the presence of an oblique and spatially varying magnetic field ahead of the shock. Results from application of the MHD-GSD equations to the stability of fast MHD shocks in two dimensions are presented. It is shown that the time to formation of triple points for both perturbed MHD and gas-dynamic shocks increases as (Formula presented.), where (Formula presented.) is a measure of the initial Mach-number perturbation. Symmetry breaking in the MHD case is demonstrated. In cylindrical converging geometry, in the presence of an azimuthal field produced by a line current, the MHD shock behaves in the mean as in Pullin et al. (Phys. Fluids, vol. 26, 2014, 097103), but suffers a greater relative pressure fluctuation along the shock than the gas-dynamic shock. © 2016 Cambridge University Press

  19. Geometrical shock dynamics for magnetohydrodynamic fast shocks

    KAUST Repository

    Mostert, W.

    2016-12-12

    We describe a formulation of two-dimensional geometrical shock dynamics (GSD) suitable for ideal magnetohydrodynamic (MHD) fast shocks under magnetic fields of general strength and orientation. The resulting area–Mach-number–shock-angle relation is then incorporated into a numerical method using pseudospectral differentiation. The MHD-GSD model is verified by comparison with results from nonlinear finite-volume solution of the complete ideal MHD equations applied to a shock implosion flow in the presence of an oblique and spatially varying magnetic field ahead of the shock. Results from application of the MHD-GSD equations to the stability of fast MHD shocks in two dimensions are presented. It is shown that the time to formation of triple points for both perturbed MHD and gas-dynamic shocks increases as (Formula presented.), where (Formula presented.) is a measure of the initial Mach-number perturbation. Symmetry breaking in the MHD case is demonstrated. In cylindrical converging geometry, in the presence of an azimuthal field produced by a line current, the MHD shock behaves in the mean as in Pullin et al. (Phys. Fluids, vol. 26, 2014, 097103), but suffers a greater relative pressure fluctuation along the shock than the gas-dynamic shock. © 2016 Cambridge University Press

  20. Miniature shock tube for laser driven shocks.

    Science.gov (United States)

    Busquet, Michel; Barroso, Patrice; Melse, Thierry; Bauduin, Daniel

    2010-02-01

    We describe in this paper the design of a miniature shock tube (smaller than 1 cm(3)) that can be placed in a vacuum vessel and allows transverse optical probing and longitudinal backside extreme ultraviolet emission spectroscopy in the 100-500 A range. Typical application is the study of laser launched radiative shocks, in the framework of what is called "laboratory astrophysics."

  1. Are Credit Shocks Supply or Demand Shocks?

    OpenAIRE

    Bijapur, Mohan

    2013-01-01

    This paper provides new insights into the relationship between the supply of credit and the macroeconomy. We present evidence that credit shocks constitute shocks to aggregate supply in that they have a permanent effect on output and cause inflation to rise in the short term. Our results also suggest that the effects on aggregate supply have grown stronger in recent decades.

  2. Shock absorbing structure

    International Nuclear Information System (INIS)

    Kojima, Naoki; Matsushita, Kazuo.

    1992-01-01

    Small pieces of shock absorbers are filled in a space of a shock absorbing vessel which is divided into a plurality of sections by partitioning members. These sections function to prevent excess deformation or replacement of the fillers upon occurrence of falling accident. Since the shock absorbing small pieces in the shock absorbing vessel are filled irregularly, shock absorbing characteristics such as compression strength is not varied depending on the direction, but they exhibit excellent shock absorbing performance. They surely absorb shocks exerted on a transportation vessel upon falling or the like. If existing artificial fillers such as pole rings made of metal or ceramic and cut pieces such as alumium extrusion molding products are used as the shock absorbing pieces, they have excellent fire-proofness and cold resistance since the small pieces are inflammable and do not contain water. (T.M.)

  3. Melting under shock compression

    International Nuclear Information System (INIS)

    Bennett, B.I.

    1980-10-01

    A simple model, using experimentally measured shock and particle velocities, is applied to the Lindemann melting formula to predict the density, temperature, and pressure at which a material will melt when shocked from room temperature and zero pressure initial conditions

  4. Biomass shock pretreatment

    Science.gov (United States)

    Holtzapple, Mark T.; Madison, Maxine Jones; Ramirez, Rocio Sierra; Deimund, Mark A.; Falls, Matthew; Dunkelman, John J.

    2014-07-01

    Methods and apparatus for treating biomass that may include introducing a biomass to a chamber; exposing the biomass in the chamber to a shock event to produce a shocked biomass; and transferring the shocked biomass from the chamber. In some aspects, the method may include pretreating the biomass with a chemical before introducing the biomass to the chamber and/or after transferring shocked biomass from the chamber.

  5. Relativistic Shock Acceleration

    International Nuclear Information System (INIS)

    Duffy, P.; Downes, T.P.; Gallant, Y.A.; Kirk, J.G.

    1999-01-01

    In this paper we briefly review the basic theory of shock waves in relativistic hydrodynamics and magneto-hydrodynamics, emphasising some astrophysically interesting cases. We then present an overview of the theory of particle acceleration at such shocks describing the methods used to calculate the spectral indices of energetic particles. Recent results on acceleration at ultra-relativistic shocks are discussed. (author)

  6. Antioxidant effects of betulin on porcine chondrocyte behavior in gelatin/C6S/C4S/HA modified tricopolymer scaffold

    International Nuclear Information System (INIS)

    Lin, Wen-Yang; Lin, Feng-Huei; Sadhasivam, S.; Savitha, S.

    2010-01-01

    The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.

  7. Antioxidant effects of betulin on porcine chondrocyte behavior in gelatin/C6S/C4S/HA modified tricopolymer scaffold

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Wen-Yang; Lin, Feng-Huei [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Sadhasivam, S., E-mail: rahulsbio@yahoo.co.in [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Savitha, S. [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China)

    2010-05-10

    The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.

  8. Xiao Qing Li

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Xiao Qing Li. Articles written in Pramana – Journal of Physics. Volume 78 Issue 3 March 2012 pp 439-449 Research Articles. Modulation instability of an intense laser beam in an unmagnetized electron–positron–ion plasma · San Qiu Liu Wei Tang Xiao Qing Li · More Details ...

  9. Alfven shock trains

    International Nuclear Information System (INIS)

    Malkov, M.A.; Kennel, C.F.; Wu, C.C.; Pellat, R.; Shapiro, V.D.

    1991-01-01

    The Cohen--Kulsrud--Burgers equation (CKB) is used to consider the nonlinear evolution of resistive, quasiparallel Alfven waves subject to a long-wavelength, plane-polarized, monochromatic instability. The instability saturates by nonlinear steepening, which proceeds until the periodic waveform develops an interior scale length comparable to the dissipation length; a fast or an intermediate shock then forms. The result is a periodic train of Alfven shocks of one or the other type. For propagation strictly parallel to the magnetic field, there will be two shocks per instability wavelength. Numerical integration of the time-dependent CKB equation shows that an initial, small-amplitude growing wave asymptotes to a stable, periodic stationary wave whose analytic solution specifies how the type of shock embedded in the shock train, and the amplitude and speed of the shock train, depend on the strength and phase of the instability. Waveforms observed upstream of the Earth's bowshock and cometary shocks resemble those calculated here

  10. System Shock: The Archetype of Operational Shock

    Science.gov (United States)

    2017-05-25

    the battle space. They can also facilitate a much greater understanding of the variables involved in each party’s decision - making process. However...system shock nests within current US Army Unified Land Operations doctrine. In order to test the utility of system shock theory to Gray Zone...23 Neil E. Harrison, “Thinking about the World We Make ” in Chaos Theory in the Social Sciences: Foundations and Applications

  11. Li/Li2 supersonic nozzle beam

    International Nuclear Information System (INIS)

    Wu, C.Y.R.; Crooks, J.B.; Yang, S.C.; Way, K.R.; Stwalley, W.C.

    1977-01-01

    The characterization of a lithium supersonic nozzle beam was made using spectroscopic techniques. It is found that at a stagnation pressure of 5.3 kPa (40 torr) and a nozzle throat diameter of 0.4 mm the ground state vibrational population of Li 2 can be described by a Boltzmann distribution with T/sub v/ = 195 +- 30 0 K. The rotational temperature is found to be T/sub r/ = 70 +- 20 0 K by band shape analysis. Measurements by quadrupole mass spectrometer indicates that approximately 10 mole per cent Li 2 dimers are formed at an oven body temperature of 1370 0 K n the supersonic nozzle expansion. This measured mole fraction is in good agreement with the existing dimerization theory

  12. Hydrogen retention in Li and Li-C-O films

    Science.gov (United States)

    Buzi, Luxherta; Nelson, Andrew O.; Yang, Yuxin; Kaita, Robert; Koel, Bruce E.

    2017-10-01

    The efficiency of Li in binding H isotopes has led to reduced recycling in magnetic fusion devices and improved plasma performance. Since elemental Li surfaces are challenging to maintain in fusion devices due to the presence of impurities, parameterizing and understanding the mechanisms for H retention in various Li compounds (Li-C-O), in addition to pure Li, is crucial for Li plasma-facing material applications. To determine H retention in Li and Li-C-O films, measurements were done under ultrahigh vacuum conditions using temperature programmed desorption (TPD). Thin Li films (20 monolayers) were deposited on a nickel single crystal substrate and irradiated with 500 eV H2+ions at surface temperatures from 90K to 520K. Initial measurements on Li and Li-O films showed that the retention was comparable and dropped exponentially with surface temperature, from 95% at 90 K to 35% at 520 K. Auger electron spectroscopy and TPD showed that H was retained as lithium hydride (LiH) in pure Li and as lithium hydroxide (LiOH) in Li2O, which decomposed to H2O and Li2O at temperatures higher than 470K. H retention in Li-C and Li-C-O films will be determined over a similar temperature range, and the sputtering rate of these layers with H ions will also be reported. This material is based upon work supported by the U.S. Department of Energy, Office of Science/Fusion Energy Sciences under Award Number DE-SC0012890.

  13. Dynamic strength behavior of a Zr-based bulk metallic glass under shock loading

    International Nuclear Information System (INIS)

    Yu Yu-Ying; Xi Feng; Dai Cheng-Da; Cai Ling-Cang; Tan Ye; Li Xue-Mei; Wu Qiang; Tan Hua

    2015-01-01

    Dynamic strength behavior of Zr 51 Ti 5 Ni 10 Cu 25 Al 9 bulk metallic glass (BMG) up to 66 GPa was investigated in a series of plate impact shock-release and shock-reload experiments. Particle velocity profiles measured at the sample/LiF window interface were used to estimate the shear stress, shear modulus, and yield stress in shocked BMG. Beyond confirming the previously reported strain-softening of shear stress during the shock loading process for BMGs, it is also shown that the softened Zr-BMG still has a high shear modulus and can support large yield stress when released or reloaded from the shocked state, and both the shear modulus and the yield stress appear as strain-hardening behaviors. The work provides a much clearer picture of the strength behavior of BMGs under shock loading, which is useful to comprehensively understand the plastic deformation mechanisms of BMGs. (paper)

  14. Hydraulic shock absorbers

    International Nuclear Information System (INIS)

    Thatcher, G.; Davidson, D. F.

    1984-01-01

    A hydraulic shock absorber of the dash pot kind for use with electrically conducting liquid such as sodium, has magnet means for electro magnetically braking a stream of liquid discharged from the cylinder. The shock absorber finds use in a liquid metal cooled nuclear reactor for arresting control rods

  15. Our Favorite Film Shocks

    DEFF Research Database (Denmark)

    Willerslev, Rane; Suhr, Christian

    2014-01-01

    The modern medium of film has long been hailed for its capacity for producing shocks of an entertaining, thought-provoking, or even politically emancipative nature. But what is a shock, how and when does it occur, how long does it last, and are there particular techniques for producing cinematic...

  16. Climate shocks and conflict

    NARCIS (Netherlands)

    Papaioannou, Kostadis J.

    2016-01-01

    This paper offers a historical micro-level analysis of the impact of climate shocks on the incidence of civil conflict in colonial Nigeria (1912-1945). Primary historical sources on court cases, prisoners and homicides are used to capture conflict. To measure climate shocks we use the deviation

  17. Corrosion of type 316 stainless steel in molten LiF-LiCl-LiBr

    International Nuclear Information System (INIS)

    Tortorelli, P.F.; DeVan, J.H.; Keiser, J.R.

    1981-01-01

    The properties of LiF-LiCl-LiBr salt make it attractive as a solvent for extracting tritium from a fusion reactor lithium blanket. Consequently, the corrosion of type 316 stainless steel by flowing (about 15 mm/s) LiF-LiCl-LiBr at a maximum temperature of 535 0 C was studied to determine whether compatibility with the structural material would be limiting in such a system. The corrosion rate was found to be low ( 0 C (approximately that of type 316 stainless steel exposed to lithium flowing at a similar velocity). At the proposed operating temperature (less than or equal to approx. 535 0 C), however, it appears that type 316 stainless steel has acceptable compatibility with the tritium-processing salt LiF-LiCl-LiBr for use with a lithium blanket

  18. Preliminary analysis of the sandstone accumulation situation at Sha-3 of the Paleogene Series Shakhetsze in the Khekou basin of the Tsziyan region

    Energy Technology Data Exchange (ETDEWEB)

    Chen, S

    1984-01-01

    The Khekou basin of the second order which is located in the Eastern part of the Tsziyan basin in the oil and gas Bokhayvan'skiy pool has an area of about 900 km/sup 2/. The main productive level occurs in sandstone beds in the Sha-3 subseries (reaching thickness of about 400 m) of the Shakhetsze series. The Bonan oil field was discovered in this region in 1975. The initially productive deposits were viewed as fluvial-delta; however, studies of recent years, including investigation of the sedimentation sequences and the structures that mark the surfaces of the microscopic level in the core sample, together with an analysis of borehole geophysical data, indicated that the sandy bodies of the productive beds in the basin must be viewed as deposits of turbidite flows and deposits of gravitational flows in channels. Insofar as distribution of the turbidite sandstones differs significantly from the delta, this led to a review of the long-term trends in the neighboring fields.

  19. Collisionless shock waves

    International Nuclear Information System (INIS)

    Sagdeev, R.Z.; Kennel, C.F.

    1991-01-01

    Collisionless shocks cannot occur naturally on the earth, because nearly all matter here consists of electrically neutral atoms and molecules. In space, however, high temperatures and ultraviolet radiation from hot stars decompose atoms into their constituent nuclei and electrons, producing a soup of electrically charged particles known as a plasma. Plasma physicists proposed that the collective electrical and magnetic properties of plasmas could produce interactions that take the place of collisions and permit shocks to form. In 1964 the theoretical work found its first experimental confirmation. Norman F. Ness and his colleagues at the Goddard Space Flight Center, using data collected from the iMP-1 spacecraft, detected clear signs that a collisionless shock exists where the solar wind encounters the earth's magnetic field. More recent research has demonstrated that collisionless shocks appear in a dazzling array of astronomical settings. For example, shocks have been found in the solar wind upstream (sunward) of all the planet and comets that have been visited by spacecraft. Violent flares on the sun generate shocks that propagate to the far reaches of the solar system; tremendous galactic outbursts create disruptions in the intergalactic medium that are trillions of times larger. In addition, many astrophysicists think that shocks from supernova explosions in our galaxy accelerate cosmic rays, a class of extraordinarily energetic elementary particles and atomic nuclei that rain down on the earth from all directions

  20. Pediatric Toxic Shock Syndrome

    Directory of Open Access Journals (Sweden)

    Jennifer Yee

    2017-09-01

    Full Text Available Audience: This scenario was developed to educate emergency medicine residents on the diagnosis and management of a pediatric patient with toxic shock syndrome. The case is also appropriate for teaching of medical students and advanced practice providers, as well as a review of the principles of crisis resource management, teamwork, and communication. Introduction: Toxic shock syndrome is a low-frequency, high-acuity scenario requiring timely identification and aggressive management. If patients suffering from this condition are managed incorrectly, they may progress into multi-organ dysfunction and potentially death. Toxic shock syndrome has been associated with Streptococcus and Staphylococcus aureus (Staph. Approximately half of Staph cases are associated with menstruation, which was first described in the 1970s-1980s and was associated with the use of absorbent tampons.1 Group A Streptococcus may cause complications such as necrotizing fasciitis and gangrenous myositis.2 Pediatric patients may present critically ill from toxic shock syndrome. Providers need to perform a thorough history and physical exam to discern the source of infection. Management requires aggressive care with antibiotics and IV fluids. Objectives: By the end of this simulation session, the learner will be able to: 1 Recognize toxic shock syndrome. 2 Review the importance of a thorough physical exam. 3 Discuss management of toxic shock syndrome, including supportive care and the difference in antibiotic choices for streptococcal and staphylococcal toxic shock syndrome. 4 Appropriately disposition a patient suffering from toxic shock syndrome. 5 Communicate effectively with team members and nursing staff during a resuscitation of a critically ill patient. Method: This session was conducted using high-fidelity simulation, followed by a debriefing session and lecture on toxic shock syndrome.

  1. Electrochemical Behavior of LiBr, LiI, and Li2Se in LiCl Molten Salt

    International Nuclear Information System (INIS)

    Choi, In Kyu; Do, Jae Bum; Hong, Sun Seok; Seo, Chung Seok

    2006-03-01

    The effect of fission products on the electrolytic reduction of uranium oxide has been studied. It has been reported that volatile fission products, such as Br, I, and Se, react with Li metal which is a reductant in the process to give LiBr, LiI, and Li 2 Se. These compounds are dissociated as corresponding anions and cations in the LiCl molten salt at 650 .deg. C. In this experiment, oxidation and reduction reaction of 3wt% of each compound in LiCl molten salt were investigated by cyclic voltammetry. For LiBr, redox reactions of cation and anion were reversible, while redox reactions of Li + and I - were irreversible. For Li 2 Se, about half of the produced Li metal was disappeared at the cathode and two anodic current curves were appeared. After the cyclic voltammetric measurements for each compound, chronopotentiometric experiment was carried out for one hour with 100 - 400 mA. After the electrolysis, no compounds gave Li metal in the porous MgO filter in which Li metal was produced at the cathode. However, LiCl salt was covered with Br 2 for LiBr electrolysis. Dark red color of Br 2 was easily removed by water. For LiI electrolysis, salt gave black color and I 2 was deposited on the Pt anode. For Li 2 Se electrolysis, black fine powders were precipitated in the salt. After the separation and dryness of the precipitates, it was analyzed with XRD and it turned out PtSe 2 . From the electrochemical experimental results, it was concluded that these compounds may affect the electrolytic reduction process of uranium oxide in the spent fuel

  2. Shocks near Jamming

    Science.gov (United States)

    Gómez, Leopoldo R.; Turner, Ari M.; van Hecke, Martin; Vitelli, Vincenzo

    2012-02-01

    Nonlinear sound is an extreme phenomenon typically observed in solids after violent explosions. But granular media are different. Right when they jam, these fragile and disordered solids exhibit a vanishing rigidity and sound speed, so that even tiny mechanical perturbations form supersonic shocks. Here, we perform simulations in which two-dimensional jammed granular packings are dynamically compressed and demonstrate that the elementary excitations are strongly nonlinear shocks, rather than ordinary phonons. We capture the full dependence of the shock speed on pressure and impact intensity by a surprisingly simple analytical model.

  3. Mechanical shock absorber

    International Nuclear Information System (INIS)

    Vrillon, Bernard.

    1973-01-01

    The mechanical shock absorber described is made of a constant thickness plate pierced with circular holes regularly distributed in such a manner that for all the directions along which the strain is applied during the shock, the same section of the substance forming the plate is achieved. The shock absorber is made in a metal standing up to extensive deformation before breaking, selected from a group comprising mild steels and austenitic stainless steels. This apparatus is used for handling pots of fast neutron reactor fuel elements [fr

  4. Shock formation of HCO+

    International Nuclear Information System (INIS)

    Elitzur, M.

    1983-01-01

    It is shown that shocks propagating in dense molecular regions will lead to a decrease in HCO + relative abundance, in agreement with previous results by Iglesias and Silk. The shock enhancement of HCO + detected in the supernova remnant IC 443 by Dickenson et al. is due to enhanced ionization in the shocked material. This is the result of the material penetrating the remnant cavity where it becomes exposed to the trapped cosmic rays. A similar enhancement appears to have been detected by Wootten in W28 and is explained by the same model

  5. Shock Isolation Elements Testing for High Input Loadings. Volume II. Foam Shock Isolation Elements.

    Science.gov (United States)

    SHOCK ABSORBERS ), (*GUIDED MISSILE SILOS, SHOCK ABSORBERS ), (*EXPANDED PLASTICS, (*SHOCK(MECHANICS), REDUCTION), TEST METHODS, SHOCK WAVES, STRAIN(MECHANICS), LOADS(FORCES), MATHEMATICAL MODELS, NUCLEAR EXPLOSIONS, HARDENING.

  6. Effective Shear Viscosity of Iron under Shock-Loading Condition

    International Nuclear Information System (INIS)

    Ma Xiao-Juan; Liu Fu-Sheng; Sun Yan-Yun; Zhang Ming-Jian; Peng Xiao-Juan; Li Yong-Hong

    2011-01-01

    We combine the flyer-impact experiment and improve the finite difference method to solve whether the shear viscosity coefficient of shock iron is more reliable. We find that the numerical simulated profile agrees well with the measured one, from which the determined effective shear viscosity coefficients of shocked iron are 3000 ± 100 Pa·s and 4000 ± 100 Pa·s, respectively, at 103 GPa and 159 GPa. These values are more than 2000 ± 300 Pa·s of Li Y L et al.[Chin. Phys. Lett. 26 (2009) 038301] Our values are more reasonable because they are obtained from a comprehensive simulation for the full-shocked perturbation evolving process. (fundamental areas of phenomenology(including applications))

  7. Counseling For Future Shock

    Science.gov (United States)

    Morgan, Lewis B.

    1974-01-01

    In this article the author looks at some of the searing prophecies made by Alvin Toffler in his book Future Shock and relates them to the world of the professional counselor and the clientele the counselor attempts to serve. (Author)

  8. Life shocks and homelessness.

    Science.gov (United States)

    Curtis, Marah A; Corman, Hope; Noonan, Kelly; Reichman, Nancy E

    2013-12-01

    We exploited an exogenous health shock-namely, the birth of a child with a severe health condition-to investigate the effect of a life shock on homelessness in large cities in the United States as well as the interactive effects of the shock with housing market characteristics. We considered a traditional measure of homelessness, two measures of housing instability thought to be precursors to homelessness, and a combined measure that approximates the broadened conceptualization of homelessness under the 2009 Homeless Emergency Assistance and Rapid Transition to Housing Act (2010). We found that the shock substantially increases the likelihood of family homelessness, particularly in cities with high housing costs. The findings are consistent with the economic theory of homelessness, which posits that homelessness results from a conjunction of adverse circumstances in which housing markets and individual characteristics collide.

  9. Unlimited Relativistic Shock Surfing Acceleration

    International Nuclear Information System (INIS)

    Ucer, D.; Shapiro, V. D.

    2001-01-01

    Nonrelativistic shock surfing acceleration at quasiperpendicular shocks is usually considered to be a preacceleration mechanism for slow pickup ions to initiate diffusive shock acceleration. In shock surfing, the particle accelerates along the shock front under the action of the convective electric field of the plasma flow. However, the particle also gains kinetic energy normal to the shock and eventually escapes downstream. We consider the case when ions are accelerated to relativistic velocities. In this case, the ions are likely to be trapped for infinitely long times, because the energy of bounce oscillations tends to decrease during acceleration. This suggests the possibility of unlimited acceleration by shock surfing

  10. Mass of 11Li from the 1H(11Li,9Li)3H reaction

    International Nuclear Information System (INIS)

    Roger, T.; Savajols, H.; Mittig, W.; Caamano, M.; Roussel-Chomaz, P.; Tanihata, I.; Alcorta, M.; Bandyopadhyay, D.; Bieri, R.; Buchmann, L.; Davids, B.; Galinski, N.; Howell, D.; Mills, W.; Mythili, S.; Openshaw, R.; Padilla-Rodal, E.; Ruprecht, G.; Sheffer, G.; Shotter, A. C.

    2009-01-01

    The mass of 11 Li has been determined from Q-value measurements of the 1 H( 11 Li, 9 Li) 3 H reaction. The experiment was performed at TRIUMF laboratory with the GANIL active target MAYA. Energy-energy and angle-angle kinematics reconstruction give a Q value of 8.119(22) MeV for the reaction. The derived 11 Li two-neutron separation energy is S 2n =363(22) keV

  11. Technology shocks matter

    OpenAIRE

    Jonas D. M. Fisher

    2002-01-01

    This paper uses the neoclassical growth model to identify the effects of technological change on the US business cycle. In the model there are two sources of technological change: neutral, which effects the production of all goods homogeneously, and investment-specific. Investment-specific shocks are the unique source of the secular trend in the real price of investment goods, while shocks to both kinds of technology are the only factors which affect labor productivity in the long run. Consis...

  12. The Heliospheric Termination Shock

    Science.gov (United States)

    Jokipii, J. R.

    2013-06-01

    The heliospheric termination shock is a vast, spheroidal shock wave marking the transition from the supersonic solar wind to the slower flow in the heliosheath, in response to the pressure of the interstellar medium. It is one of the most-important boundaries in the outer heliosphere. It affects energetic particles strongly and for this reason is a significant factor in the effects of the Sun on Galactic cosmic rays. This paper summarizes the general properties and overall large-scale structure and motions of the termination shock. Observations over the past several years, both in situ and remote, have dramatically revised our understanding of the shock. The consensus now is that the shock is quite blunt, is with the front, blunt side canted at an angle to the flow direction of the local interstellar plasma relative to the Sun, and is dynamical and turbulent. Much of this new understanding has come from remote observations of energetic charged particles interacting with the shock, radio waves and radiation backscattered from interstellar neutral atoms. The observations and the implications are discussed.

  13. The evaluation of marine traffic noise and its effect on the Chinese White Dolphins in Sha Chau and Lung Kwu Chau Marine Park, Hong Kong

    Science.gov (United States)

    Chan, T.

    2016-12-01

    The Hong Kong International Airport (HKIA) handles a large amount of air traffic, at 68.5 million passengers per year (approx. 40.1 million flights per year). Given that flight demand is forecast to reach 97 million passengers per year (approx 60.2 million flights per year) by 2030, the HKIA must optimise runway capacity in order to meet growing demand. Hence, the Airport Authority Hong Kong (AAHK) has put forward a proposal to expand the airport into a three-runway system by building a third runway. However, this presents many environmental constraints. These include major impacts on marine ecology; especially the Chinese White Dolphins (Sousa chinensis) that live around the Sha Chau and Lung Kwu Chau Marine Park north to the airport. Due to that the third runway will reclaim approximately 650 hectares of the se so re-routing of speed boats and ferries has been planned. This includes one route that passes through the marine nursery inside the park. This indirectly causes noise pollution that will affect marine life. Since dolphins rely on echolocation (often discerned by a "click" sound) to communicate and navigate, increasing marine traffic (re-routing) causes obscuring noises and acoustic communication interfering with echolocation, as well as collisions which lead to physical injuries. Underwater construction works involving techniques such as percussive piling may interfere with the dolphins' echolocation capability. The data has been collected using a hydrophone by observing the noise frequency changes within the marine park. The noises come from a number of sources, including fishing boats, and speed boats, krill and around 20 estuarine fish species. The evaluation of four years (2013-2016) has shown that noise pollution is increasing (as indicated by the increase of frequencies around 100 125 kHz) and that it has caused disruption in regular dolphin movement (irregular clicking sequence) .

  14. Shocks in fragile matter

    Science.gov (United States)

    Vitelli, Vincenzo

    2012-02-01

    Non-linear sound is an extreme phenomenon typically observed in solids after violent explosions. But granular media are different. Right when they unjam, these fragile and disordered solids exhibit vanishing elastic moduli and sound speed, so that even tiny mechanical perturbations form supersonic shocks. Here, we perform simulations in which two-dimensional jammed granular packings are continuously compressed, and demonstrate that the resulting excitations are strongly nonlinear shocks, rather than linear waves. We capture the full dependence of the shock speed on pressure and compression speed by a surprisingly simple analytical model. We also treat shear shocks within a simplified viscoelastic model of nearly-isostatic random networks comprised of harmonic springs. In this case, anharmonicity does not originate locally from nonlinear interactions between particles, as in granular media; instead, it emerges from the global architecture of the network. As a result, the diverging width of the shear shocks bears a nonlinear signature of the diverging isostatic length associated with the loss of rigidity in these floppy networks.

  15. Physics of Collisionless Shocks Space Plasma Shock Waves

    CERN Document Server

    Balogh, André

    2013-01-01

    The present book provides a contemporary systematic treatment of shock waves in high-temperature collisionless plasmas as are encountered in near Earth space and in Astrophysics. It consists of two parts. Part I develops the complete theory of shocks in dilute hot plasmas under the assumption of absence of collisions among the charged particles when the interaction is mediated solely by the self-consistent electromagnetic fields. Such shocks are naturally magnetised implying that the magnetic field plays an important role in their evolution and dynamics. This part treats both subcritical shocks, which dissipate flow energy by generating anomalous resistance or viscosity, and supercritical shocks. The main emphasis is, however, on super-critical shocks where the anomalous dissipation is insufficient to retard the upstream flow. These shocks, depending on the direction of the upstream magnetic field, are distinguished as quasi-perpendicular and quasi-parallel shocks which exhibit different behaviours, reflecti...

  16. Life Shocks and Homelessness

    Science.gov (United States)

    Corman, Hope; Noonan, Kelly; Reichman, Nancy E.

    2014-01-01

    We exploited an exogenous health shock—namely, the birth of a child with a severe health condition—to investigate the effect of a life shock on homelessness in large cities in the United States as well as the interactive effects of the shock with housing market characteristics. We considered a traditional measure of homelessness, two measures of housing instability thought to be precursors to homelessness, and a combined measure that approximates the broadened conceptualization of homelessness under the 2009 Homeless Emergency Assistance and Rapid Transition to Housing Act (2010). We found that the shock substantially increases the likelihood of family homelessness, particularly in cities with high housing costs. The findings are consistent with the economic theory of homelessness, which posits that homelessness results from a conjunction of adverse circumstances in which housing markets and individual characteristics collide. PMID:23868747

  17. Health Shocks and Retirement:

    DEFF Research Database (Denmark)

    Datta Gupta, Nabanita; Larsen, Mona

    We investigate the effect of an acute health shock on retirement among elderly male workers in Denmark, 1991-1999, and in particular whether various welfare state programs and institutions impinge on the retirement effect. The results show that an acute health event increases the retirement chances...... significant. For the most part, the retirement effect following a health shock seems to be immune to the availability of a multitude of government programs for older workers in Denmark....... benefits in Denmark nor by the promotion of corporate social responsibility initiatives since the mid-1990s. In the late 1990s, however, the retirement rate following a health shock is reduced to 3% with the introduction of the subsidized employment program (fleksjob) but this effect is not strongly...

  18. Electronic Properties of LiFePO4 and Li doped LiFePO4

    International Nuclear Information System (INIS)

    Zhuang, G.V.; Allen, J.L.; Ross, P.N.; Guo, J.-H.; Jow, T.R.

    2005-01-01

    The potential use of different iron phosphates as cathode materials in lithium-ion batteries has recently been investigated.1 One of the promising candidates is LiFePO4. This compound has several advantages in comparison to the state-of-the-art cathode material in commercial rechargeable lithium batteries. Firstly, it has a high theoretical capacity (170 mAh/g). Secondly, it occurs as mineral triphylite in nature and is inexpensive, thermally stable, non-toxic and non-hygroscopic. However, its low electronic conductivity (∼10-9 S/cm) results in low power capability. There has been intense worldwide research activity to find methods to increase the electronic conductivity of LiFePO4, including supervalent ion doping,2 introducing non-carbonaceous network conduction3 and carbon coating, and the optimization of the carbon coating on LiFePO4 particle surfaces.4 Recently, the Li doped LiFePO4 (Li1+xFe1-xPO4) synthesized at ARL has yield electronic conductivity increase up to 106.5 We studied electronic structure of LiFePO4 and Li doped LiFePO4 by synchrotron based soft X-ray emission (XES) and X-ray absorption (XAS) spectroscopies. XAS probes the unoccupied partial density of states, while XES the occupied partial density of states. By combining XAS and XES measurements, we obtained information on band gap and orbital character of both LiFePO4 and Li doped LiFePO4. The occupied and unoccupied oxygen partial density of states (DOS) of LiFePO4 and 5 percent Li doped LiFePO4 are presented in Fig. 1. Our experimental results clearly indicate that LiFePO4 has wideband gap (∼ 4 eV). This value is much larger than what is predicted by DFT calculation. For 5 percent Li doped LiFePO4, a new doping state was created closer to the Fermi level, imparting p-type conductivity, consistent with thermopower measurement. Such observation substantiates the suggestion that high electronic conductivity in Li1.05Fe0.95 PO4 is due to available number of charge carriers in the material

  19. The Shock Routine

    DEFF Research Database (Denmark)

    van Hooren, Franca; Kaasch, Alexandra; Starke, Peter

    2014-01-01

    in Australia, Belgium, the Netherlands and Sweden over the course of four global economic shocks, we ask whether the notion of critical junctures is useful in understanding the nature of change triggered by crisis. The main empirical finding is that fundamental change in the aftermath of an exogenous shock...... is the exception rather than the rule. Instead, incremental ‘crisis routines’ based on existing policy instruments are overwhelmingly used to deal with economic hardship. We discuss these findings in the light of the psychological ‘threat-rigidity’ effect and reflect on their consequences for theories...

  20. Shock absorber in Ignalina NPP

    International Nuclear Information System (INIS)

    Bulavas, A.; Muralis, J.

    1996-09-01

    Theoretical calculation and experimental analysis of models of shock absorber in Ignalina NPP is presented. The results obtained from the investigation with model of shock absorber coincide with the theoretical calculation. (author). 2 figs., 3 refs

  1. Shock Response of Boron Carbide

    National Research Council Canada - National Science Library

    Dandekar, D. P. (Dattatraya Purushottam)

    2001-01-01

    .... The present work was undertaken to determine tensile/spall strength of boron carbide under plane shock wave loading and to analyze all available shock compression data on boron carbide materials...

  2. Fascinating World of Shock Waves

    Indian Academy of Sciences (India)

    Srimath

    travelling at supersonic speeds (more than the sound speed at ... actual earth- quake, travel at supersonic speeds. .... The time scale of the shock wave is also important ..... real lithotripsy where a shock wave is used shatter the kidney stones!

  3. INTERFERENCE OF UNIDIRECTIONAL SHOCK WAVES

    Directory of Open Access Journals (Sweden)

    P. V. Bulat

    2015-05-01

    Full Text Available Subject of study.We consider interference of unidirectional shock waves or, as they are called, catching up shock waves. The scope of work is to give a classification of the shock-wave structures that arise in this type of interaction of shock waves, and the area of their existence. Intersection of unidirectional shock waves results in arising of a shock-wave structure at the intersection point, which contains the main shock wave, tangential discontinuity and one more reflected gas-dynamic discontinuity of unknown beforehand type. The problem of determining the type of reflected discontinuity is the main problem that one has to solve in the study of catching shock waves interference. Main results.The paper presents the pictures of shock-wave structures arising at the interaction of catching up shock waves. The areas with a regular and irregular unidirectional interaction of shocks are described. Characteristic shock-wave structures are of greatest interest, where reflected gas-dynamic discontinuity degenerates into discontinuous characteristics. Such structures have a number of extreme properties. We have found the areas of existence for such shock-wave structures. There are also areas in which the steady-state solution is not available. The latter has determined revival of interest for the theoretical study of the problem, because the facts of sudden shock-wave structure destruction inside the air intake of supersonic aircrafts at high Mach numbers have been discovered. Practical significance.The theory of interference for unidirectional shock waves and design procedure are usable in the design of supersonic air intakes. It is also relevant for application possibility investigation of catching up oblique shock waves to create overcompressed detonation in perspective detonation air-jet and rocket engines.

  4. Shock tube Multiphase Experiments

    Science.gov (United States)

    Middlebrooks, John; Allen, Roy; Paudel, Manoj; Young, Calvin; Musick, Ben; McFarland, Jacob

    2017-11-01

    Shock driven multiphase instabilities (SDMI) are unique physical phenomena that have far-reaching practical applications in engineering and science. The instability is present in high energy explosions, scramjet combustors, and supernovae events. The SDMI arises when a multiphase interface is impulsively accelerated by the passage of a shockwave. It is similar in development to the Richtmyer-Meshkov (RM) instability however, particle-to-gas coupling is the driving mechanism of the SDMI. As particle effects such as lag and phase change become more prominent, the SDMI's development begins to significantly deviate from the RM instability. We have developed an experiment for studying the SDMI in our shock tube facility. In our experiments, a multiphase interface is created using a laminar jet and flowed into the shock tube where it is accelerated by the passage of a planar shockwave. The interface development is captured using CCD cameras synchronized with planar laser illumination. This talk will give an overview of new experiments conducted to examine the development of a shocked cylindrical multiphase interface. The effects of Atwood number, particle size, and a second acceleration (reshock) of the interface will be discussed.

  5. Teleconnected food supply shocks

    Science.gov (United States)

    Bren d'Amour, Christopher; Wenz, Leonie; Kalkuhl, Matthias; Steckel, Jan Christoph; Creutzig, Felix

    2016-03-01

    The 2008-2010 food crisis might have been a harbinger of fundamental climate-induced food crises with geopolitical implications. Heat-wave-induced yield losses in Russia and resulting export restrictions led to increases in market prices for wheat across the Middle East, likely contributing to the Arab Spring. With ongoing climate change, temperatures and temperature variability will rise, leading to higher uncertainty in yields for major nutritional crops. Here we investigate which countries are most vulnerable to teleconnected supply-shocks, i.e. where diets strongly rely on the import of wheat, maize, or rice, and where a large share of the population is living in poverty. We find that the Middle East is most sensitive to teleconnected supply shocks in wheat, Central America to supply shocks in maize, and Western Africa to supply shocks in rice. Weighing with poverty levels, Sub-Saharan Africa is most affected. Altogether, a simultaneous 10% reduction in exports of wheat, rice, and maize would reduce caloric intake of 55 million people living in poverty by about 5%. Export bans in major producing regions would put up to 200 million people below the poverty line at risk, 90% of which live in Sub-Saharan Africa. Our results suggest that a region-specific combination of national increases in agricultural productivity and diversification of trade partners and diets can effectively decrease future food security risks.

  6. STEREO interplanetary shocks and foreshocks

    International Nuclear Information System (INIS)

    Blanco-Cano, X.; Kajdič, P.; Aguilar-Rodríguez, E.; Russell, C. T.; Jian, L. K.; Luhmann, J. G.

    2013-01-01

    We use STEREO data to study shocks driven by stream interactions and the waves associated with them. During the years of the extended solar minimum 2007-2010, stream interaction shocks have Mach numbers between 1.1-3.8 and θ Bn ∼20-86°. We find a variety of waves, including whistlers and low frequency fluctuations. Upstream whistler waves may be generated at the shock and upstream ultra low frequency (ULF) waves can be driven locally by ion instabilities. The downstream wave spectra can be formed by both, locally generated perturbations, and shock transmitted waves. We find that many quasiperpendicular shocks can be accompanied by ULF wave and ion foreshocks, which is in contrast to Earth's bow shock. Fluctuations downstream of quasi-parallel shocks tend to have larger amplitudes than waves downstream of quasi-perpendicular shocks. Proton foreshocks of shocks driven by stream interactions have extensions dr ≤0.05 AU. This is smaller than foreshock extensions for ICME driven shocks. The difference in foreshock extensions is related to the fact that ICME driven shocks are formed closer to the Sun and therefore begin to accelerate particles very early in their existence, while stream interaction shocks form at ∼1 AU and have been producing suprathermal particles for a shorter time.

  7. STEREO interplanetary shocks and foreshocks

    Energy Technology Data Exchange (ETDEWEB)

    Blanco-Cano, X. [Instituto de Geofisica, UNAM, CU, Coyoacan 04510 DF (Mexico); Kajdic, P. [IRAP-University of Toulouse, CNRS, Toulouse (France); Aguilar-Rodriguez, E. [Instituto de Geofisica, UNAM, Morelia (Mexico); Russell, C. T. [ESS and IGPP, University of California, Los Angeles, 603 Charles Young Drive, Los Angeles, CA 90095 (United States); Jian, L. K. [NASA Goddard Space Flight Center, Greenbelt, MD and University of Maryland, College Park, MD (United States); Luhmann, J. G. [SSL, University of California Berkeley (United States)

    2013-06-13

    We use STEREO data to study shocks driven by stream interactions and the waves associated with them. During the years of the extended solar minimum 2007-2010, stream interaction shocks have Mach numbers between 1.1-3.8 and {theta}{sub Bn}{approx}20-86 Degree-Sign . We find a variety of waves, including whistlers and low frequency fluctuations. Upstream whistler waves may be generated at the shock and upstream ultra low frequency (ULF) waves can be driven locally by ion instabilities. The downstream wave spectra can be formed by both, locally generated perturbations, and shock transmitted waves. We find that many quasiperpendicular shocks can be accompanied by ULF wave and ion foreshocks, which is in contrast to Earth's bow shock. Fluctuations downstream of quasi-parallel shocks tend to have larger amplitudes than waves downstream of quasi-perpendicular shocks. Proton foreshocks of shocks driven by stream interactions have extensions dr {<=}0.05 AU. This is smaller than foreshock extensions for ICME driven shocks. The difference in foreshock extensions is related to the fact that ICME driven shocks are formed closer to the Sun and therefore begin to accelerate particles very early in their existence, while stream interaction shocks form at {approx}1 AU and have been producing suprathermal particles for a shorter time.

  8. Transforming in-situ observations of CME-driven shock accelerated protons into the shock's reference frame.

    Directory of Open Access Journals (Sweden)

    I. M. Robinson

    2005-07-01

    Full Text Available We examine the solar energetic particle event following solar activity from 14, 15 April 2001 which includes a "bump-on-the-tail" in the proton energy spectra at 0.99 AU from the Sun. We find this population was generated by a CME-driven shock which arrived at 0.99 AU around midnight 18 April. As such this population represents an excellent opportunity to study in isolation, the effects of proton acceleration by the shock. The peak energy of the bump-on-the-tail evolves to progressively lower energies as the shock approaches the observing spacecraft at the inner Lagrange point. Focusing on the evolution of this peak energy we demonstrate a technique which transforms these in-situ spectral observations into a frame of reference co-moving with the shock whilst making allowance for the effects of pitch angle scattering and focusing. The results of this transform suggest the bump-on-the-tail population was not driven by the 15 April activity but was generated or at least modulated by a CME-driven shock which left the Sun on 14 April. The existence of a bump-on-the-tail population is predicted by models in Rice et al. (2003 and Li et al. (2003 which we compare with observations and the results of our analysis in the context of both the 14 April and 15 April CMEs. We find an origin of the bump-on-the-tail at the 14 April CME-driven shock provides better agreement with these modelled predictions although some discrepancy exists as to the shock's ability to accelerate 100 MeV protons.

    Keywords. Solar physics, astrophysics and astronomy (Energetic particles; Flares and mass ejections – Space plasma physics (Transport processes

  9. Shock Dynamics in Stellar Outbursts. I. Shock Formation

    Energy Technology Data Exchange (ETDEWEB)

    Ro, Stephen; Matzner, Christopher D., E-mail: ro@astro.utoronto.ca [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H4 (Canada)

    2017-05-20

    Wave-driven outflows and non-disruptive explosions have been implicated in pre-supernova outbursts, supernova impostors, luminous blue variable eruptions, and some narrow-line and superluminous supernovae. To model these events, we investigate the dynamics of stars set in motion by strong acoustic pulses and wave trains, focusing on nonlinear wave propagation, shock formation, and an early phase of the development of a weak shock. We identify the shock formation radius, showing that a heuristic estimate based on crossing characteristics matches an exact expansion around the wave front and verifying both with numerical experiments. Our general analytical condition for shock formation applies to one-dimensional motions within any static environment, including both eruptions and implosions. We also consider the early phase of shock energy dissipation. We find that waves of super-Eddington acoustic luminosity always create shocks, rather than damping by radiative diffusion. Therefore, shock formation is integral to super-Eddington outbursts.

  10. A Clinical Study on the cases of The Pain Shock Patients after Korean Bee-Venom Therapy

    Directory of Open Access Journals (Sweden)

    Lee Jin-seon

    2001-12-01

    Full Text Available Objective:There has been no known report on the pain shock after administering Korean bee-venom therapy. Three accounts of pain shock were observed at the Sangji university affiliated Oriental medicine clinic from July 2001 through September 2001. This thesis will inform clinical progression and cautions on administering Korean bee-venom therapy. Method:We were able to witness different patterns of pain shock during the treatment of degenerative knee joint, progressive oral paralysis, and A.L.S. In order to reduce heat toxicity of the bee venom, needling points were first massaged with the ice for 10 minutes before injecting 0.1~0.2cc of the bee venom. Points of injection were ST36, LI11, LI4 and others. Pain shock occurred after injecting on inner xi-an, outer xi-an and LI4. The phenomena associated with pain shock was recorded in chronological order and local changes were examined. Result Through examining 3 patients with the pain shock, we managed to observe clinical progression, duration, and time linked changes on specific regions. We also managed to determine sensitive needling points for the pain shock. Conclusion:Following results were obtained from 3 patients with the pain shock caused by Korean bee-venom therapy from July 2001 to September 2001. 1. Either positive or negative responses were shown after the pain shock. For case 1, extreme pain was accompanied with muscular convulsion and tremble, ocular hyperemia, delirium, stiffening of extremities, and hyper ventilation which all suggest positive responses. For case 2 and 3, extreme pain was accompanied with facial sweating, asthenia of extremities, pallor face, dizziness, weak voice, and sleepiness which are the signs of negative responses. 2. The time required to recover to stable state took nearly an hour (including sleeping time and there was no side effect. 3. Precautions required to prevent the pain shock includes full concentration from the practitioner, accurate point

  11. Core TuLiP

    NARCIS (Netherlands)

    Czenko, M.R.; Etalle, Sandro

    2007-01-01

    We propose CoreTuLiP - the core of a trust management language based on Logic Programming. CoreTuLiP is based on a subset of moded logic programming, but enjoys the features of TM languages such as RT; in particular clauses are issued by different authorities and stored in a distributed manner. We

  12. Grain destruction in interstellar shocks

    International Nuclear Information System (INIS)

    Seab, C.G.; Shull, J.M.

    1984-01-01

    One of the principal methods for removing grains from the Interstellar Medium is to destroy them in shock waves. Previous theoretical studies of shock destruction have generally assumed only a single size and type of grain; most do not account for the effect of the grain destruction on the structure of the shock. Earlier calculations have been improved in three ways: first, by using a ''complete'' grain model including a distribution of sizes and types of grains; second, by using a self-consistent shock structure that incorporates the changing elemental depletions as the grains are destroyed; and third, by calculating the shock-processed ultraviolet extinction curves for comparison with observations. (author)

  13. Enhanced Li-Ion Battery

    Directory of Open Access Journals (Sweden)

    Natasha Ross

    2015-01-01

    Full Text Available Au with Pd nanoparticles were synthesized and coated onto the spinel LiMn2O4 via a coprecipitation calcination method with the objective to improve the microstructure, conductivity, and electrochemical activities of pristine LiMn2O4. The novel LiPdAuxMn2-xO4 composite cathode had high phase purity, well crystallized particles, and more regular morphological structures with narrow size distributions. At enlarged cycling potential ranges the LiPdAuxMn2-xO4 sample delivered 90 mAh g−1 discharge capacity compared to LiMn2O4 (45 mAh g−1. It was concluded that even a small amount of the Pd and Au enhanced both the lithium diffusivity and electrochemical conductivity of the host sample due to the beneficial properties of their synergy.

  14. Bubble Dynamics and Shock Waves

    CERN Document Server

    2013-01-01

    This volume of the Shock Wave Science and Technology Reference Library is concerned with the interplay between bubble dynamics and shock waves. It is divided into four parts containing twelve chapters written by eminent scientists. Topics discussed include shock wave emission by laser generated bubbles (W Lauterborn, A Vogel), pulsating bubbles near boundaries (DM Leppinen, QX Wang, JR Blake), interaction of shock waves with bubble clouds (CD Ohl, SW Ohl), shock propagation in polydispersed bubbly liquids by model equations (K Ando, T Colonius, CE Brennen. T Yano, T Kanagawa,  M Watanabe, S Fujikawa) and by DNS (G Tryggvason, S Dabiri), shocks in cavitating flows (NA Adams, SJ Schmidt, CF Delale, GH Schnerr, S Pasinlioglu) together with applications involving encapsulated bubble dynamics in imaging (AA Doinikov, A Novell, JM Escoffre, A Bouakaz),  shock wave lithotripsy (P Zhong), sterilization of ships’ ballast water (A Abe, H Mimura) and bubbly flow model of volcano eruptions ((VK Kedrinskii, K Takayama...

  15. Recovery of Li from alloys of Al- Li and Li- Al using engineered scavenger compounds

    Science.gov (United States)

    Riley, W. D.; Jong, B. W.; Collins, W. K.; Gerdemann, S. J.

    1994-01-01

    A method of producing lithium of high purity from lithium aluminum alloys using an engineered scavenger compound, comprising: I) preparing an engineered scavenger compound by: a) mixing and heating compounds of TiO2 and Li2CO3 at a temperature sufficient to dry the compounds and convert Li.sub.2 CO.sub.3 to Li.sub.2 O; and b) mixing and heating the compounds at a temperature sufficient to produce a scavenger Li.sub.2 O.3TiO.sub.2 compound; II) loading the scavenger into one of two electrode baskets in a three electrode cell reactor and placing an Al-Li alloy in a second electrode basket of the three electrode cell reactor; III) heating the cell to a temperature sufficient to enable a mixture of KCl-LiCl contained in a crucible in the cell to reach its melting point and become a molten bath; IV) immersing the baskets in the bath until an electrical connection is made between the baskets to charge the scavenger compound with Li until there is an initial current and voltage followed by a fall off ending current and voltage; and V) making a connection between the basket electrode containing engineered scavenger compound and a steel rod electrode disposed between the basket electrodes and applying a current to cause Li to leave the scavenger compound and become electrodeposited on the steel rod electrode.

  16. Adjustable Shock Absorbers

    OpenAIRE

    Adamiec, Radek

    2012-01-01

    Bakalářská práce obsahuje přehled používaných tlumičů osobních automobilů, závodních automobilů a motocyklů. Jsou zde popsány systémy t lumením, konstrukce tlumičů a vidlic používaných u motocyklů. Dále je zde přehled prvků používaných u podvozků automobilů. This bachelor´s thesis contains the survey of the shock absorbers of passenger cars, racing cars and motorcycles. Are described damping systems, the design used shock absorbers and forks for motorcycles. Then there is the list of the e...

  17. Radiative relativistic shock adiabate

    International Nuclear Information System (INIS)

    Tsintsadze, L.N.; Nishikawa, K.

    1997-01-01

    The influences of thermal radiation on the state equation of shock waves, derived in the previous paper [L. N. Tsintsadze, Phys. Plasmas 2, 4462 (1995)], are studied and a series of relations of thermodynamic quantities that hold for shock waves are derived. It is shown that the presence of radiation can strongly change the compressibility of the plasma. It is well known that for polytropic gases the compressibility cannot change more than four times the initial value in the case of nonrelativistic temperatures. The numerical calculations show that there are no such restrictions, when the radiation energy exceeds the kinetic energy of the plasma. The ultrarelativistic temperature range is also covered in our numerical calculations. Also studied are the influences of the radiation on the PT and the TV diagrams. A significant modification due to radiation is found in every case studied. copyright 1997 American Institute of Physics

  18. POSTURAL SHOCK IN PREGNANCY

    Science.gov (United States)

    Wilkening, Ralph L.; Knauer, John; Larson, Roger K.

    1955-01-01

    Signs and symptoms of shock may be produced in some patients in late pregnancy by putting them in the dorsal recumbent posture. Change from this position will relieve the condition. The features of the supine hypotensive syndrome can be duplicated by applying pressure to the abdomen with the patient in a lateral position. The postural variations of venous pressure, blood pressure, and pulse appear to be due to obstruction of venous return from the lower portion of the body caused by the large uterus of late pregnancy compressing the vena cava. When shock is observed in a woman in late pregnancy, she should be turned to a lateral position before more active measures of treatment are begun. ImagesFigure 1. PMID:14351983

  19. Bow shock data analysis

    Science.gov (United States)

    Zipf, Edward C.; Erdman, Peeter W.

    1994-08-01

    The University of Pittsburgh Space Physics Group in collaboration with the Army Research Office (ARO) modeling team has completed a systematic organization of the shock and plume spectral data and the electron temperature and density measurements obtained during the BowShock I and II rocket flights which have been submitted to the AEDC Data Center, has verified the presence of CO Cameron band emission during the Antares engine burn and for an extended period of time in the post-burn plume, and have adapted 3-D radiation entrapment codes developed by the University of Pittsburgh to study aurora and other atmospheric phenomena that involve significant spatial effects to investigate the vacuum ultraviolet (VUV) and extreme ultraviolet (EUV) envelope surrounding the re-entry that create an extensive plasma cloud by photoionization.

  20. Shock Isolation Elements Testing for High Input Loadings. Volume III. Mechanical Shock Isolation Elements.

    Science.gov (United States)

    SHOCK ABSORBERS ), (*GUIDED MISSILE SILOS, SHOCK ABSORBERS ), (*SPRINGS, (*SHOCK(MECHANICS), REDUCTION), TORSION BARS, ELASTOMERS, DAMPING, EQUATIONS OF MOTION, MODEL TESTS, TEST METHODS, NUCLEAR EXPLOSIONS, HARDENING.

  1. Shock resistance testing

    International Nuclear Information System (INIS)

    Pouard, M.

    1984-03-01

    In the framework of mechanical tests and to answer the different requests for tests, the T.C.R (Transport Conditionnement et Retraitement) laboratory got test facilities. These installations allow to carry out tests of resistance to shocks, mainly at the safety level of components of nuclear power plants, mockups of transport casks for fuel elements and transport containers for radioactive materials. They include a tower and a catapult. This paper give a decription of the facilities and explain their operation way [fr

  2. On Modeling Risk Shocks

    OpenAIRE

    Dorofeenko, Victor; Lee, Gabriel; Salyer, Kevin; Strobel, Johannes

    2016-01-01

    Within the context of a financial accelerator model, we model time-varying uncertainty (i.e. risk shocks) through the use of a mixture Normal model with time variation in the weights applied to the underlying distributions characterizing entrepreneur productivity. Specifically, we model capital producers (i.e. the entrepreneurs) as either low-risk (relatively small second moment for productivity) and high-risk (relatively large second moment for productivity) and the fraction of both types is...

  3. The Shock Doctrine

    OpenAIRE

    Dionysios K. Solomos; Dimitrios N. Koumparoulis

    2011-01-01

    Naomi Klein attempts to redefine the economic history discovering the historical continuities and to reveal the neoliberal theory which functions via the utilization of specific “tools”. The state of shock is the key for the opponents of Chicago School and Milton Friedman in order for them to establish neoliberal policies and to promote the deregulated capitalism which includes less welfare state, less public sector, less regulation, weakened labor unions, privatizations and laissez-faire. Th...

  4. Shock compression experiments on Lithium Deuteride single crystals.

    Energy Technology Data Exchange (ETDEWEB)

    Knudson, Marcus D.; Desjarlais, Michael Paul; Lemke, Raymond W.

    2014-10-01

    S hock compression exper iments in the few hundred GPa (multi - Mabr) regime were performed on Lithium Deuteride (LiD) single crystals . This study utilized the high velocity flyer plate capability of the Sandia Z Machine to perform impact experiments at flyer plate velocities in the range of 17 - 32 km/s. Measurements included pressure, density, and temperature between %7E200 - 600 GPa along the Principal Hugoniot - the locus of end states achievable through compression by large amplitude shock waves - as well as pressure and density of re - shock states up to %7E900 GPa . The experimental measurements are compared with recent density functional theory calculations as well as a new tabular equation of state developed at Los Alamos National Labs.

  5. Characterization of shocked beryllium

    Directory of Open Access Journals (Sweden)

    Papin P.A.

    2012-08-01

    Full Text Available While numerous studies have investigated the low-strain-rate constitutive response of beryllium, the combined influence of high strain rate and temperature on the mechanical behavior and microstructure of beryllium has received limited attention over the last 40 years. In the current work, high strain rate tests were conducted using both explosive drive and a gas gun to accelerate the material. Prior studies have focused on tensile loading behavior, or limited conditions of dynamic strain rate and/or temperature. Two constitutive strength (plasticity models, the Preston-Tonks-Wallace (PTW and Mechanical Threshold Stress (MTS models, were calibrated using common quasi-static and Hopkinson bar data. However, simulations with the two models give noticeably different results when compared with the measured experimental wave profiles. The experimental results indicate that, even if fractured by the initial shock loading, the Be remains sufficiently intact to support a shear stress following partial release and subsequent shock re-loading. Additional “arrested” drive shots were designed and tested to minimize the reflected tensile pulse in the sample. These tests were done to both validate the model and to put large shock induced compressive loads into the beryllium sample.

  6. Fuel-coolant interactions in a shock-tube geometry

    International Nuclear Information System (INIS)

    Segev, A.; Henry, R.E.; Bankoff, S.G.

    1978-01-01

    Thermal interactions were studied in a shock tube configuration using different pairs of liquids. Large pressures were obtained for systems of water-Wood's metal and butanol-Wood's metal. Different types of interactions were observed, depending on the hot liquid temperature. It was found that thehydrodynamic component alone may account for the measured pressure in the lower temperature range. A combination of thermal and hydrodynamic interactions accounts for the pressures at high temperatures. Experiments with water and molten salt (LiCl + KCl) produced small scale explosions. All interactions were suppressed when driving pressure increased. (author)

  7. Enhanced electrochemical performance of LiMnPO4 by Li+-conductive Li3VO4 surface coatings

    International Nuclear Information System (INIS)

    Dong, Youzhong; Zhao, Yanming; Duan, He; Liang, Zhiyong

    2014-01-01

    By a simple wet ball-milling method, Li 3 VO 4 -coated LiMnPO 4 samples were prepared successfully for the first time. The thin Li 3 VO 4 coating layer with a three-dimensional Li + -ion transport path and high mobility of Li + -ion strongly adhered to the LiMnPO 4 material reduces Mn dissolution and increases the Li + flux through the surface of the LiMnPO 4 itself by preventing formation of phases on the surface that would normally block Li + as well as Li + -ion permeation into the surface of the LiMnPO 4 electrode and therefore improve the rate capability as well as the cycling stability of LiMnPO 4 materials. The electrochemical testing shows that the 5% Li 3 VO 4 -coated LiMnPO 4 sample shows a clear voltage plateau in the charge curves and a much higher reversible capacity at different discharge rates compared with the pristine LiMnPO 4 . EIS results also show that the surface charge transfer resistance and Warburg impedance of the Li 3 VO 4 -coated LiMnPO 4 samples significantly decreased. The surface charge transfer resistance and Warburg impedance for the pristine LiMnPO 4 are 955.1 Ω and 400.3 Ω, respectively. While, for the 5% Li 3 VO 4 -coated LiMnPO 4 , the value are only 400.2 Ω and 283.6 Ω, respectively. The surface charge transfer resistance decreases more than half. All of the improved performance will be favorable for application of the LiMnPO 4 in high-power lithium ion batteries

  8. Selfsimilar time dependent shock structures

    International Nuclear Information System (INIS)

    Beck, R.; Drury, L.O.

    1985-01-01

    Diffusive shock acceleration as an astrophysical mechanism for accelerating charged particles has the advantage of being highly efficient. This means however that the theory is of necessity nonlinear; the reaction of the accelerated particles on the shock structure and the acceleration process must be self-consistently included in any attempt to develop a complete theory of diffusive shock acceleration. Considerable effort has been invested in attempting, at least partially, to do this and it has become clear that in general either the maximum particle energy must be restricted by introducing additional loss processes into the problem or the acceleration must be treated as a time dependent problem (Drury, 1984). It is concluded that stationary modified shock structures can only exist for strong shocks if additional loss processes limit the maximum energy a particle can attain. This is certainly possible and if it occurs the energy loss from the shock will lead to much greater shock compressions. It is however equally possible that no such processes exist and we must then ask what sort of nonstationary shock structure develops. The same argument which excludes stationary structures also rules out periodic solutions and indeed any solution where the width of the shock remains bounded. It follows that the width of the shock must increase secularly with time and it is natural to examine the possibility of selfsimilar time dependent solutions

  9. Selfsimilar time dependent shock structures

    Science.gov (United States)

    Beck, R.; Drury, L. O.

    1985-01-01

    Diffusive shock acceleration as an astrophysical mechanism for accelerating charged particles has the advantage of being highly efficient. This means however that the theory is of necessity nonlinear; the reaction of the accelerated particles on the shock structure and the acceleration process must be self-consistently included in any attempt to develop a complete theory of diffusive shock acceleration. Considerable effort has been invested in attempting, at least partially, to do this and it has become clear that in general either the maximum particle energy must be restricted by introducing additional loss processes into the problem or the acceleration must be treated as a time dependent problem (Drury, 1984). It is concluded that stationary modified shock structures can only exist for strong shocks if additional loss processes limit the maximum energy a particle can attain. This is certainly possible and if it occurs the energy loss from the shock will lead to much greater shock compressions. It is however equally possible that no such processes exist and we must then ask what sort of nonstationary shock structure develops. The ame argument which excludes stationary structures also rules out periodic solutions and indeed any solution where the width of the shock remains bounded. It follows that the width of the shock must increase secularly with time and it is natural to examine the possibility of selfsimilar time dependent solutions.

  10. Creep of Li2O

    International Nuclear Information System (INIS)

    Hollenberg, G.W.; Liu, Y.Y.; Arthur, B.

    1984-11-01

    The tritium breeding material with the highest lithium atom density, Li 2 O has been observed to incur significant swelling (>4%) under fast reactor irradiation. Such swelling, if unrestrained leads to either unacceptable, induced-strains in adjacent structural material or undesirable design compromises. Fortunately, however, Li 2 O deforms at low temperatures so that swelling strains may be internally accommodated. Laboratory dilational creep experiments were conducted on unirradiated Li 2 O between 500 and 700 0 C in order to provide data for structural analysis of in-reactor experiments and blanket design studies. A densification model agreed with most of the available data

  11. Risk shocks and housing markets

    OpenAIRE

    Dorofeenko, Viktor; Lee, Gabriel S.; Salyer, Kevin D.

    2010-01-01

    Abstract: This paper analyzes the role of uncertainty in a multi-sector housing model with financial frictions. We include time varying uncertainty (i.e. risk shocks) in the technology shocks that affect housing production. The analysis demonstratesthat risk shocks to the housing production sector are a quantitatively important impulse mechanism for the business cycle. Also, we demonstrate that bankruptcy costs act as an endogenous markup factor in housing prices; as a consequence, the volati...

  12. Health shocks and risk aversion.

    Science.gov (United States)

    Decker, Simon; Schmitz, Hendrik

    2016-12-01

    We empirically assess whether a health shock influences individual risk aversion. We use grip strength data to obtain an objective health shock indicator. In order to account for the non-random nature of our data regression-adjusted matching is employed. Risk preferences are traditionally assumed to be constant. However, we find that a health shock increases individual risk aversion. The finding is robust to a series of sensitivity analyses and persists for at least four years after the shock. Income changes do not seem to be the driving mechanism. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. Shock in the emergency department

    DEFF Research Database (Denmark)

    Holler, Jon Gitz; Henriksen, Daniel Pilsgaard; Mikkelsen, Søren

    2016-01-01

    BACKGROUND: The knowledge of the frequency and associated mortality of shock in the emergency department (ED) is limited. The aim of this study was to describe the incidence, all-cause mortality and factors associated with death among patients suffering shock in the ED. METHODS: Population...... failures. Outcomes were annual incidence per 100,000 person-years at risk (pyar), all-cause mortality at 0-7, and 8-90 days and risk factors associated with death. RESULTS: We identified 1646 of 438,191 (0.4 %) ED patients with shock at arrival. Incidence of shock increased from 53.8 to 80.6 cases per 100...

  14. Shock compression of diamond crystal

    OpenAIRE

    Kondo, Ken-ichi; Ahrens, Thomas J.

    1983-01-01

    Two shock wave experiments employing inclined mirrors have been carried out to determine the Hugoniot elastic limit (HEL), final shock state at 191 and 217 GPa, and the post-shock state of diamond crystal, which is shock-compressed along the intermediate direction between the and crystallographic axes. The HEL wave has a velocity of 19.9 ± 0.3 mm/µsec and an amplitude of 63 ± 28 GPa. An alternate interpretation of the inclined wedge mirror streak record suggests a ramp precursor wave and th...

  15. Comparing Shock geometry from MHD simulation to that from the Q/A-scaling analysis

    Science.gov (United States)

    Li, G.; Zhao, L.; Jin, M.

    2017-12-01

    In large SEP events, ions can be accelerated at CME-driven shocks to very high energies. Spectra of heavy ions in many large SEP events show features such as roll-overs or spectral breaks. In some events when the spectra are plotted in energy/nucleon they can be shifted relatively to each other so that the spectra align. The amount of shift is charge-to-mass ratio (Q/A) dependent and varies from event to event. In the work of Li et al. (2009), the Q/A dependences of the scaling is related to shock geometry when the CME-driven shock is close to the Sun. For events where multiple in-situ spacecraft observations exist, one may expect that different spacecraft are connected to different portions of the CME-driven shock that have different shock geometries, therefore yielding different Q/A dependence. At the same time, shock geometry can be also obtained from MHD simulations. This means we can compare shock geometry from two completely different approaches: one from MHD simulation and the other from in-situ spectral fitting. In this work, we examine this comparison for selected events.

  16. A Shocking Solar Nebula?

    OpenAIRE

    Liffman, Kurt

    2009-01-01

    It has been suggested that shock waves in the solar nebula formed the high temperature materials observed in meteorites and comets. It is shown that the temperatures at the inner rim of the solar nebula could have been high enough over a sufficient length of time to produce chondrules, CAIs, refractory dust grains and other high-temperature materials observed in comets and meteorites. The solar bipolar jet flow may have produced an enrichment of 16O in the solar nebula over time and the chond...

  17. Myths of "shock therapy".

    Science.gov (United States)

    Fink, M

    1977-09-01

    The author discusses the myths of the ECT process--that shock and the convulsion are essential, memory loss and brain damage are inescapable, and little is known of the process--and assesses the fallacies in these ideas. Present views of the ECT process suggest that its mode of action in depression may best be described as a prolonged form of diencephalic stimulation, particularly useful to affect the hypothalamic dysfunctions that characterize depressive illness. The author emphasizes the need for further study of this treatment modality and for self-regulation by the profession.

  18. Gravitational shock waves and extreme magnetomaterial shock waves

    International Nuclear Information System (INIS)

    Lichnerowicz, Andre.

    1975-01-01

    Within an astrophysical context corresponding to high densities, a self-gravitating model is studied, which is the set of an extreme material medium of infinite conductivity and of a magnetic field. Corresponding shock waves generate necessarily, in general, gravitational shock waves [fr

  19. Shock Producers and Shock Absorbers in the Crisis

    OpenAIRE

    Sinn, Hans-Werner

    2009-01-01

    It is not surprising that the U.S. has been by far the world’s largest shock producer in this crisis. The big shock absorbers on the other hand were Japan, Russia and Germany, whose exports shrank more than their imports.

  20. Simulations of Converging Shock Collisions for Shock Ignition

    Science.gov (United States)

    Sauppe, Joshua; Dodd, Evan; Loomis, Eric

    2016-10-01

    Shock ignition (SI) has been proposed as an alternative to achieving high gain in inertial confinement fusion (ICF) targets. A central hot spot below the ignition threshold is created by an initial compression pulse, and a second laser pulse drives a strong converging shock into the fuel. The collision between the rebounding shock from the compression pulse and the converging shock results in amplification of the converging shock and increases the hot spot pressure above the ignition threshold. We investigate shock collision in SI drive schemes for cylindrical targets with a polystyrene foam interior using radiation-hydrodynamics simulations with the RAGE code. The configuration is similar to previous targets fielded on the Omega laser. The CH interior results in a lower convergence ratio and the cylindrical geometry facilitates visualization of the shock transit using an axial X-ray backlighter, both of which are important for comparison to potential experimental measurements. One-dimensional simulations are used to determine shock timing, and the effects of low mode asymmetries in 2D computations are also quantified. LA-UR-16-24773.

  1. 30th International Symposium on Shock Waves

    CERN Document Server

    Sadot, Oren; Igra, Ozer

    2017-01-01

    These proceedings collect the papers presented at the 30th International Symposium on Shock Waves (ISSW30), which was held in Tel-Aviv Israel from July 19 to July 24, 2015. The Symposium was organized by Ortra Ltd. The ISSW30 focused on the state of knowledge of the following areas: Nozzle Flow, Supersonic and Hypersonic Flows with Shocks, Supersonic Jets, Chemical Kinetics, Chemical Reacting Flows, Detonation, Combustion, Ignition, Shock Wave Reflection and Interaction, Shock Wave Interaction with Obstacles, Shock Wave Interaction with Porous Media, Shock Wave Interaction with Granular Media, Shock Wave Interaction with Dusty Media, Plasma, Magnetohyrdrodynamics, Re-entry to Earth Atmosphere, Shock Waves in Rarefied Gases, Shock Waves in Condensed Matter (Solids and Liquids), Shock Waves in Dense Gases, Shock Wave Focusing, Richtmyer-Meshkov Instability, Shock Boundary Layer Interaction, Multiphase Flow, Blast Waves, Facilities, Flow Visualization, and Numerical Methods. The two volumes serve as a reference ...

  2. Fast imaging of the laser-blow-off plume driven shock wave: Dependence on the mass and density of the ambient gas

    Energy Technology Data Exchange (ETDEWEB)

    George, Sony [ISP, Cochin University of Science and Tech., Cochin 682 022 (India); Singh, R.K., E-mail: rajesh@ipr.res.in [Institute for Plasma Research, Gandhinagar 382 428 (India); Nampoori, V.P.N. [ISP, Cochin University of Science and Tech., Cochin 682 022 (India); Kumar, Ajai [Institute for Plasma Research, Gandhinagar 382 428 (India)

    2013-01-17

    A systemic investigation of expansion dynamics of plasma plume, produced by laser-blow-off of LiF–C thin film has been done with emphasis on the formation of shock wave and their dependence on the pressure and nature of the ambient gas. The present results demonstrate that highly directional plume produces a strong shock wave in comparison to shock produced by the diverging plume. Shock-velocity, strength and its structure are strongly dependent on ambient environment; maximum shock velocity is observed in helium whereas shock strength is highest in argon environment. The role of chemically reactive processes was not observed in the present case as the plume structure is almost similar in argon and oxygen.

  3. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  4. Low-intensity Extracorporeal Shock Wave Treatment Improves Erectile Function: A Systematic Review and Meta-analysis.

    Science.gov (United States)

    Lu, Zhihua; Lin, Guiting; Reed-Maldonado, Amanda; Wang, Chunxi; Lee, Yung-Chin; Lue, Tom F

    2017-02-01

    As a novel therapeutic method for erectile dysfunction (ED), low-intensity extracorporeal shock wave treatment (LI-ESWT) has been applied recently in the clinical setting. We feel that a summary of the current literature and a systematic review to evaluate the therapeutic efficacy of LI-ESWT for ED would be helpful for physicians who are interested in using this modality to treat patients with ED. A systematic review of the evidence regarding LI-ESWT for patients with ED was undertaken with a meta-analysis to identify the efficacy of the treatment modality. A comprehensive search of the PubMed and Embase databases to November 2015 was performed. Studies reporting on patients with ED treated with LI-ESWT were included. The International Index of Erectile Function (IIEF) and the Erection Hardness Score (EHS) were the most commonly used tools to evaluate the therapeutic efficacy of LI-ESWT. There were 14 studies including 833 patients from 2005 to 2015. Seven studies were randomized controlled trials (RCTs); however, in these studies, the setup parameters of LI-ESWT and the protocols of treatment were variable. The meta-analysis revealed that LI-ESWT could significantly improve IIEF (mean difference: 2.00; 95% confidence interval [CI], 0.99-3.00; pwaves per treatment, and duration of LI-ESWT treatment were closely related to clinical outcome, especially regarding IIEF improvement. The number of studies of LI-ESWT for ED have increased dramatically in recent years. Most of these studies presented encouraging results, regardless of variation in LI-ESWT setup parameters or treatment protocols. These studies suggest that LI-ESWT could significantly improve the IIEF and EHS of ED patients. The publication of robust evidence from additional RCTs and longer-term follow-up would provide more confidence regarding use of LI-ESWT for ED patients. We reviewed 14 studies of men who received low-intensity extracorporeal shock wave treatment (LI-ESWT) for erectile dysfunction (ED

  5. Molecular diagnostics of interstellar shocks

    International Nuclear Information System (INIS)

    Hartquist, T.W.; Oppenheimer, M.; Dalgarno, A.

    1980-01-01

    The chemistry of molecules in shocked regions of the interstellar gas is considered and calculations are carried out for a region subjected to a shock at a velocity of 8 km s -1 Substantial enhancements are predicted in the concentrations of the molecules H 2 S, SO, and SiO compared to those anticipated in cold interstellar clouds

  6. Molecular diagnostics of interstellar shocks

    Science.gov (United States)

    Hartquist, T. W.; Dalgarno, A.; Oppenheimer, M.

    1980-02-01

    The chemistry of molecules in shocked regions of the interstellar gas is considered and calculations are carried out for a region subjected to a shock at a velocity of 8 km/sec. Substantial enhancements are predicted in the concentrations of the molecules H2S, SO, and SiO compared to those anticipated in cold interstellar clouds.

  7. How Culture Shock Affects Communication.

    Science.gov (United States)

    Barna, LaRay M.

    The paper defines the term "culture shock" and discusses the changes that this state can make in a person's behavior. Culture shock refers to the emotional and physiological reaction of high activation that is brought about by sudden immersion in a new culture. Because one's own culture shields one from the unknown and reduces the need to make…

  8. Molecular diagnostics of interstellar shocks

    Science.gov (United States)

    Hartquist, T. W.; Dalgarno, A.; Oppenheimer, M.

    1980-01-01

    The chemistry of molecules in shocked regions of the interstellar gas is considered and calculations are carried out for a region subjected to a shock at a velocity of 8 km/sec. Substantial enhancements are predicted in the concentrations of the molecules H2S, SO, and SiO compared to those anticipated in cold interstellar clouds.

  9. Shock wave treatment in medicine

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 30; Issue 2 ... In the present paper we discuss the basic theory and application of shock waves and its history in medicine. The idea behind using shock wave therapy for orthopedic diseases is the stimulation of healing in tendons, surrounding tissue and bones. This is a ...

  10. Shock wave treatment in medicine

    Indian Academy of Sciences (India)

    Unknown

    to open surgery, the cost of the ESWT is very reasonable. But nevertheless it is necessary to improve the basic un ... In second group, shock waves are used to measure distances because of the low energy loss over large distances ... pared to a piezoelectric hydrophone. The rise time of an electrohydraulic generated shock ...

  11. Numerical modeling of slow shocks

    International Nuclear Information System (INIS)

    Winske, D.

    1987-01-01

    This paper reviews previous attempt and the present status of efforts to understand the structure of slow shocks by means of time dependent numerical calculations. Studies carried out using MHD or hybrid-kinetic codes have demonstrated qualitative agreement with theory. A number of unresolved issues related to hybrid simulations of the internal shock structure are discussed in some detail. 43 refs., 8 figs

  12. Dynamic shock wave: hammer blow

    International Nuclear Information System (INIS)

    Lackme, Claude

    1978-01-01

    The general properties of shocks, their generation and the conditions of reflexion to an interface are dealt with in turn. By then applying these concepts to a liquid column and its environment (wall, free area, closing devices) the hammer blow is presented as being a relatively weak shock [fr

  13. Slow shocks and their transition to fast shocks in the inner solar wind

    International Nuclear Information System (INIS)

    Wang, Y.C.

    1987-01-01

    The jump conditions of MHD shocks may be directly calculated as functions of three upstream conditions: the shock Alfven number based on the normal component of the relative shock speed, the shock angle, and the plasma β value. The shock Alfven number is less than 1 for a slow shock and greater than 1 for a fast shock. A traveling, forward shock can be a slow shock in coronal space, where the Alfven speed is of the order of 1000 km/s. The surface of a forward slow shock has a bow-shaped geometry with its nose facing toward the sun. The decrease in the Alfven speed at increasing heliocentric distance causes the shock Alfven number of a forward slow shock to become greater than 1, and the shock eventually evolves from a slow shock into a fast shock. During the transition the shock system consists of a slow shock, a fast shock, and a rotational discontinuity. They intersect along a closed transition line. As the system moves outward from the sun, the area enclosed by the transition line expands, the fast shock grows stronger, and the slow shock becomes weaker. Eventually, the slow shock diminishes, and the entire shock system evolves into a forward fast shock. copyrightAmerican Geophysical Union 1987

  14. Fabrication of Li-intercalated bilayer graphene

    Directory of Open Access Journals (Sweden)

    K. Sugawara

    2011-06-01

    Full Text Available We have succeeded in fabricating Li-intercalated bilayer graphene on silicon carbide. The low-energy electron diffraction from Li-deposited bilayer graphene shows a sharp 3×3R30° pattern in contrast to Li-deposited monolayer graphene. This indicates that Li atoms are intercalated between two adjacent graphene layers and take the same well-ordered superstructure as in bulk C6Li. The angle-resolved photoemission spectroscopy has revealed that Li atoms are fully ionized and the π bands of graphene are systematically folded by the superstructure of intercalated Li atoms, producing a snowflake-like Fermi surface centered at the Γ point. The present result suggests a high potential of Li-intercalated bilayer graphene for application to a nano-scale Li-ion battery.

  15. Shocking matter to extreme conditions

    International Nuclear Information System (INIS)

    Gupta, Y.M.; Sharma, S.M.

    1997-01-01

    A good understanding of the thermodynamic response of matter at high compression and high energy densities is important to several areas of physics. Shock-wave experiments are uniquely suited for obtaining data at extreme conditions, and a shock-compressed matter can be viewed as a condensed system with or without dissociation or as a strongly coupled plasma. This article reviews work by Da Silva et al. in which irradiances ranging from 5x10 superscript 12 to 2x10 superscript 14 W/cm 2 were used to generate 8- to 10-ns square pulses in liquid deuterium. The authors demonstrated negligible pre-heating of the sample, steady propagation of the shock wave, and direct determination of the shock wave velocity along with particle velocity and density in the shocked state. Da Silva et al. results are compared with models and other experimental information, and the usefulness of the data in other areas is assessed. 11 refs., 1 fig

  16. Electron transport and shock ignition

    Energy Technology Data Exchange (ETDEWEB)

    Bell, A R; Tzoufras, M, E-mail: t.bell1@physics.ox.ac.uk [Clarendon Laboratory, University of Oxford, Parks Road, Oxford OX1 3PU (United Kingdom)

    2011-04-15

    Inertial fusion energy (IFE) offers one possible route to commercial energy generation. In the proposed 'shock ignition' route to fusion, the target is compressed at a relatively low temperature and then ignited using high intensity laser irradiation which drives a strong converging shock into the centre of the fuel. With a series of idealized calculations we analyse the electron transport of energy into the target, which produces the pressure responsible for driving the shock. We show that transport in shock ignition lies near the boundary between ablative and heat front regimes. Moreover, simulations indicate that non-local effects are significant in the heat front regime and might lead to increased efficiency by driving the shock more effectively and reducing heat losses to the plasma corona.

  17. Oscillating nonlinear acoustic shock waves

    DEFF Research Database (Denmark)

    Gaididei, Yuri; Rasmussen, Anders Rønne; Christiansen, Peter Leth

    2016-01-01

    We investigate oscillating shock waves in a tube using a higher order weakly nonlinear acoustic model. The model includes thermoviscous effects and is non isentropic. The oscillating shock waves are generated at one end of the tube by a sinusoidal driver. Numerical simulations show that at resona......We investigate oscillating shock waves in a tube using a higher order weakly nonlinear acoustic model. The model includes thermoviscous effects and is non isentropic. The oscillating shock waves are generated at one end of the tube by a sinusoidal driver. Numerical simulations show...... polynomial in the space and time variables, we find analytical approximations to the observed single shock waves in an infinitely long tube. Using perturbation theory for the driven acoustic system approximative analytical solutions for the off resonant case are determined....

  18. Li-ion batteries: Phase transition

    International Nuclear Information System (INIS)

    Hou Peiyu; Zhang Yantao; Zhang Lianqi; Chu Geng; Gao Jian

    2016-01-01

    Progress in the research on phase transitions during Li + extraction/insertion processes in typical battery materials is summarized as examples to illustrate the significance of understanding phase transition phenomena in Li-ion batteries. Physical phenomena such as phase transitions (and resultant phase diagrams) are often observed in Li-ion battery research and already play an important role in promoting Li-ion battery technology. For example, the phase transitions during Li + insertion/extraction are highly relevant to the thermodynamics and kinetics of Li-ion batteries, and even physical characteristics such as specific energy, power density, volume variation, and safety-related properties. (topical review)

  19. Shock waves & explosions

    CERN Document Server

    Sachdev, PL

    2004-01-01

    Understanding the causes and effects of explosions is important to experts in a broad range of disciplines, including the military, industrial and environmental research, aeronautic engineering, and applied mathematics. Offering an introductory review of historic research, Shock Waves and Explosions brings analytic and computational methods to a wide audience in a clear and thorough way. Beginning with an overview of the research on combustion and gas dynamics in the 1970s and 1980s, the author brings you up to date by covering modeling techniques and asymptotic and perturbative methods and ending with a chapter on computational methods.Most of the book deals with the mathematical analysis of explosions, but computational results are also included wherever they are available. Historical perspectives are provided on the advent of nonlinear science, as well as on the mathematical study of the blast wave phenomenon, both when visualized as a point explosion and when simulated as the expansion of a high-pressure ...

  20. Analysis of shock implosion

    Energy Technology Data Exchange (ETDEWEB)

    Mishkin, E.A.; Alejaldre, C. (Polytechnic Inst. of New York, Brooklyn (USA))

    1984-06-01

    An imploding shock wave, coming from infinity, moves through an ideal gas with the adiabatic constant ..gamma... To define a single-valued self-similar coefficient over the whole classical interval 1<..gamma..

  1. The cosmic-ray shock structure problem for relativistic shocks

    Science.gov (United States)

    Webb, G. M.

    1985-01-01

    The time asymptotic behaviour of a relativistic (parallel) shock wave significantly modified by the diffusive acceleration of cosmic-rays is investigated by means of relativistic hydrodynamical equations for both the cosmic-rays and thermal gas. The form of the shock structure equation and the dispersion relation for both long and short wavelength waves in the system are obtained. The dependence of the shock acceleration efficiency on the upstream fluid spped, long wavelength Mach number and the ratio N = P sub co/cP sub co+P sub go)(Psub co and P sub go are the upstream cosmic-ray and thermal gas pressures respectively) are studied.

  2. Cosmic-ray shock acceleration in oblique MHD shocks

    Science.gov (United States)

    Webb, G. M.; Drury, L. OC.; Volk, H. J.

    1986-01-01

    A one-dimensional, steady-state hydrodynamical model of cosmic-ray acceleration at oblique MHD shocks is presented. Upstream of the shock the incoming thermal plasma is subject to the adverse pressure gradient of the accelerated particles, the J x B force, as well as the thermal gas pressure gradient. The efficiency of the acceleration of cosmic-rays at the shock as a function of the upstream magnetic field obliquity and upstream plasma beta is investigated. Astrophysical applications of the results are briefly discussed.

  3. Fragmentation properties of 6Li

    International Nuclear Information System (INIS)

    Lovas, R.G.; Kruppa, A.T.; Beck, R.; Dickmann, F.

    1987-01-01

    The α+d and t+τ cluster structure of 6 Li is described in a microscopic α+d cluster model through quantities that enter into the description of cluster fragmentation processes. The states of the separate clusters α, d, t and τ are described as superpositions of Os Slater determinants belonging to different potential size parameters. To describe both the 6 Li and fragment state realistically, nucleon-nucleon forces optimized for the used model state spaces were constructed. The fragmentation properties predicted by them slightly differ from those calculated with some forces of common use provided the latter are modified so as to reproduce the α, d and 6 Li energies. (author) 61 refs.; 9 figs

  4. Interferometric windows characterization up to 450 K for shock wave experiments: Hugoniot curves and refractive index

    Directory of Open Access Journals (Sweden)

    Godefroit J.-L.

    2012-08-01

    Full Text Available Conventional shock wave experiments need interferometric windows in order to determine the equation of state of a large variety of metals. Lithium fluoride (LiF and sapphire are extensively used for that purpose because their optical transparencies enable the optical diagnostics at interfaces under a given range of shock pressure. In order to simulate and analyse the experiments it is necessary to gather a correct knowledge of the optical and mechanical properties of these windows. Therefore, our window supplies are systematically characterized and an experimental campaign under shock loading is conducted. Our preliminary work on LiF windows at 532 nm is in good agreement with literature data at room temperature and the new characterization at 450 K enables a better interpretation of our preheated target experiments. It confirms the predominant effect of density on optical properties under pressure and temperature. The present work demonstrates that the initial density determination is a key point and that the uncertainties need to be improved. For that purpose, complementary experiments are conducted on LiF windows with simplified target designs and enriched diagnostics, coupling VISAR (532 nm and PdV (1550 nm diagnostics. Furthermore, a similar campaign is conducted on sapphire windows with symmetric impact configuration.

  5. Improved Reactive Flow Modeling of the LX-17 Double Shock Experiments

    Science.gov (United States)

    Rehagen, Thomas J.; Vitello, Peter

    2017-06-01

    Over driven double shock experiments provide a measurement of the properties of the reaction product states of the insensitive high explosive LX-17 (92.5% TATB and 7.5% Kel-F by weight). These experiments used two flyer materials mounted on the end of a projectile to send an initial shock through the LX-17, followed by a second shock of a higher magnitude into the detonation products. In the experiments, the explosive was initially driven by the flyer plate to pressures above the Chapman-Jouguet state. The particle velocity history was recorded by Photonic Doppler Velocimetry (PDV) probes pointing at an aluminum foil coated LiF window. The PDV data shows a sharp initial shock and decay, followed by a rounded second shock. Here, the experimental results are compared to 2D and 3D Cheetah reactive flow modeling. Our default Cheetah reactive flow model fails to accurately reproduce the decay of the first shock or the curvature or strength of the second shock. A new model is proposed in which the carbon condensate produced in the reaction zone is controlled by a kinetic rate. This allows the carbon condensate to be initially out of chemical equilibrium with the product gas. This new model reproduces the initial detonation peak and decay, and matches the curvature of the second shock, however, it still over-predicts the strength of the second shock. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract No. DE-AC52-07NA27344.

  6. Chondrule destruction in nebular shocks

    Energy Technology Data Exchange (ETDEWEB)

    Jacquet, Emmanuel; Thompson, Christopher, E-mail: ejacquet@mnhn.fr [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St George Street, Toronto, ON M5S 3H8 (Canada)

    2014-12-10

    Chondrules are millimeter-sized silicate spherules ubiquitous in primitive meteorites, but whose origin remains mysterious. One of the main proposed mechanisms for producing them is melting of solids in shock waves in the gaseous protoplanetary disk. However, evidence is mounting that chondrule-forming regions were enriched in solids well above solar abundances. Given the high velocities involved in shock models, destructive collisions would be expected between differently sized grains after passage of the shock front as a result of differential drag. We investigate the probability and outcome of collisions of particles behind a one-dimensional shock using analytic methods as well as a full integration of the coupled mass, momentum, energy, and radiation equations. Destruction of protochondrules seems unavoidable for solid/gas ratios ε ≳ 0.1, and possibly even for solar abundances because of 'sandblasting' by finer dust. A flow with ε ≳ 10 requires much smaller shock velocities (∼2 versus 8 km s{sup –1}) in order to achieve chondrule-melting temperatures, and radiation trapping allows slow cooling of the shocked fragments. Initial destruction would still be extensive; although re-assembly of millimeter-sized particles would naturally occur by grain sticking afterward, the compositional heterogeneity of chondrules may be difficult to reproduce. We finally note that solids passing through small-scale bow shocks around few kilometer-sized planetesimals might experience partial melting and yet escape fragmentation.

  7. Creep of Li2O

    International Nuclear Information System (INIS)

    Hollenberg, G.W.; Arthur, B.; Lui, Y.Y.

    1985-01-01

    The objective of this effort was to obtain data on the performance of lithium ceramic materials during fast neutron irradiation in support of solid breeder blanket designs. Li 2 O has been observed to swell (greater than or equal to 4%) under fast reactor irradiation. Fortunately, Li 2 O deforms at low temperatures so that swelling strains may be internally accommodated. Laboratory creep experiments were conducted between 500 to 700 0 C in order to provide data for structural analysis of in-reactor experiments and blanket design studies. A densification model agreed with most of the available data

  8. Simulation of mechanical shock environments

    International Nuclear Information System (INIS)

    Lalanne, Christian.

    1975-07-01

    Shocks can produce a severe mechanical environment which must be taken into account when designing and developing new equipments. After some mathematical (Laplace and Fourier transforms) and mechanical recalls (response of a one degree freedom system to a sinusoidal excitation), different analysis methods are compared, these methods being the most used now to compare relative severities of tests and establish specifications. A few chapter deal with the different properties of simple, easy to produce, shock shapes. Then some now-in-use programmators or shock-machines specifications are shown. A final chapter concerns acceleration transducers [fr

  9. Particle acceleration in modified shocks

    International Nuclear Information System (INIS)

    Drury, L.O'C.; Axford, W.I.; Summers, D.

    1982-01-01

    Efficient particle acceleration in shocks must modify the shock structure with consequent changes in the particle acceleration. This effect is studied and analytic solutions are found describing the diffusive acceleration of particles with momentum independent diffusion coefficients in hyperbolic tangent type velocity transitions. If the input particle spectrum is a delta function, the shock smoothing replaces the truncated power-law downstream particle spectrum by a more complicated form, but one which has a power-law tail at high momenta. For a cold plasma this solution can be made completely self-consistent. Some problems associated with momentum dependent diffusion coefficients are discussed. (author)

  10. INTERFERENCE OF COUNTERPROPAGATING SHOCK WAVES

    Directory of Open Access Journals (Sweden)

    P. V. Bulat

    2015-03-01

    Full Text Available The subject of study. We examined the interaction of counterpropagating shock waves. The necessity of counterpropagating shock waves studying occurs at designing of high Mach number modern internal compression air intakes, Ramjets with subsonic and supersonic combustion, in asymmetrical supersonic nozzles and in some other cases. In a sense, this problem is a generalization of the case of an oblique shock reflection from the wall or from the plane of symmetry. With the renewed vigor, the interest to this problem emerged at the end of the 90s. This was due to the start of the programs for flight study at hypersonic speeds. The first experiments performed with air intakes, which realized the interaction of counterpropagating shock waves have shown that the change in flow velocity is accompanied by abrupt alteration of shock-wave structure, the occurrence of nonstationary and oscillatory phenomena. With an increase of flow velocity these phenomena undesirable for aircraft structure became more marked. The reason is that there are two fundamentally different modes of interaction of counterpropagating shock waves: a four-wave regular and a five-wave irregular. The transition from one mode to another can be nonstationary abrupt or gradual, it can also be accompanied by hysteresis. Main results. Criteria for the transition from regular reflection of counterpropagating shock waves to irregular are described: the criterion of von Neumann and the stationary Mach configuration criterion. We described areas in which the transition from one reflection type to another is possible only in abrupt way, as well as areas of possible gradual transition. Intensity dependences of the reflected shock waves from the intensity of interacting counterpropagating shocks were given. Qualitative pictures of shock-wave structures arising from the interaction of counterpropagating shock waves were shown. Calculation results of the intensity of outgoing gas

  11. Particle acceleration in modified shocks

    Energy Technology Data Exchange (ETDEWEB)

    Drury, L.O' C. (Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany, F.R.)); Axford, W.I. (Max-Planck-Institut fuer Aeronomie, Katlenburg-Lindau (Germany, F.R.)); Summers, D. (Memorial Univ. of Newfoundland, St. John' s (Canada))

    1982-03-01

    Efficient particle acceleration in shocks must modify the shock structure with consequent changes in the particle acceleration. This effect is studied and analytic solutions are found describing the diffusive acceleration of particles with momentum independent diffusion coefficients in hyperbolic tangent type velocity transitions. If the input particle spectrum is a delta function, the shock smoothing replaces the truncated power-law downstream particle spectrum by a more complicated form, but one which has a power-law tail at high momenta. For a cold plasma this solution can be made completely self-consistent. Some problems associated with momentum dependent diffusion coefficients are discussed.

  12. Shocks in the Early Universe.

    Science.gov (United States)

    Pen, Ue-Li; Turok, Neil

    2016-09-23

    We point out a surprising consequence of the usually assumed initial conditions for cosmological perturbations. Namely, a spectrum of Gaussian, linear, adiabatic, scalar, growing mode perturbations not only creates acoustic oscillations of the kind observed on very large scales today, it also leads to the production of shocks in the radiation fluid of the very early Universe. Shocks cause departures from local thermal equilibrium as well as create vorticity and gravitational waves. For a scale-invariant spectrum and standard model physics, shocks form for temperatures 1  GeVUniverse as early as 10^{-30}  sec after the big bang.

  13. Ternary nitrides for hydrogen storage: Li-B-N, Li-Al-N and Li-Ga-N systems

    International Nuclear Information System (INIS)

    Langmi, Henrietta W.; McGrady, G. Sean

    2008-01-01

    This paper reports an investigation of hydrogen storage performance of ternary nitrides based on lithium and the Group 13 elements boron, aluminum and gallium. These were prepared by ball milling Li 3 N together with the appropriate Group 13 nitride-BN, AlN or GaN. Powder X-ray diffraction of the products revealed that the ternary nitrides obtained are not the known Li 3 BN 2 , Li 3 AlN 2 and Li 3 GaN 2 phases. At 260 deg. C and 30 bar hydrogen pressure, the Li-Al-N ternary system initially absorbed 3.7 wt.% hydrogen, although this is not fully reversible. We observed, for the first time, hydrogen uptake by a pristine ternary nitride of Li and Al synthesized from the binary nitrides of the metals. While the Li-Ga-N ternary system also stored a significant amount of hydrogen, the storage capacity for the Li-B-N system was near zero. The hydrogenation reaction is believed to be similar to that of Li 3 N, and the enthalpies of hydrogen absorption for Li-Al-N and Li-Ga-N provide evidence that AlN and GaN, as well as the ball milling process, play a significant role in altering the thermodynamics of Li 3 N

  14. Shock parameter calculations at weak interplanetary shock waves

    Directory of Open Access Journals (Sweden)

    J. M. Gloag

    2005-02-01

    Full Text Available A large set of interplanetary shock waves observed using the Ulysses spacecraft is analysed in order to determine their local parameters. For the first time a detailed analysis is extended to the thermodynamic properties of a large number of events. The intention is to relate the shock parameters to the requirements set by MHD shock theory. A uniform approach is adopted in the selection of up and downstream regions for this analysis and applied to all the shock waves. Initially, the general case of a 3 component adiabatic plasma is considered. However, the calculation of magnetosonic and Alfvénic Mach numbers and the ratio of downstream to upstream entropy produce some unexpected results. In some cases there is no clear increase in entropy across the shock and also the magnetosonic Mach number can be less than 1. It is found that a more discerning use of data along with an empirical value for the polytropic index can raise the distribution of downstream to upstream entropy ratios to a more acceptable level. However, it is also realised that many of these shocks are at the very weakest end of the spectrum and associated phenomena may also contribute to the explanation of these results.

  15. Quasilinear simulations of interplanetary shocks and Earth's bow shock

    Science.gov (United States)

    Afanasiev, Alexandr; Battarbee, Markus; Ganse, Urs; Vainio, Rami; Palmroth, Minna; Pfau-Kempf, Yann; Hoilijoki, Sanni; von Alfthan, Sebastian

    2016-04-01

    We have developed a new self-consistent Monte Carlo simulation model for particle acceleration in shocks. The model includes a prescribed large-scale magnetic field and plasma density, temperature and velocity profiles and a self-consistently computed incompressible ULF foreshock under the quasilinear approximation. Unlike previous analytical treatments, our model is time dependent and takes full account of the anisotropic particle distributions and scattering in the wave-particle interaction process. We apply the model to the problem of particle acceleration at traveling interplanetary (IP) shocks and Earth's bow shock and compare the results with hybrid-Vlasov simulations and spacecraft observations. A qualitative agreement in terms of spectral shape of the magnetic fluctuations and the polarization of the unstable mode is found between the models and the observations. We will quantify the differences of the models and explore the region of validity of the quasilinear approach in terms of shock parameters. We will also compare the modeled IP shocks and the bow shock, identifying the similarities and differences in the spectrum of accelerated particles and waves in these scenarios. The work has received funding from the European Union's Horizon 2020 research and innovation programme under grant agreement No 637324 (HESPERIA). The Academy of Finland is thanked for financial support. We acknowledge the computational resources provided by CSC - IT Centre for Science Ltd., Espoo.

  16. Diaphragmless shock wave generators for industrial applications of shock waves

    Science.gov (United States)

    Hariharan, M. S.; Janardhanraj, S.; Saravanan, S.; Jagadeesh, G.

    2011-06-01

    The prime focus of this study is to design a 50 mm internal diameter diaphragmless shock tube that can be used in an industrial facility for repeated loading of shock waves. The instantaneous rise in pressure and temperature of a medium can be used in a variety of industrial applications. We designed, fabricated and tested three different shock wave generators of which one system employs a highly elastic rubber membrane and the other systems use a fast acting pneumatic valve instead of conventional metal diaphragms. The valve opening speed is obtained with the help of a high speed camera. For shock generation systems with a pneumatic cylinder, it ranges from 0.325 to 1.15 m/s while it is around 8.3 m/s for the rubber membrane. Experiments are conducted using the three diaphragmless systems and the results obtained are analyzed carefully to obtain a relation between the opening speed of the valve and the amount of gas that is actually utilized in the generation of the shock wave for each system. The rubber membrane is not suitable for industrial applications because it needs to be replaced regularly and cannot withstand high driver pressures. The maximum shock Mach number obtained using the new diaphragmless system that uses the pneumatic valve is 2.125 ± 0.2%. This system shows much promise for automation in an industrial environment.

  17. Shock wave dynamics derivatives and related topics

    CERN Document Server

    Emanuel, George

    2012-01-01

    "...this monograph develops an esoteric niche within shock wave theory. …treats shock waves from an analytical approach assuming perfect gas. Emanuel has made significant contributions to the theory of shock waves and has selected a number of topics that reflect those contributions."-Shock Waves, 2013.

  18. 7Li--7Be experiment

    International Nuclear Information System (INIS)

    Rowley, J.K.

    1978-01-01

    An experiment to detect solar neutrinos by use of lithium is considered. The reaction employed is 7 Li(ν,e - ) 7 Be. The parameters of a possible experimental arrangement are described; chemical separation, backgrounds, and counting are discussed at some length. Despite the problems such an experiment still seems feasible. 5 figures, 6 tables

  19. Nonlinearity, Conservation Law and Shocks

    Indian Academy of Sciences (India)

    Almost all natural phenomena, and social and economic changes, .... reference moving with velocity c also by the same symbol x and ... abstract as can be seen from the publication of the book Shock Waves and Reaction Diffusion Equation.

  20. Shock Thermodynamic Applied Research Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Shock Thermodynamic Applied Research Facility (STAR) facility, within Sandia’s Solid Dynamic Physics Department, is one of a few institutions in the world with a...

  1. Target design for shock ignition

    International Nuclear Information System (INIS)

    Schurtz, G; Ribeyre, X; Lafon, M

    2010-01-01

    The conventional approach of laser driven inertial fusion involves the implosion of cryogenic shells of deuterium-tritium ice. At sufficiently high implosion velocities, the fuel ignites by itself from a central hot spot. In order to reduce the risks of hydrodynamic instabilities inherent to large implosion velocities, it was proposed to compress the fuel at low velocity, and ignite the compressed fuel by means of a convergent shock wave driven by an intense spike at the end of the laser pulse. This scheme, known as shock ignition, reduces the risks of shell break-up during the acceleration phase, but it may be impeded by a low coupling efficiency of the laser pulse with plasma at high intensities. This work provides a relationship between the implosion velocity and the laser intensity required to ignite the target by a shock. The operating domain of shock ignition at different energies is described.

  2. Undercuts by Laser Shock Forming

    International Nuclear Information System (INIS)

    Wielage, Hanna; Vollertsen, Frank

    2011-01-01

    In laser shock forming TEA-CO 2 -laser induced shock waves are used to form metal foils, such as aluminum or copper. The process utilizes an initiated plasma shock wave on the target surface, which leads to a forming of the foil. A challenge in forming technologies is the manufacturing of undercuts. By conventional forming methods these special forms are not feasible. In this article, it is presented that undercuts in the micro range can be produced by laser shock deep drawing. Different drawing die diameters, drawing die depths and the material aluminum in the thicknesses 20 and 50 μm were investigated. It will be presented that smaller die diameters facilitate undercuts compared to bigger die diameters. The phenomena can be explained by Barlow's formula. Furthermore, it is shown which maximum undercut depth at different die diameters can be reached. To this end, cross-sections of the different parameter combinations are displayed.

  3. Electric Shock Injuries in Children

    Science.gov (United States)

    ... Issues Listen Español Text Size Email Print Share Electric Shock Injuries in Children Page Content ​When the ... comes into direct contact with a source of electricity, the current passes through it, producing what's called ...

  4. Relativistic shocks and particle acceleration

    International Nuclear Information System (INIS)

    Heavens, A.F.

    1988-01-01

    In this paper, we investigate the fluid dynamics of relativistic shock waves, and use the results to calculate the spectral index of particles accelerated by the Fermi process in such shocks. We have calculated the distributions of Fermi-accelerated particles at shocks propagating into cold proton-electron plasma and also cold electron-positron plasma. We have considered two different power spectra for the scattering waves, and find, in contrast to the non-relativistic case, that the spectral index of the accelerated particles depends on the wave power spectrum. On the assumption of thermal equilibrium both upstream and downstream, we present some useful fits for the compression ratio of shocks propagating at arbitrary speeds into gas of any temperature. (author)

  5. Shock wave interaction with turbulence: Pseudospectral simulations

    International Nuclear Information System (INIS)

    Buckingham, A.C.

    1986-01-01

    Shock waves amplify pre-existing turbulence. Shock tube and shock wave boundary layer interaction experiments provide qualitative confirmation. However, shock pressure, temperature, and rapid transit complicate direct measurement. Computational simulations supplement the experimental data base and help isolate the mechanisms responsible. Simulations and experiments, particularly under reflected shock wave conditions, significantly influence material mixing. In these pseudospectral Navier-Stokes simulations the shock wave is treated as either a moving (tracked or fitted) domain boundary. The simulations assist development of code mix models. Shock Mach number and pre-existing turbulence intensity initially emerge as key parameters. 20 refs., 8 figs

  6. Thermal Stability of LiPF6 Salt and Li-ion Battery Electrolytes Containing LiPF6

    OpenAIRE

    Yang, Hui; Zhuang, Guorong V.; Ross Jr., Philip N.

    2006-01-01

    The thermal stability of the neat LiPF6 salt and of 1 molal solutions of LiPF6 in prototypical Li-ion battery solvents was studied with thermogravimetric analysis (TGA) and on-line FTIR. Pure LiPF6 salt is thermally stable up to 380 oK in a dry inert atmosphere, and its decomposition path is a simple dissociation producing LiF as solid and PF5 as gaseous products. In the presence of water (300 ppm) in the carrier gas, its decomposition onset temperature is lowered as a result of direct t...

  7. The Efficacy of Cognitive Shock

    Science.gov (United States)

    2015-05-21

    way, causing dissonance or cognitive conflict, so that the mental model has to be ‘accommodated’ to the new data. Categories and knowledge have to...The Efficacy of Cognitive Shock A Monograph by MAJ Anthony L. Marston United States Army School of Advanced Military Studies...DATES COVERED (From - To) JUN 2014 – MAY 2015 4. TITLE AND SUBTITLE The Efficacy of Cognitive Shock 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c

  8. Pressurized Thermal Shock, Pts

    International Nuclear Information System (INIS)

    Boyd, C.

    2008-01-01

    Pressurized Thermal Shock (Pts) refers to a condition that challenges the integrity of the reactor pressure vessel. The root cause of this problem is the radiation embrittlement of the reactor vessel. This embrittlement leads to an increase in the reference temperature for nil ductility transition (RTNDT). RTNDT can increase to the point where the reactor vessel material can loose fracture toughness during overcooling events. The analysis of the risk of having a Pts for a specific plant is a multi-disciplinary problem involving probabilistic risk analysis (PRA), thermal-hydraulic analysis, and ultimately a structural and fracture analysis of the vessel wall. The PRA effort involves the postulation of overcooling events and ultimately leads to an integrated risk analysis. The thermal-hydraulic effort involves the difficult task of predicting the system behavior during a postulated overcooling scenario with a special emphasis on predicting the thermal and mechanic loadings on the reactor pressure vessel wall. The structural and fracture analysis of the reactor vessel wall relies on the thermal-hydraulic conditions as boundary conditions. The US experience has indicated that medium and large diameter primary system breaks dominate the risk of Pts along with scenarios that involve a stuck open valve (and associated system cooldown) that recloses resulting in system re-pressurization while the vessel wall is cool.

  9. Sepsis and septic shock

    Science.gov (United States)

    Hotchkiss, Richard S.; Moldawer, Lyle L.; Opal, Steven M.; Reinhart, Konrad; Turnbull, Isaiah R.; Vincent, Jean-Louis

    2017-01-01

    For more than two decades, sepsis was defined as a microbial infection that produces fever (or hypothermia), tachycardia, tachypnoea and blood leukocyte changes. Sepsis is now increasingly being considered a dysregulated systemic inflammatory and immune response to microbial invasion that produces organ injury for which mortality rates are declining to 15–25%. Septic shock remains defined as sepsis with hyperlactataemia and concurrent hypotension requiring vasopressor therapy, with in-hospital mortality rates approaching 30–50%. With earlier recognition and more compliance to best practices, sepsis has become less of an immediate life-threatening disorder and more of a long-term chronic critical illness, often associated with prolonged inflammation, immune suppression, organ injury and lean tissue wasting. Furthermore, patients who survive sepsis have continuing risk of mortality after discharge, as well as long-term cognitive and functional deficits. Earlier recognition and improved implementation of best practices have reduced in-hospital mortality, but results from the use of immunomodulatory agents to date have been disappointing. Similarly, no biomarker can definitely diagnose sepsis or predict its clinical outcome. Because of its complexity, improvements in sepsis outcomes are likely to continue to be slow and incremental. PMID:28117397

  10. Focusing of Shear Shock Waves

    Science.gov (United States)

    Giammarinaro, Bruno; Espíndola, David; Coulouvrat, François; Pinton, Gianmarco

    2018-01-01

    Focusing is a ubiquitous way to transform waves. Recently, a new type of shock wave has been observed experimentally with high-frame-rate ultrasound: shear shock waves in soft solids. These strongly nonlinear waves are characterized by a high Mach number, because the shear wave velocity is much slower, by 3 orders of magnitude, than the longitudinal wave velocity. Furthermore, these waves have a unique cubic nonlinearity which generates only odd harmonics. Unlike longitudinal waves for which only compressional shocks are possible, shear waves exhibit cubic nonlinearities which can generate positive and negative shocks. Here we present the experimental observation of shear shock wave focusing, generated by the vertical motion of a solid cylinder section embedded in a soft gelatin-graphite phantom to induce linearly vertically polarized motion. Raw ultrasound data from high-frame-rate (7692 images per second) acquisitions in combination with algorithms that are tuned to detect small displacements (approximately 1 μ m ) are used to generate quantitative movies of gel motion. The features of shear shock wave focusing are analyzed by comparing experimental observations with numerical simulations of a retarded-time elastodynamic equation with cubic nonlinearities and empirical attenuation laws for soft solids.

  11. Shock compression of synthetic opal

    International Nuclear Information System (INIS)

    Inoue, A; Okuno, M; Okudera, H; Mashimo, T; Omurzak, E; Katayama, S; Koyano, M

    2010-01-01

    Structural change of synthetic opal by shock-wave compression up to 38.1 GPa has been investigated by using SEM, X-ray diffraction method (XRD), Infrared (IR) and Raman spectroscopies. Obtained information may indicate that the dehydration and polymerization of surface silanole due to high shock and residual temperature are very important factors in the structural evolution of synthetic opal by shock compression. Synthetic opal loses opalescence by 10.9 and 18.4 GPa of shock pressures. At 18.4 GPa, dehydration and polymerization of surface silanole and transformation of network structure may occur simultaneously. The 4-membered ring of TO 4 tetrahedrons in as synthetic opal may be relaxed to larger ring such as 6-membered ring by high residual temperature. Therefore, the residual temperature may be significantly high at even 18.4 GPa of shock compression. At 23.9 GPa, opal sample recovered the opalescence. Origin of this opalescence may be its layer structure by shock compression. Finally, sample fuse by very high residual temperature at 38.1 GPa and the structure closes to that of fused SiO 2 glass. However, internal silanole groups still remain even at 38.1 GPa.

  12. Computations of slowly moving shocks

    International Nuclear Information System (INIS)

    Karni, S.; Canic, S.

    1997-01-01

    Computations of slowly moving shocks by shock capturing schemes may generate oscillations are generated already by first-order schemes, but become more pronounced in higher-order schemes which seem to exhibit different behaviors: (i) the first-order upwind (UW) scheme which generates strong oscillations and (ii) the Lax-Friedrichs scheme which appears not to generate any disturbances at all. A key observation is that in the UW case, the numerical viscosity in the shock family vanishes inside the slow shock layer. Simple scaling arguments show the third-order effects on the solution may no longer be neglected. We derive the third-order modified equation for the UW scheme and regard the oscillatory solution as a traveling wave solution of the parabolic modified equation for the perturbation. We then look at the governing equation for the perturbation, which points to a plausible mechanism by which postshock oscillations are generated. It contains a third-order source term that becomes significant inside the shock layer, and a nonlinear coupling term which projects the perturbation on all characteristic fields, including those not associated with the shock family. 5 refs., 8 figs

  13. Shock compression of synthetic opal

    Science.gov (United States)

    Inoue, A.; Okuno, M.; Okudera, H.; Mashimo, T.; Omurzak, E.; Katayama, S.; Koyano, M.

    2010-03-01

    Structural change of synthetic opal by shock-wave compression up to 38.1 GPa has been investigated by using SEM, X-ray diffraction method (XRD), Infrared (IR) and Raman spectroscopies. Obtained information may indicate that the dehydration and polymerization of surface silanole due to high shock and residual temperature are very important factors in the structural evolution of synthetic opal by shock compression. Synthetic opal loses opalescence by 10.9 and 18.4 GPa of shock pressures. At 18.4 GPa, dehydration and polymerization of surface silanole and transformation of network structure may occur simultaneously. The 4-membered ring of TO4 tetrahedrons in as synthetic opal may be relaxed to larger ring such as 6-membered ring by high residual temperature. Therefore, the residual temperature may be significantly high at even 18.4 GPa of shock compression. At 23.9 GPa, opal sample recovered the opalescence. Origin of this opalescence may be its layer structure by shock compression. Finally, sample fuse by very high residual temperature at 38.1 GPa and the structure closes to that of fused SiO2 glass. However, internal silanole groups still remain even at 38.1 GPa.

  14. Shock compression of synthetic opal

    Energy Technology Data Exchange (ETDEWEB)

    Inoue, A; Okuno, M; Okudera, H [Department of Earth Sciences, Kanazawa University Kanazawa, Ishikawa, 920-1192 (Japan); Mashimo, T; Omurzak, E [Shock Wave and Condensed Matter Research Center, Kumamoto University, Kumamoto, 860-8555 (Japan); Katayama, S; Koyano, M, E-mail: okuno@kenroku.kanazawa-u.ac.j [JAIST, Nomi, Ishikawa, 923-1297 (Japan)

    2010-03-01

    Structural change of synthetic opal by shock-wave compression up to 38.1 GPa has been investigated by using SEM, X-ray diffraction method (XRD), Infrared (IR) and Raman spectroscopies. Obtained information may indicate that the dehydration and polymerization of surface silanole due to high shock and residual temperature are very important factors in the structural evolution of synthetic opal by shock compression. Synthetic opal loses opalescence by 10.9 and 18.4 GPa of shock pressures. At 18.4 GPa, dehydration and polymerization of surface silanole and transformation of network structure may occur simultaneously. The 4-membered ring of TO{sub 4} tetrahedrons in as synthetic opal may be relaxed to larger ring such as 6-membered ring by high residual temperature. Therefore, the residual temperature may be significantly high at even 18.4 GPa of shock compression. At 23.9 GPa, opal sample recovered the opalescence. Origin of this opalescence may be its layer structure by shock compression. Finally, sample fuse by very high residual temperature at 38.1 GPa and the structure closes to that of fused SiO{sub 2} glass. However, internal silanole groups still remain even at 38.1 GPa.

  15. Electromagnetically driven radiative shocks and their measurements

    International Nuclear Information System (INIS)

    Kondo, K.; Watanabe, M.; Nakajima, M.; Kawamura, T.; Horioka, K.

    2005-01-01

    Experimental results on a generation of strong shocks in a compact pulse power device are reported. The characteristics of strong shocks are different from hydrodynamical shocks' because they depend on not only collisions but radiation processes. Radiative shocks are relevant to high energy density phenomena such as the explosions of supernovae. When initial pressure is lower than about 50 mtorr, an interesting structure is confirmed at the shock front, which might indicate a phenomenon proceeded by the radiative process. (author)

  16. Pressurized thermal shock (PTS)

    International Nuclear Information System (INIS)

    Rosso, Ricardo D.; Ventura, Mirta A.

    2006-01-01

    In the present work, a description of Thermal Shock in Pressurized conditions (PTS), and its influence in the treatment of the integrity of the pressure vessel (RPV) of a Pressurized Water Reactor (PWR) and/or of a Heavy water Pressurized water Reactor (PHWR) is made. Generally, the analysis of PTS involves a process of three stages: a-) Modeling with a System Code of relevant thermohydraulics transients in reference with the thermal shock; b-) The local distribution of temperatures in the downcomer and the heat transference coefficients from the RPV wall to the fluid, are determined; c-) The fracture mechanical analysis. These three stages are included in this work: Results with the thermohydraulics code Relap5/mod.3, are obtained, for a LOCA scenario in the hot leg of the cooling System of the Primary System of the CAN-I reactor. The method used in obtaining results is described. A study on the basis of lumped parameters of the local evolutions of the temperature of the flow is made, in the downcomer of the reactor pressure vessel. The purpose of this study is to determine how the intensification of the stress coefficient, varies in function of the emergency injected water during the thermohydraulic transients that take place under the imposed conditions in the postulated scene. Specially, it is considered a 50 cm 2 break, located in the neighborhoods of the pressurized with the corresponding hot leg connection. This size is considered like the most critical. The method used to obtain the results is described. The fracture mechanical analysis is made. From the obtained results we confirmed that we have a simple tool of easy application in order to analyze phenomena of the type PTS in the postulated scenes by break in the cold and hot legs of the primary system. This methodology of calculus is completely independent of the used ones by the Nucleoelectrica Argentina S.A. (NASA) in the analysis of the PTS phenomena in the CAN-I. The results obtained with the adopted

  17. Radiation- and pair-loaded shocks

    Science.gov (United States)

    Lyutikov, Maxim

    2018-06-01

    We consider the structure of mildly relativistic shocks in dense media, taking into account the radiation and pair loading, and diffusive radiation energy transfer within the flow. For increasing shock velocity (increasing post-shock temperature), the first important effect is the efficient energy redistribution by radiation within the shock that leads to the appearance of an isothermal jump, whereby the flow reaches the final state through a discontinuous isothermal transition. The isothermal jump, on scales much smaller than the photon diffusion length, consists of a weak shock and a quick relaxation to the isothermal conditions. Highly radiation-dominated shocks do not form isothermal jump. Pair production can mildly increase the overall shock compression ratio to ≈10 (4 for matter-dominated shocks and 7 of the radiation-dominated shocks).

  18. LiHo(PO34

    Directory of Open Access Journals (Sweden)

    Mokhtar Férid

    2009-02-01

    Full Text Available Lithium holmium(III polyphosphate(V, LiHo(PO34, belongs to the type I of polyphosphates with general formula ALn(PO34, where A is a monovalent cation and Ln is a trivalent rare earth cation. In the crystal structure, the polyphosphate chains spread along the b-axis direction, with a repeat period of four tetrahedra and 21 internal symmetry. The Li and Ho atoms are both located on twofold rotation axes and are surrounded by four and eight O atoms, leading to a distorted tetrahedral and dodecahedral coordination, respectively. The HoO8 polyhedra are isolated from each other, the closest Ho...Ho distance being 5.570 (1 Å.

  19. Prediction of massive bleeding. Shock index and modified shock index.

    Science.gov (United States)

    Terceros-Almanza, L J; García-Fuentes, C; Bermejo-Aznárez, S; Prieto-Del Portillo, I J; Mudarra-Reche, C; Sáez-de la Fuente, I; Chico-Fernández, M

    2017-12-01

    To determine the predictive value of the Shock Index and Modified Shock Index in patients with massive bleeding due to severe trauma. Retrospective cohort. Severe trauma patient's initial attention at the intensive care unit of a tertiary hospital. Patients older than 14 years that were admitted to the hospital with severe trauma (Injury Severity Score >15) form January 2014 to December 2015. We studied the sensitivity (Se), specificity (Sp), positive and negative predictive value (PV+ and PV-), positive and negative likelihood ratio (LR+ and LR-), ROC curves (Receiver Operating Characteristics) and the area under the same (AUROC) for prediction of massive hemorrhage. 287 patients were included, 76.31% (219) were male, mean age was 43,36 (±17.71) years and ISS was 26 (interquartile range [IQR]: 21-34). The overall frequency of massive bleeding was 8.71% (25). For Shock Index: AUROC was 0.89 (95% confidence intervals [CI] 0.84 to 0.94), with an optimal cutoff at 1.11, Se was 91.3% (95% CI: 73.2 to 97.58) and Sp was 79.69% (95% CI: 74.34 to 84.16). For the Modified Shock Index: AUROC was 0.90 (95% CI: 0.86 to 0.95), with an optimal cutoff at 1.46, Se was 95.65% (95% CI: 79.01 to 99.23) and Sp was 75.78% (95% CI: 70.18 to 80.62). Shock Index and Modified Shock Index are good predictors of massive bleeding and could be easily incorporated to the initial workup of patients with severe trauma. Copyright © 2017 Elsevier España, S.L.U. y SEMICYUC. All rights reserved.

  20. Üliõpilase meelespea

    Index Scriptorium Estoniae

    2001-01-01

    16. aprill. TPÜ valitsuse otsus nr. 3 kõlab nii : alustada TPÜ lõpetanutele UNESCO, Euroopa Nõukogu ja Euroopa Komisjoni ühise töögrupi poolt välja töötatud ingliskeelse ülikooli diplomi lisa Diplome Supplement (DS) väljastamist üliõpilase soovil ; kinnitada Diploma Supplementì väljastamise kord ja vormistamise maksumus 500 krooni : [täistekst

  1. Kinetic Monte Carlo Study of Li Intercalation in LiFePO4.

    Science.gov (United States)

    Xiao, Penghao; Henkelman, Graeme

    2018-01-23

    Even as a commercial cathode material, LiFePO 4 remains of tremendous research interest for understanding Li intercalation dynamics. The partially lithiated material spontaneously separates into Li-poor and Li-rich phases at equilibrium. Phase segregation is a surprising property of LiFePO 4 given its high measured rate capability. Previous theoretical studies, aiming to describe Li intercalation in LiFePO 4 , include both atomic-scale density functional theory (DFT) calculations of static Li distributions and entire-particle-scale phase field models, based upon empirical parameters, studying the dynamics of the phase separation. Little effort has been made to bridge the gap between these two scales. In this work, DFT calculations are used to fit a cluster expansion for the basis of kinetic Monte Carlo calculations, which enables long time scale simulations with accurate atomic interactions. This atomistic model shows how the phases evolve in Li x FePO 4 without parameters from experiments. Our simulations reveal that an ordered Li 0.5 FePO4 phase with alternating Li-rich and Li-poor planes along the ac direction forms between the LiFePO 4 and FePO 4 phases, which is consistent with recent X-ray diffraction experiments showing peaks associated with an intermediate-Li phase. The calculations also help to explain a recent puzzling experiment showing that LiFePO 4 particles with high aspect ratios that are narrower along the [100] direction, perpendicular to the [010] Li diffusion channels, actually have better rate capabilities. Our calculations show that lateral surfaces parallel to the Li diffusion channels, as well as other preexisting sites that bind Li weakly, are important for phase nucleation and rapid cycling performance.

  2. Shock diffraction in alumina powder

    International Nuclear Information System (INIS)

    Venz, G.; Killen, P.D.; Page, N.W.

    1996-01-01

    In order to produce complex shaped components by dynamic compaction of ceramic powders detailed knowledge of their response under shock loading conditions is required. This work attempts to provide data on release effects and shock attenuation in 1 μm and 5 μm α-alumina powders which were compacted to between 85 % and 95 % of the solid phase density by the impact of high velocity steel projectiles. As in previous work, the powder was loaded into large cylindrical dies with horizontal marker layers of a contrasting coloured powder to provide a record of powder displacement in the recovered specimens. After recovery and infiltration with a thermosetting resin the specimens were sectioned and polished to reveal the structure formed by the passage of the projectile and shock wave. Results indicate that the shock pressures generated were of the order of 0.5 to 1.4 GPa and higher, with shock velocities and sound speeds in the ranges 650 to 800 m/s and 350 to 400 m/s respectively

  3. Transient shocks beyond the heliopause

    International Nuclear Information System (INIS)

    Fermo, R L; Pogorelov, N V; Burlaga, L F

    2015-01-01

    The heliopause is a rich, dynamic surface affected by the time-dependent solar wind. Stream interactions due to coronal mass ejections (CMEs), corotating interaction regions (CIRs), and other transient phenomena are known to merge producing global merged interaction regions (GMIRs). Numerical simulations of the solar wind interaction with the local interstellar medium (LISM) show that GMIRs, as well other time-dependent structures in the solar wind, may produce compression/rarefaction waves and shocks in the LISM behind the heliopause. These shocks may initiate wave activity observed by the Voyager spacecraft. The magnetometer onboard Voyager 1 indeed observed a few structures that may be interpreted as shocks. We present numerical simulations of such shocks in the year of 2000, when both Voyager spacecraft were in the supersonic solar wind region, and in 2012, when Voyager 1 observed traveling shocks. In the former case, Voyager observations themselves provide time- dependent boundary conditions in the solar wind. In the latter case, we use OMNI data at 1 AU to analyze the plasma and magnetic field behavior after Voyager 1 crossed the heliospheric boundary. Numerical results are compared with spacecraft observations. (paper)

  4. Energetic ion acceleration at collisionless shocks

    Science.gov (United States)

    Decker, R. B.; Vlahos, L.

    1985-01-01

    An example is presented from a test particle simulation designed to study ion acceleration at oblique turbulent shocks. For conditions appropriate at interplanetary shocks near 1 AU, it is found that a shock with theta sub B n = 60 deg is capable of producing an energy spectrum extending from 10 keV to approx. 1 MeV in approx 1 hour. In this case total energy gains result primarily from several separate episodes of shock drift acceleration, each of which occurs when particles are scattered back to the shock by magnetic fluctuations in the shock vicinity.

  5. Energetic ion acceleration at collisionless shocks

    International Nuclear Information System (INIS)

    Decker, R.B.; Vlahos, L.

    1985-01-01

    An example is presented from a test particle simulation designed to study ion acceleration at oblique turbulent shocks. For conditions appropriate at interplanetary shocks near 1 AU, it is found that a shock with theta sub B n = 60 deg is capable of producing an energy spectrum extending from 10 keV to approx 1 MeV in approx 1 hour. In this case total energy gains result primarily from several separate episodes of shock drift acceleration, each of which occurs when particles are scattered back to the shock by magnetic fluctuations in the shock vicinity

  6. Why the Nature of Oil Shocks Matters

    International Nuclear Information System (INIS)

    Archanskaia, Elizaveta; Hubert, Paul; Creel, Jerome

    2009-03-01

    This article studies the impact of oil shocks on the macro-economy in two ways insofar unexploited in the literature. The analysis is conducted at the global level, and it explicitly accounts for the potentially changing nature of oil shocks. Based on an original world GDP series and a grouping of oil shocks according to their nature, we find that oil supply shocks negatively impact world growth, contrary to oil demand shocks, pro-cyclical in their nature. This result is robust at the national level for the US. Furthermore, endogenous monetary policy is shown to have no counter-cyclical effects in the context of an oil demand shock. (authors)

  7. MHD intermediate shock discontinuities: Pt. 1

    International Nuclear Information System (INIS)

    Kennel, C.F.; Blandford, R.D.; Coppi, P.

    1989-01-01

    Recent numerical investigations have focused attention once more on the role of intermediate shocks in MHD. Four types of intermediate shock are identified using a graphical representation of the MHD Rankine-Hugoniot conditions. This same representation can be used to exhibit the close relationship of intermediate shocks to switch-on shocks and rotational discontinuities. The conditions under which intermediate discontinuities can be found are elucidated. The variations in velocity, pressure, entropy and magnetic-field jumps with upstream parameters in intermediate shocks are exhibited graphically. The evolutionary arguments traditionally advanced against intermediate shocks may fail because the equations of classical MHD are not strictly hyperbolic. (author)

  8. Shock waves in weakly compressed granular media.

    Science.gov (United States)

    van den Wildenberg, Siet; van Loo, Rogier; van Hecke, Martin

    2013-11-22

    We experimentally probe nonlinear wave propagation in weakly compressed granular media and observe a crossover from quasilinear sound waves at low impact to shock waves at high impact. We show that this crossover impact grows with the confining pressure P0, whereas the shock wave speed is independent of P0-two hallmarks of granular shocks predicted recently. The shocks exhibit surprising power law attenuation, which we model with a logarithmic law implying that shock dissipation is weak and qualitatively different from other granular dissipation mechanisms. We show that elastic and potential energy balance in the leading part of the shocks.

  9. The Interstellar 7Li/6Li Ratio in the Diffuse Gas Near IC 443

    Science.gov (United States)

    Ritchey, A. M.; Taylor, C. J.; Federman, S. R.; Lambert, D. L.

    2010-11-01

    Supernova remnants are believed to be the primary acceleration sites of Galactic cosmic rays (GCR), which are essential to gas-phase interstellar chemistry since they are a major source of ionization in both diffuse and dense environments. The interaction of accelerated particles with interstellar gas will also synthesize isotopes of the light elements Li, Be, and B through the spallation of CNO nuclei (producing all stable LiBeB isotopes) and through α+α fusion (yielding 6Li and 7Li, only). Type II supernovae may provide an additional source of 7Li and 11B during core collapse through neutrino-induced spallation in the He and C shells of the progenitor star (the ν-process). However, direct observational evidence for light element synthesis resulting from cosmic-ray or neutrino-induced spallation is rare. Here, we examine 7Li/6Li isotope ratios along four lines of sight through the supernova remnant IC 443 using observations of the Li I λ6707 doublet made with the Hobby-Eberly Telescope (HET) at McDonald Observatory. The 7Li/6Li ratio in the general interstellar medium is expected to be similar to the ratio of ~12 that characterizes solar system material. A local enhancement in the cosmic-ray flux will act to lower 7Li/6Li, yielding a ratio of ~2 when cosmic rays dominate Li synthesis. Gamma-ray emission from IC 443 provides strong evidence for the interaction of cosmic rays accelerated by the remnant with the ambient atomic and molecular gas. Yet this material has also been contaminated by the ejecta of a Type II supernova, which should be enriched in 7Li. We are seeking 7Li/6Li ratios that are either higher than the solar system ratio as a result of the ν-process or lower due to cosmic-ray spallation. Since the fine structure separation of the Li I doublet is comparable to the isotope shift (~7 km s-1) and each fine structure line is further split into hyperfine components, the velocity structure along the line of sight must be carefully constrained if

  10. Pre-main-sequence depletion of Li-6 and Li-7

    International Nuclear Information System (INIS)

    Proffitt, C.R.; Michaud, G.

    1989-01-01

    Depletion of Li-6 and Li-7 during premain-sequence contraction has been calculated for several evolutionary sequences. Slightly greater Li-7 depletion was found than by other recent workers. On the premain sequence, Li-6 is depleted by a factor of at least 10 in the present models for stars with T(eff) lower than 6800 K on the main sequence. Because of the shorter destruction time scale for Li-6 as compared to Li-7, the determination of the abundances of these two isotopes would place strict constraints on the structure of premain-sequence stars. 39 refs

  11. Shock, diaschisis and von Monakow

    Directory of Open Access Journals (Sweden)

    Eliasz Engelhardt

    2013-07-01

    Full Text Available The concept of shock apparently emerged in the middle of the 18th century (Whyett as an occurrence observed experimentally after spinal cord transection, and identified as "shock" phenomenon one century later (Hall. The concept was extended (Brown-Séquard and it was suggested that brain lesions caused functional rupture in regions distant from the injured one ("action à distance". The term "diaschisis" (von Monakow, proposed as a new modality of shock, had its concept broadened, underpinned by observations of patients, aiming at distinguishing between symptoms of focal brain lesions and transitory effects they produced, attributable to depression of distant parts of the brain connected to the injured area. Presently, diaschisis is related mainly to cerebrovascular lesions and classified according to the connection fibers involved, as proposed by von Monakow. Depression of metabolism and blood flow in regions anatomically separated, but related by connections with the lesion, allows observing diaschisis with neuroimaging.

  12. Shock compression of geological materials

    International Nuclear Information System (INIS)

    Kirk, S; Braithwaite, C; Williamson, D; Jardine, A

    2014-01-01

    Understanding the shock compression of geological materials is important for many applications, and is particularly important to the mining industry. During blast mining the response to shock loading determines the wave propagation speed and resulting fragmentation of the rock. The present work has studied the Hugoniot of two geological materials; Lake Quarry Granite and Gosford Sandstone. For samples of these materials, the composition was characterised in detail. The Hugoniot of Lake Quarry Granite was predicted from this information as the material is fully dense and was found to be in good agreement with the measured Hugoniot. Gosford Sandstone is porous and undergoes compaction during shock loading. Such behaviour is similar to other granular material and we show how it can be described using a P-a compaction model.

  13. Shock compression of simulated adobe

    Science.gov (United States)

    Braithwaite, C. H.; Church, P. D.; Gould, P. J.; Stewart, B.; Jardine, A. P.

    2017-01-01

    A series of plate impact experiments were conducted to investigate the shock response of a simulant for adobe, a traditional form of building material widely used around the world. Air dried bricks were sourced from the London brick company, dry machined and impacted at a range of velocities in a single stage gas gun. The shock Hugoniot was determined (Us =2.26up+0.37) as well as release information. The material was found to behave in a manner which was similar to that of loose sand and considerably less stiff than a weak porous sandstone. The effect of any cementing of the grains was examined by shocking powdered samples contained within a cell arrangement.

  14. Determining the refractive index of shocked [100] lithium fluoride to the limit of transmissibility

    International Nuclear Information System (INIS)

    Rigg, P. A.; Scharff, R. J.; Hixson, R. S.; Knudson, M. D.

    2014-01-01

    Lithium fluoride (LiF) is a common window material used in shock- and ramp-compression experiments because it displays a host of positive attributes in these applications. Most commonly, it is used to maintain stress at an interface and velocimetry techniques are used to record the particle velocity at that interface. In this application, LiF remains transparent to stresses up to 200 GPa. In this stress range, LiF has an elastic-plastic response with a very low (<0.5 GPa) elastic precursor and exhibits no known solid-solid phase transformations. However, because the density dependence of the refractive index of LiF does not follow the Gladstone-Dale relation, the measured particle velocity at this interface is not the true particle velocity and must be corrected. For that reason, the measured velocity is often referred to as the apparent velocity in these types of experiments. In this article, we describe a series of shock-compression experiments that have been performed to determine the refractive index of LiF at the two most commonly used wavelengths (532 nm and 1550 nm) between 35 and 200 GPa to high precision. A modified form of the Gladstone-Dale relation was found to work best to fit the determined values of refractive index. In addition, we provide a direct relationship between the apparent and true particle velocity to correct experimentally obtained wave profiles by others using these velocimetry techniques.

  15. Shock Initiation of Damaged Explosives

    Energy Technology Data Exchange (ETDEWEB)

    Chidester, S K; Vandersall, K S; Tarver, C M

    2009-10-22

    Explosive and propellant charges are subjected to various mechanical and thermal insults that can increase their sensitivity over the course of their lifetimes. To quantify this effect, shock initiation experiments were performed on mechanically and thermally damaged LX-04 (85% HMX, 15% Viton by weight) and PBX 9502 (95% TATB, 5% Kel-F by weight) to obtain in-situ manganin pressure gauge data and run distances to detonation at various shock pressures. We report the behavior of the HMX-based explosive LX-04 that was damaged mechanically by applying a compressive load of 600 psi for 20,000 cycles, thus creating many small narrow cracks, or by cutting wedge shaped parts that were then loosely reassembled, thus creating a few large cracks. The thermally damaged LX-04 charges were heated to 190 C for long enough for the beta to delta solid - solid phase transition to occur, and then cooled to ambient temperature. Mechanically damaged LX-04 exhibited only slightly increased shock sensitivity, while thermally damaged LX-04 was much more shock sensitive. Similarly, the insensitive explosive PBX 9502 was mechanically damaged using the same two techniques. Since PBX 9502 does not undergo a solid - solid phase transition but does undergo irreversible or 'rachet' growth when thermally cycled, thermal damage to PBX 9502 was induced by this procedure. As for LX-04, the thermally damaged PBX 9502 demonstrated a greater shock sensitivity than mechanically damaged PBX 9502. The Ignition and Growth reactive flow model calculated the increased sensitivities by igniting more damaged LX-04 and PBX 9502 near the shock front based on the measured densities (porosities) of the damaged charges.

  16. Ultralong Lifespan and Ultrafast Li Storage: Single-Crystal LiFePO4 Nanomeshes.

    Science.gov (United States)

    Zhang, Yan; Zhang, Hui Juan; Feng, Yang Yang; Fang, Ling; Wang, Yu

    2016-01-27

    A novel LiFePO4 material, in the shape of a nanomesh, has been rationally designed and synthesized based on the low crystal-mismatch strategy. The LiFePO4 nanomesh possesses several advantages in morphology and crystal structure, including a mesoporous structure, its crystal orientation that is along the [010] direction, and a shortened Li-ion diffusion path. These properties are favorable for their application as cathode in Li-ion batteries, as these will accelerate the Li-ion diffusion rate, improve the Li-ion exchange between the LiFePO4 nanomesh and the electrolyte, and reduce the Li-ion capacitive behavior during Li intercalation. So the LiFePO4 nanomesh exhibits a high specific capacity, enhanced rate capability, and strengthened cyclability. The method developed here can also be extended to other similar systems, for instance, LiMnPO4 , LiCoPO4 , and LiNiPO4 , and may find more applications in the designed synthesis of functional materials. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Shock compaction of molybdenum powder

    Science.gov (United States)

    Ahrens, T. J.; Kostka, D.; Vreeland, T., Jr.; Schwarz, R. B.; Kasiraj, P.

    1983-01-01

    Shock recovery experiments which were carried out in the 9 to 12 GPa range on 1.4 distension Mo and appear adequate to compact to full density ( 45 (SIGMA)m) powders were examined. The stress levels, however, are below those calculated to be from 100 to approx. 22 GPa which a frictional heating model predicts are required to consolidate approx. 10 to 50 (SIGMA)m particles. The model predicts that powders that have a distension of m=1.6 shock pressures of 14 to 72 GPa are required to consolidate Mo powders in the 50 to 10 (SIGMA)m range.

  18. Cation disorder in shocked orthopyroxene.

    Science.gov (United States)

    Dundon, R. W.; Hafner, S. S.

    1971-01-01

    The study of cation distributions over nonequivalent lattice sites in minerals may reveal information on the history of temperature and pressure in rocks. Chemically homogeneous orthopyroxene specimens were shocked under well-controlled conditions in the laboratory in order to provide a basis for the interpretation of more complex natural materials. As a result of the investigation it is concluded that the distribution of magnesium and iron over the M1 and M2 positions in Bamle enstatite shocked at 1 megabar is highly disordered. It corresponds to an equilibrium distribution of at least 1000 C.

  19. Sepsis and Septic Shock Strategies.

    Science.gov (United States)

    Armstrong, Bracken A; Betzold, Richard D; May, Addison K

    2017-12-01

    Three therapeutic principles most substantially improve organ dysfunction and survival in sepsis: early, appropriate antimicrobial therapy; restoration of adequate cellular perfusion; timely source control. The new definitions of sepsis and septic shock reflect the inadequate sensitivity, specify, and lack of prognostication of systemic inflammatory response syndrome criteria. Sequential (sepsis-related) organ failure assessment more effectively prognosticates in sepsis and critical illness. Inadequate cellular perfusion accelerates injury and reestablishing perfusion limits injury. Multiple organ systems are affected by sepsis and septic shock and an evidence-based multipronged approach to systems-based therapy in critical illness results in improve outcomes. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Evaluation of Li3N accumulation in a fused LiCl/Li salt matrix

    International Nuclear Information System (INIS)

    Eberle, C. S.

    1998-01-01

    Pyrochemical conditioning of spent nuclear fuel for the purpose of final disposal is currently being demonstrated at Argonne National Laboratory (ANL), and ongoing research in this area includes the demonstration of this process on spent oxide fuel. In conjunction with this research a pilot scale of the preprocessing stage is being designed by ANL-W to demonstrate the in situ hot cell capability of the chemical reduction stage. An impurity evaluation was completed for a Li/LiCl salt matrix in the presence of spent LWR uranium oxide fuel. A simple analysis was performed in which the sources of impurities in the salt matrix were only from the cell atmosphere. Only reactions with the lithium were considered. The levels of impurities were shown to be highly sensitive system conditions. A predominance diagram for the Li-O-N system was constructed for the device, and the general oxidation, nitridation and combined reactions were calculated as a function of oxygen and nitrogen partial pressure. These calculations and hotcell atmosphere data were used to determine the total number and type of impurities expected in the salt matrix and the mass rate for the device was determined

  1. Thermal stability of LiPF 6 salt and Li-ion battery electrolytes containing LiPF 6

    Science.gov (United States)

    Yang, Hui; Zhuang, Guorong V.; Ross, Philip N.

    The thermal stability of the neat lithium hexafluorophosphate (LiPF 6) salt and of 1 molal (m) solutions of LiPF 6 in prototypical Li-ion battery solvents was studied with thermogravimetric analysis (TGA) and on-line Fourier transform infrared (FTIR). Pure LiPF 6 salt is thermally stable up to 107 °C in a dry inert atmosphere, and its decomposition path is a simple dissociation producing lithium fluoride (LiF) as solid and PF 5 as gaseous products. In the presence of water (300 ppm) in the carrier gas, its decomposition onset temperature is lowered as a result of direct thermal reaction between LiPF 6 and water vapor to form phosphorous oxyfluoride (POF 3) and hydrofluoric acid (HF). No new products were observed in 1 m solutions of LiPF 6 in ethylene carbonate (EC), dimethyl carbonate (DMC) and ethyl methyl carbonate (EMC) by on-line TGA-FTIR analysis. The storage of the same solutions in sealed containers at 85 °C for 300-420 h did not produce any significant quantity of new products as well. In particular, no alkylflurophosphates were found in the solutions after storage at elevated temperature. In the absence of either an impurity like alcohol or cathode active material that may (or may not) act as a catalyst, there is no evidence of thermally induced reaction between LiPF 6 and the prototypical Li-ion battery solvents EC, PC, DMC or EMC.

  2. Shock/shock interactions between bodies and wings

    Directory of Open Access Journals (Sweden)

    Gaoxiang XIANG

    2018-02-01

    Full Text Available This paper examines the Shock/Shock Interactions (SSI between the body and wing of aircraft in supersonic flows. The body is simplified to a flat wedge and the wing is assumed to be a sharp wing. The theoretical spatial dimension reduction method, which transforms the 3D problem into a 2D one, is used to analyze the SSI between the body and wing. The temperature and pressure behind the Mach stem induced by the wing and body are obtained, and the wave configurations in the corner are determined. Numerical validations are conducted by solving the inviscid Euler equations in 3D with a Non-oscillatory and Non-free-parameters Dissipative (NND finite difference scheme. Good agreements between the theoretical and numerical results are obtained. Additionally, the effects of the wedge angle and sweep angle on wave configurations and flow field are considered numerically and theoretically. The influences of wedge angle are significant, whereas the effects of sweep angle on wave configurations are negligible. This paper provides useful information for the design and thermal protection of aircraft in supersonic and hypersonic flows. Keywords: Body and wing, Flow field, Hypersonic flow, Shock/shock interaction, Wave configurations

  3. Analytical solutions of hypersonic type IV shock - shock interactions

    Science.gov (United States)

    Frame, Michael John

    An analytical model has been developed to predict the effects of a type IV shock interaction at high Mach numbers. This interaction occurs when an impinging oblique shock wave intersects the most normal portion of a detached bow shock. The flowfield which develops is complicated and contains an embedded jet of supersonic flow, which may be unsteady. The jet impinges on the blunt body surface causing very high pressure and heating loads. Understanding this type of interaction is vital to the designers of cowl lips and leading edges on air- breathing hypersonic vehicles. This analytical model represents the first known attempt at predicting the geometry of the interaction explicitly, without knowing beforehand the jet dimensions, including the length of the transmitted shock where the jet originates. The model uses a hyperbolic equation for the bow shock and by matching mass continuity, flow directions and pressure throughout the flowfield, a prediction of the interaction geometry can be derived. The model has been shown to agree well with the flowfield patterns and properties of experiments and CFD, but the prediction for where the peak pressure is located, and its value, can be significantly in error due to a lack of sophistication in the model of the jet fluid stagnation region. Therefore it is recommended that this region of the flowfield be modeled in more detail and more accurate experimental and CFD measurements be used for validation. However, the analytical model has been shown to be a fast and economic prediction tool, suitable for preliminary design, or for understanding the interactions effects, including the basic physics of the interaction, such as the jet unsteadiness. The model has been used to examine a wide parametric space of possible interactions, including different Mach number, impinging shock strength and location, and cylinder radius. It has also been used to examine the interaction on power-law shaped blunt bodies, a possible candidate for

  4. "Driverless" Shocks in the Interplanetary Medium

    Science.gov (United States)

    Gopalswamy, N.; Kaiser, M. L.; Lara, A.

    1999-01-01

    Many interplanetary shocks have been detected without an obvious driver behind them. These shocks have been thought to be either blast waves from solar flares or shocks due to sudden increase in solar wind speed caused by interactions between large scale open and closed field lines of the Sun. We investigated this problem using a set of interplanetary shock detected {\\it in situ} by the Wind space craft and tracing their solar origins using low frequency radio data obtained by the Wind/WAVES experiment. For each of these "driverless shocks" we could find a unique coronal mass ejections (CME) event observed by the SOHO (Solar and Heliospheric Observatory) coronagraphs. We also found that these CMEs were ejected at large angles from the Sun-Earth line. It appears that the "driverless shocks" are actually driver shocks, but the drivers were not intercepted by the spacecraft. We conclude that the interplanetary shocks are much more extended than the driving CMEs.

  5. Shock and Vibration. Volume 1, Issue 1

    National Research Council Canada - National Science Library

    Pilkey, Walter D

    1994-01-01

    ..., and earthquake engineering. Among the specific areas to be covered are vibration testing and control, vibration condition monitoring and diagnostics, shock hardenings, modal technology, shock testing, data acquisition, fluid...

  6. Initial ISEE magnetometer results: shock observation

    International Nuclear Information System (INIS)

    Russell, C.T.

    1979-01-01

    ISEE-1 and -2 magnetic field profiles across 6 terrestrial bow shock and one interplanetary shock are examined. The inteplanetary shock illustrates the behavior of a low Mach number shock. Three examples of low or moderate β, high Mach number, quasi-perpendicular shocks are examined. These did not have upstream waves, but rather had waves growing in the field gradient. Two examples of high β shocks showed little coherence in field variation even though the two vehicles were only a few hundred kilometers apart. The authors present the joint behavior of wave, particle and field data across some of these shocks to show some of the myriad of shock features whose behavior they are now beginning to investigate. (Auth.)

  7. 29th International Symposium on Shock Waves

    CERN Document Server

    Ranjan, Devesh

    2015-01-01

    This proceedings present the results of the 29th International Symposium on Shock Waves (ISSW29) which was held in Madison, Wisconsin, U.S.A., from July 14 to July 19, 2013. It was organized by the Wisconsin Shock Tube Laboratory, which is part of the College of Engineering of the University of Wisconsin-Madison. The ISSW29 focused on the following areas: Blast Waves, Chemically Reactive Flows, Detonation and Combustion,  Facilities, Flow Visualization, Hypersonic Flow, Ignition, Impact and Compaction, Industrial Applications, Magnetohydrodynamics, Medical and Biological Applications, Nozzle Flow, Numerical Methods, Plasmas, Propulsion, Richtmyer-Meshkov Instability, Shock-Boundary Layer Interaction, Shock Propagation and Reflection, Shock Vortex Interaction, Shock Waves in Condensed Matter, Shock Waves in Multiphase Flow, as well as Shock Waves in Rarefield Flow. The two Volumes contain the papers presented at the symposium and serve as a reference for the participants of the ISSW 29 and individuals interes...

  8. Inferior vena cava obstruction and shock

    Directory of Open Access Journals (Sweden)

    Megri Mohammed

    2018-01-01

    Full Text Available Shock is one of the most challenging life-threatening conditions with high mortality and morbidity; the outcomes are highly dependent on the early detection and management of the condition. Septic shock is the most common type of shock in the Intensive Care Unit. While not as common as other subsets of shock, obstructive shock is a significant subtype due to well defined mechanical and pathological causes, including tension pneumothorax, massive pulmonary embolism, and cardiac tamponade. We are presenting a patient with obstructive shock due to inferior vena cava obstruction secondary to extensive deep venous thrombosis. Chance of survival from obstructive shock in our patient was small; however, there was complete and immediate recovery after treatment of the obstruction on recognizing the affected vessels. This case alerts the practicing intensivist and the emergency medicine physician to consider occlusion of the great vessels other than the pulmonary artery or aorta as causes of obstructive shock.

  9. Shock dynamics in layered periodic media

    KAUST Repository

    Ketcheson, David I.

    2012-01-01

    Solutions of constant-coeffcient nonlinear hyperbolic PDEs generically develop shocks, even if the initial data is smooth. Solutions of hyperbolic PDEs with variable coeffcients can behave very differently. We investigate formation and stability of shock waves in a one-dimensional periodic layered medium by a computational study of time-reversibility and entropy evolution. We find that periodic layered media tend to inhibit shock formation. For small initial conditions and large impedance variation, no shock formation is detected even after times much greater than the time of shock formation in a homogeneous medium. Furthermore, weak shocks are observed to be dynamically unstable in the sense that they do not lead to significant long-term entropy decay. We propose a characteristic condition for admissibility of shocks in heterogeneous media that generalizes the classical Lax entropy condition and accurately predicts the formation or absence of shocks in these media.

  10. 2013 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Tulalip Partnership

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In October 2012, WSI (Watershed Sciences, Inc.) was contracted by the Puget Sound LiDAR Consortium (PSLC)to collect Light Detection and Ranging (LiDAR) data on a...

  11. 2014 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Willapa Valley (Delivery 1)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In January, 2014 WSI, a Quantum Spatial (QSI) company, was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR) data...

  12. 2013 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Saddle Mountain

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In October 2013, WSI, a Quantum Spatial Company (QSI), was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR) data...

  13. 2015 Puget Sound LiDAR Consortium (PSLC) LiDAR: WA DNR Lands (P2)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In June 2014, WSI, a Quantum Spatial Inc. (QSI) company, was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...

  14. 2013 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Nooksack

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In July 2012, WSI (Watershed Sciences, Inc.) was contracted by the Puget Sound LiDARConsortium (PSLC) to collect Light Detection and Ranging (LiDAR) data on a...

  15. 2015 Puget Sound LiDAR Consortium (PSLC) LiDAR: WA DNR Lands (P1)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In June 2014, WSI, a Quantum Spatial Inc. (QSI) company, was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...

  16. 2009 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Lewis County, Washington

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Watershed Sciences, Inc. (WSI) collected Light Detection and Ranging (LiDAR) data for the Lewis County survey area for the Puget Sound LiDAR Consortium. This data...

  17. 2013 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Entiat

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In October 2012, WSI (Watershed Sciences, Inc.) was contracted by the Puget Sound LiDARConsortium (PSLC) to collect Light Detection and Ranging (LiDAR) data for the...

  18. Converging cylindrical shocks in ideal magnetohydrodynamics

    International Nuclear Information System (INIS)

    Pullin, D. I.; Mostert, W.; Wheatley, V.; Samtaney, R.

    2014-01-01

    We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R=√(μ 0 /p 0 ) I/(2 π) where I is the current, μ 0 is the permeability, and p 0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field

  19. Converging cylindrical shocks in ideal magnetohydrodynamics

    KAUST Repository

    Pullin, D. I.

    2014-09-01

    We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R = √μ0/p0 I/(2π) where I is the current, μ0 is the permeability, and p0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field then

  20. Converging cylindrical shocks in ideal magnetohydrodynamics

    KAUST Repository

    Pullin, D. I.; Mostert, W.; Wheatley, V.; Samtaney, Ravi

    2014-01-01

    We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R = √μ0/p0 I/(2π) where I is the current, μ0 is the permeability, and p0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field then

  1. Converging cylindrical shocks in ideal magnetohydrodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Pullin, D. I. [Graduate Aerospace Laboratories, California Institute of Technology, Pasadena, California 91125 (United States); Mostert, W.; Wheatley, V. [School of Mechanical and Mining Engineering, University of Queensland, Queensland 4072 (Australia); Samtaney, R. [Mechanical Engineering, Physical Sciences and Engineering Division, King Abdullah University of Science and Technology, Thuwal (Saudi Arabia)

    2014-09-15

    We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R=√(μ{sub 0}/p{sub 0}) I/(2 π) where I is the current, μ{sub 0} is the permeability, and p{sub 0} is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The

  2. Evolution of elastic x-ray scattering in laser-shocked warm dense lithium.

    Science.gov (United States)

    Kugland, N L; Gregori, G; Bandyopadhyay, S; Brenner, C M; Brown, C R D; Constantin, C; Glenzer, S H; Khattak, F Y; Kritcher, A L; Niemann, C; Otten, A; Pasley, J; Pelka, A; Roth, M; Spindloe, C; Riley, D

    2009-12-01

    We have studied the dynamics of warm dense Li with near-elastic x-ray scattering. Li foils were heated and compressed using shock waves driven by 4-ns-long laser pulses. Separate 1-ns-long laser pulses were used to generate a bright source of 2.96 keV Cl Ly- alpha photons for x-ray scattering, and the spectrum of scattered photons was recorded at a scattering angle of 120 degrees using a highly oriented pyrolytic graphite crystal operated in the von Hamos geometry. A variable delay between the heater and backlighter laser beams measured the scattering time evolution. Comparison with radiation-hydrodynamics simulations shows that the plasma is highly coupled during the first several nanoseconds, then relaxes to a moderate coupling state at later times. Near-elastic scattering amplitudes have been successfully simulated using the screened one-component plasma model. Our main finding is that the near-elastic scattering amplitudes are quite sensitive to the mean ionization state Z[over ] and by extension to the choice of ionization model in the radiation-hydrodynamics simulations used to predict plasma properties within the shocked Li.

  3. Evolution of elastic x-ray scattering in laser-shocked warm dense lithium

    International Nuclear Information System (INIS)

    Kugland, N. L.; Niemann, C.; Gregori, G.; Bandyopadhyay, S.; Spindloe, C.; Brenner, C. M.; Brown, C. R. D.; Constantin, C.; Glenzer, S. H.; Khattak, F. Y.; Kritcher, A. L.; Otten, A.; Pelka, A.; Roth, M.; Pasley, J.; Riley, D.

    2009-01-01

    We have studied the dynamics of warm dense Li with near-elastic x-ray scattering. Li foils were heated and compressed using shock waves driven by 4-ns-long laser pulses. Separate 1-ns-long laser pulses were used to generate a bright source of 2.96 keV Cl Ly-α photons for x-ray scattering, and the spectrum of scattered photons was recorded at a scattering angle of 120 deg. using a highly oriented pyrolytic graphite crystal operated in the von Hamos geometry. A variable delay between the heater and backlighter laser beams measured the scattering time evolution. Comparison with radiation-hydrodynamics simulations shows that the plasma is highly coupled during the first several nanoseconds, then relaxes to a moderate coupling state at later times. Near-elastic scattering amplitudes have been successfully simulated using the screened one-component plasma model. Our main finding is that the near-elastic scattering amplitudes are quite sensitive to the mean ionization state Z and by extension to the choice of ionization model in the radiation-hydrodynamics simulations used to predict plasma properties within the shocked Li.

  4. Entropy jump across an inviscid shock wave

    Science.gov (United States)

    Salas, Manuel D.; Iollo, Angelo

    1995-01-01

    The shock jump conditions for the Euler equations in their primitive form are derived by using generalized functions. The shock profiles for specific volume, speed, and pressure are shown to be the same, however density has a different shock profile. Careful study of the equations that govern the entropy shows that the inviscid entropy profile has a local maximum within the shock layer. We demonstrate that because of this phenomenon, the entropy, propagation equation cannot be used as a conservation law.

  5. Collisionless Electrostatic Shock Modeling and Simulation

    Science.gov (United States)

    2016-10-21

    equations with piston -like boundary conditions gives a solution for the shock behavior. • Assumes cold upstream ions, therefore neglecting shock...temperature ratio (>10) – Wave Train Wavelength – Shock-Front Mach Number – Reflected Ion Beam Velocity Gathering Experiment Data – Double Plasma Device...experimental shock data. • Inconsistencies in published 1969 double -plasma device data hampered validation. Future Work: Extension to Moderately

  6. Shock waves in gas and plasma

    International Nuclear Information System (INIS)

    Niu, K.

    1996-01-01

    A shock wave is a discontinuous surface that connects supersonic flow with subsonic flow. After a shock wave, flow velocity is reduced, and pressure and temperature increase; entropy especially increases across a shock wave. Therefore, flow is in nonequilibrium, and irreversible processes occur inside the shock layer. The thickness of a shock wave in neutral gas is of the order of the mean free path of the fluid particle. A shock wave also appears in magnetized plasma. Provided that when the plasma flow is parallel to the magnetic field, a shock wave appears if the governing equation for velocity potential is in hyperbolic type in relation with the Mach number and the Alfven number. When the flow is perpendicular to the magnetic field, the Maxwell stress, in addition to the pressure, plays a role in the shock wave in plasma. When the plasma temperature is so high, as the plasma becomes collision-free, another type of shock wave appears. In a collision-free shock wave, gyromotions of electrons around the magnetic field lines cause the shock formation instead of collisions in a collision-dominant plasma or neutral gas. Regardless of a collision-dominant or collision-free shock wave, the fluid that passes through the shock wave is heated in addition to being compressed. In inertial confinement fusion, the fuel must be compressed. Really, implosion motion performs fuel compression. A shock wave, appearing in the process of implosion, compresses the fuel. The shock wave, however, heats the fuel more intensively, and it makes it difficult to compress the fuel further because high temperatures invite high pressure. Adiabatic compression of the fuel is the desired result during the implosion, without the formation of a shock wave. (Author)

  7. Electric shock and electrical fire specialty

    International Nuclear Information System (INIS)

    2011-02-01

    This book deals with electric shock and electrical fire, which is made up seven chapters. It describes of special measurement for electric shock and electrical fire. It mentions concretely about electrical fire analysis and precautionary measurement, electrical shock analysis cases, occurrence of static electricity and measurement, gas accident, analysis of equipment accident and precautionary measurement. The book is published to educate the measurement on electric shock and electrical fire by electrical safety technology education center in Korea Electrical Safety Corporation.

  8. Investigation of the $^{8}$Li($^{2}$H,p)$^{9}$Li Reaction at REX-ISOLDE

    CERN Multimedia

    2002-01-01

    We propose to investigate the $^{8}$Li($^{2}$H,p )$^{9}$Li reaction at REX-ISOLDE. The main aim is to test a recently found discrepancy in extracted spectroscopic factors for this reaction. As a byproduct we will obtain improved data relevant for predictions of the $^{8}$Li(n,$\\gamma$)$^{9}$Li rate in inhomogeneous nucleosynthesis. For the full experiment including beam tuning and background measurements we ask for 13 shifts.

  9. Spectroscopic analysis of LiHoF4 and LiErF4

    DEFF Research Database (Denmark)

    Christensen, H.P.

    1979-01-01

    The polarized absorption spectra for Ho3+ and Er3+ in LiHoF4 and LiErF4, respectively, have been recorded in the spectral interval 4000-26 000 cm-1 at 2 K. Parts of the spectra were examined at higher temperatures. The experimental levels for Ho3+ and Er3+ in LiRF4 were close to those found in Li...

  10. Li-rich anti-perovskite Li3OCl films with enhanced ionic conductivity

    Energy Technology Data Exchange (ETDEWEB)

    Lu, XJ; Wu, G; Howard, JW; Chen, AP; Zhao, YS; Daemen, LL; Jia, QX

    2014-08-13

    Anti-perovskite solid electrolyte films were prepared by pulsed laser deposition, and their room-temperature ionic conductivity can be improved by more than an order of magnitude in comparison with its bulk counterpart. The cyclability of Li3OCl films in contact with lithium was evaluated using a Li/Li3OCl/Li symmetric cell, showing self-stabilization during cycling test.

  11. Prenatal temperature shocks reduce cooperation

    NARCIS (Netherlands)

    Duchoslav, Jan

    2017-01-01

    Climate change has not only led to a sustained rise in mean global temperature over the past decades, but also increased the frequency of extreme weather events. This paper explores the effect of temperature shocks in utero on later-life taste for cooperation. Using historical climate data combined

  12. Shock Incarceration: Rehabilitation or Retribution?

    Science.gov (United States)

    MacKenzie, Doris Layton; And Others

    1989-01-01

    Reviews Louisiana's shock incarceration program used as alternative to standard prison incarceration. Program involves short period of imprisonment in a "boot camp" type atmosphere followed by three phases of intensive parole supervision. Examines the program in regard to its rehabilitative potential and compares program elements to…

  13. Shock Mounting for Heavy Machines

    Science.gov (United States)

    Thompson, A. R.

    1984-01-01

    Elastomeric bearings eliminate extraneous forces. Rocket thrust transmitted from motor to load cells via support that absorbs extraneous forces so they do not affect accuracy of thrust measurements. Adapter spoked cone fits over forward end of rocket motor. Shock mounting developed for rocket engines under test used as support for heavy machines, bridges, or towers.

  14. 2-Shock layered tuning campaign

    Science.gov (United States)

    Masse, Laurent; Dittrich, T.; Khan, S.; Kyrala, G.; Ma, T.; MacLaren, S.; Ralph, J.; Salmonson, J.; Tipton, R.; Los Alamos Natl Lab Team; Lawrence Livermore Natl Lab Team

    2016-10-01

    The 2-Shock platform has been developed to maintain shell sphericity throughout the compression phase of an indirect-drive target implosion and produce a stagnating hot spot in a quasi 1D-like manner. A sub-scale, 1700 _m outer diameter, and thick, 200 _m, uniformly Silicon doped, gas-filled plastic capsule is driven inside a nominal size 5750 _m diameter ignition hohlraum. The hohlraum fill is near vacuum to reduce back-scatter and improve laser/drive coupling. A two-shock pulse of about 1 MJ of laser energy drives the capsule. The thick capsule prevents ablation front feed-through to the imploded core. This platform has demonstrated its efficiency to tune a predictable and reproducible 1-D implosion with a nearly round shape. It has been shown that the high foot performance was dominated by the local defect growth due to the ablation front instability and by the hohlraum radiation asymmetries. The idea here is to take advantage of this 2-Shock platform to design a 1D-like layered implosion and eliminates the deleterious effects of radiation asymmetries and ablation front instability growth. We present the design work and our first experimental results of this near one-dimensional 2-Shock layered design. This work was performed under the auspices of the Lawrence Livermore National Security, LLC, (LLNS) under Contract No. DE-AC52-07NA27344.

  15. Interstellar turbulence and shock waves

    International Nuclear Information System (INIS)

    Bykov, A.M.

    1982-01-01

    Random deflections of shock fronts propagated through the turbulent interstellar medium can produce the strong electro-density fluctuations on scales l> or approx. =10 13 cm inferred from pulsar radio scintillations. The development of turbulence in the hot-phase ISM is discussed

  16. Nonlinearity, Conservation Law and Shocks

    Indian Academy of Sciences (India)

    However, genuine nonlinearity is always present in an ideal gas. The conservation form of the equation (25) brings in shocks which cut off the growing part of the amplitUde as shown in. Figure 15. Acknowledgements. The author sincerely thanks the two referees whose valuable comments led to an improvement of the ...

  17. Model for Shock Wave Chaos

    KAUST Repository

    Kasimov, Aslan R.

    2013-03-08

    We propose the following model equation, ut+1/2(u2−uus)x=f(x,us) that predicts chaotic shock waves, similar to those in detonations in chemically reacting mixtures. The equation is given on the half line, x<0, and the shock is located at x=0 for any t≥0. Here, us(t) is the shock state and the source term f is taken to mimic the chemical energy release in detonations. This equation retains the essential physics needed to reproduce many properties of detonations in gaseous reactive mixtures: steady traveling wave solutions, instability of such solutions, and the onset of chaos. Our model is the first (to our knowledge) to describe chaos in shock waves by a scalar first-order partial differential equation. The chaos arises in the equation thanks to an interplay between the nonlinearity of the inviscid Burgers equation and a novel forcing term that is nonlocal in nature and has deep physical roots in reactive Euler equations.

  18. EXTRACORPOREAL SHOCK WAVE LITHOTRIPSY AS ...

    African Journals Online (AJOL)

    Objective To evaluate extracorporeal shock wave lithotripsy (ESWL) as a monotherapy for urolithiasis in patients with solitary kidney and to determine the factors that may affect its results. Patients and Methods Using the Dornier MFL 5000 lithotriptor, 106 patients with solitary kidney (80 men and 26 women) were treated for ...

  19. Shock formation within sonoluminescence bubbles

    International Nuclear Information System (INIS)

    Vuong, V.Q.; Szeri, A.J.; Young, D.A.

    1999-01-01

    A strong case has been made by several authors that sharp, spherically symmetric shocks converging on the center of a spherical bubble driven by a strong acoustic field give rise to rapid compression and heating that produces the brief flash of light known as sonoluminescence. The formation of such shocks is considered. It is found that, although at the main collapse the bubble wall does indeed launch an inwardly-traveling compression wave, and although the subsequent reflection of the wave at the bubble center produces a very rapid temperature peak, the wave is prevented from steepening into a sharp shock by an adverse gradient in the sound speed caused by heat transfer. It is shown that the mathematical characteristics of the flow can be prevented from accumulating into a shock front by this adverse sound speed gradient. A range of results is presented for a variety of bubble ambient radii and sound field amplitudes suggested by experiments. The time scale of the peak temperature in the bubble is set by the dynamics of the compression wave: this is typically in the range 100 - 300 ps (FWHM) in concert with recent measurements of the sonoluminescence pulse width. copyright 1999 American Institute of Physics

  20. Model for Shock Wave Chaos

    KAUST Repository

    Kasimov, Aslan R.; Faria, Luiz; Rosales, Rodolfo R.

    2013-01-01

    : steady traveling wave solutions, instability of such solutions, and the onset of chaos. Our model is the first (to our knowledge) to describe chaos in shock waves by a scalar first-order partial differential equation. The chaos arises in the equation

  1. Studying shocks in model astrophysical flows

    International Nuclear Information System (INIS)

    Chakrabarti, S.K.

    1989-01-01

    We briefly discuss some properties of the shocks in the existing models for quasi two-dimensional astrophysical flows. All of these models which allow the study of shock analytically have some unphysical characteristics due to inherent assumptions made. We propose a hybrid model for a thin flow which has fewer unpleasant features and is suitable for the study of shocks. (author). 5 refs

  2. Shock waves in relativistic nuclear matter, I

    International Nuclear Information System (INIS)

    Gleeson, A.M.; Raha, S.

    1979-02-01

    The relativistic Rankine-Hugoniot relations are developed for a 3-dimensional plane shock and a 3-dimensional oblique shock. Using these discontinuity relations together with various equations of state for nuclear matter, the temperatures and the compressibilities attainable by shock compression for a wide range of laboratory kinetic energy of the projectile are calculated. 12 references

  3. The microphysics of collisionless shock waves

    DEFF Research Database (Denmark)

    Marcowith, Alexandre; Bret, Antoine; Bykov, Andrei

    2016-01-01

    Collisionless shocks, that is shocks mediated by electromagnetic processes, are customary in space physics and in astrophysics. They are to be found in a great variety of objects and environments: magnetospheric and heliospheric shocks, supernova remnants, pulsar winds and their nebulæ, active ga...

  4. Permeability enhancement by shock cooling

    Science.gov (United States)

    Griffiths, Luke; Heap, Michael; Reuschlé, Thierry; Baud, Patrick; Schmittbuhl, Jean

    2015-04-01

    The permeability of an efficient reservoir, e.g. a geothermal reservoir, should be sufficient to permit the circulation of fluids. Generally speaking, permeability decreases over the life cycle of the geothermal system. As a result, is usually necessary to artificially maintain and enhance the natural permeability of these systems. One of the methods of enhancement -- studied here -- is thermal stimulation (injecting cold water at low pressure). This goal of this method is to encourage new thermal cracks within the reservoir host rocks, thereby increasing reservoir permeability. To investigate the development of thermal microcracking in the laboratory we selected two granites: a fine-grained (Garibaldi Grey granite, grain size = 0.5 mm) and a course-grained granite (Lanhelin granite, grain size = 2 mm). Both granites have an initial porosity of about 1%. Our samples were heated to a range of temperatures (100-1000 °C) and were either cooled slowly (1 °C/min) or shock cooled (100 °C/s). A systematic microstructural (2D crack area density, using standard stereological techniques, and 3D BET specific surface area measurements) and rock physical property (porosity, P-wave velocity, uniaxial compressive strength, and permeability) analysis was undertaken to understand the influence of slow and shock cooling on our reservoir granites. Microstructurally, we observe that the 2D crack surface area per unit volume and the specific surface area increase as a result of thermal stressing, and, for the same maximum temperature, crack surface area is higher in the shock cooled samples. This observation is echoed by our rock physical property measurements: we see greater changes for the shock cooled samples. We can conclude that shock cooling is an extremely efficient method of generating thermal microcracks and modifying rock physical properties. Our study highlights that thermal treatments are likely to be an efficient method for the "matrix" permeability enhancement of

  5. Inappropriate shocks in the subcutaneous ICD

    DEFF Research Database (Denmark)

    Olde Nordkamp, Louise R A; Brouwer, Tom F; Barr, Craig

    2015-01-01

    shocks have been reported. METHODS: We analyzed the incidence, predictors and management of inappropriate shocks in the EFFORTLESS S-ICD Registry, which collects S-ICD implantation information and follow-up data from clinical centers in Europe and New Zealand. RESULTS: During a follow-up of 21 ± 13...... xyphoid to V6) reduced the risk. Reprogramming or optimization of SVT treatment after the first clinical event of inappropriate shock was successful in preventing further inappropriate shocks for cardiac oversensing and SVT events. CONCLUSIONS: Inappropriate shocks, mainly due to cardiac oversensing...

  6. Perpendicular relativistic shocks in magnetized pair plasma

    Science.gov (United States)

    Plotnikov, Illya; Grassi, Anna; Grech, Mickael

    2018-04-01

    Perpendicular relativistic (γ0 = 10) shocks in magnetized pair plasmas are investigated using two dimensional Particle-in-Cell simulations. A systematic survey, from unmagnetized to strongly magnetized shocks, is presented accurately capturing the transition from Weibel-mediated to magnetic-reflection-shaped shocks. This transition is found to occur for upstream flow magnetizations 10-3 10-2, it leaves place to a purely electromagnetic precursor following from the strong emission of electromagnetic waves at the shock front. Particle acceleration is found to be efficient in weakly magnetized perpendicular shocks in agreement with previous works, and is fully suppressed for σ > 10-2. Diffusive Shock Acceleration is observed only in weakly magnetized shocks, while a dominant contribution of Shock Drift Acceleration is evidenced at intermediate magnetizations. The spatial diffusion coefficients are extracted from the simulations allowing for a deeper insight into the self-consistent particle kinematics and scale with the square of the particle energy in weakly magnetized shocks. These results have implications for particle acceleration in the internal shocks of AGN jets and in the termination shocks of Pulsar Wind Nebulae.

  7. Üliõpilasteatrid peavad Itaalias kongressi

    Index Scriptorium Estoniae

    2006-01-01

    Itaalia väikelinnas Urbinos lõpeb 27. juulil sealse ülikooli teatri Teatro Aenigma ja Rahvusvahelise Üliõpilasteatrite Assotsiatsiooni koostöös kuues tudengiteatrite maailmakongress. Eestist osaleb ja peab ettekande lavastaja ja Tartu Üliõpilasteatri kunstiline juht Kalev Kudu

  8. Nuclear charge radius of {sup 11}Li

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, Rodolfo, E-mail: R.Sanchez@GSI.de; Noertershaeuser, Wilfried [Gesellschaft fuer Schwerionenforschung (Germany); Dax, Andreas [CERN(Switzerland); Ewald, Guido; Goette, Stefan; Kirchner, Reinhard; Kluge, H.-Juergen; Kuehl, Thomas [Gesellschaft fuer Schwerionenforschung (Germany); Wojtaszek, Agnieszka [Swietokrzyska Academy, Institute of Physics (Poland); Bushaw, Bruce A. [Pacific Northwest National Laboratory (United States); Drake, Gordon W. F. [University of Windsor, Department of Physics (Canada); Yan Zongchao [University of New Brunswick, Department of Physics (Canada); Zimmermann, Claus [Physikalisches Institut, Eberhard Karls Universitaet Tuebingen (Germany); Albers, Daniel; Behr, John; Bricault, Pierre; Dilling, Jens; Dombsky, Marik; Lassen, Jens; Phil Levy, C. D. [Tri-University Meson Facility (Canada)

    2006-07-15

    We have determined the nuclear charge radius of {sup 11}Li by high-precision laser spectroscopy. The experiment was performed at the TRIUMF-ISAC facility where the {sup 7}Li-{sup 11}Li isotope shift (IS) was measured in the 2s{yields}3s electronic transition using Doppler-free two-photon spectroscopy with a relative accuracy better than 10{sup -5}. The accuracy for the IS of the other lithium isotopes was also improved. IS's are mainly caused by differences in nuclear mass, but changes in proton distribution also give small contributions. Comparing experimentally measured IS with advanced atomic calculation of purely mass-based shifts, including QED and relativistic effects, allows derivation of the nuclear charge radii. The radii are found to decrease monotonically from {sup 6}Li to {sup 9}Li, and then increase with {sup 11}Li about 11% larger than {sup 9}Li. These results are a benchmark for the open question as to whether nuclear core excitation by halo neutrons is necessary to explain the large nuclear matter radius of {sup 11}Li; thus, the results are compared with a number of nuclear structure models.

  9. Nuclear charge radius of 11Li

    International Nuclear Information System (INIS)

    Sanchez, Rodolfo; Noertershaeuser, Wilfried; Dax, Andreas; Ewald, Guido; Goette, Stefan; Kirchner, Reinhard; Kluge, H.-Juergen; Kuehl, Thomas; Wojtaszek, Agnieszka; Bushaw, Bruce A.; Drake, Gordon W. F.; Yan Zongchao; Zimmermann, Claus; Albers, Daniel; Behr, John; Bricault, Pierre; Dilling, Jens; Dombsky, Marik; Lassen, Jens; Phil Levy, C. D.

    2006-01-01

    We have determined the nuclear charge radius of 11 Li by high-precision laser spectroscopy. The experiment was performed at the TRIUMF-ISAC facility where the 7 Li- 11 Li isotope shift (IS) was measured in the 2s → 3s electronic transition using Doppler-free two-photon spectroscopy with a relative accuracy better than 10 -5 . The accuracy for the IS of the other lithium isotopes was also improved. IS's are mainly caused by differences in nuclear mass, but changes in proton distribution also give small contributions. Comparing experimentally measured IS with advanced atomic calculation of purely mass-based shifts, including QED and relativistic effects, allows derivation of the nuclear charge radii. The radii are found to decrease monotonically from 6 Li to 9 Li, and then increase with 11 Li about 11% larger than 9 Li. These results are a benchmark for the open question as to whether nuclear core excitation by halo neutrons is necessary to explain the large nuclear matter radius of 11 Li; thus, the results are compared with a number of nuclear structure models.

  10. Infrastructure Investment Protection with LiDAR

    Science.gov (United States)

    2012-10-15

    The primary goal of this research effort was to explore the wide variety of uses of LiDAR technology and to evaluate their : applicability to NCDOT practices. NCDOT can use this information about LiDAR in determining how and when the : technology can...

  11. Saginaw Bay, MI LiDAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — TASK NAME:(NRCS) Saginaw Bay, MI LiDAR LiDAR Data Acquisition and Processing Production Task USGS Contract No. G10PC00057 Task Order No. G11PD01254 Woolpert Order...

  12. Microstructure Analysis of Synthesized LiBOB

    Directory of Open Access Journals (Sweden)

    Etty Marti Wigayati

    2015-11-01

    Full Text Available Lithium bis (oxalate borate or LiBOB is an active material used as the electrolyte for lithium battery application. LiBOB (LiB(C2O42 powder was prepared from LiOH, H2C2O4 and H3BO3. The employed method was solid state reaction. LiBOB powder produced from the reaction was then observed using SEM and TEM. Surface area was analyzed using Quantachrome Nova 4200e. From the analysis analyzed using XRD to identify the resulting phases, crystal structure, and crystallite size. The functional groups were analyzed using FT-IR. The particle morphology was result, it was seen that the resulted phases were C4LiBO8 and LiB(C2O42.H2O, the crystal structure was orthorhombic with space group Pbca and Pnma. From the particle morphology observation it was shown that micro pores were created irregularly. When the observation was deepened, nanopores with elongated round shape were seen within the micropores. The pore size was approximately 50–100 nm. The surface area, total pore volume, and average pore diameter of LiBOB powder was 88.556 m2/g, 0.4252 cm3/g, and 19.2 nm respectively.

  13. Initial conditions of radiative shock experiments

    International Nuclear Information System (INIS)

    Kuranz, C. C.; Drake, R. P.; Krauland, C. M.; Marion, D. C.; Grosskopf, M. J.; Rutter, E.; Torralva, B.; Holloway, J. P.; Bingham, D.; Goh, J.; Boehly, T. R.; Sorce, A. T.

    2013-01-01

    We performed experiments at the Omega Laser Facility to characterize the initial, laser-driven state of a radiative shock experiment. These experiments aimed to measure the shock breakout time from a thin, laser-irradiated Be disk. The data are then used to inform a range of valid model parameters, such as electron flux limiter and polytropic γ, used when simulating radiative shock experiments using radiation hydrodynamics codes. The characterization experiment and the radiative shock experiment use a laser irradiance of ∼7 × 10 14 W cm −2 to launch a shock in the Be disk. A velocity interferometer and a streaked optical pyrometer were used to infer the amount of time for the shock to move through the Be disk. The experimental results were compared with simulation results from the Hyades code, which can be used to model the initial conditions of a radiative shock system using the CRASH code

  14. Exploratory laser-driven shock wave studies

    International Nuclear Information System (INIS)

    Solem, J.C.; Veeser, L.R.

    1977-11-01

    We show the results of a feasibility study for investigating shock structure and for measuring equation-of-state parameters using high-energy, short-pulse lasers. We discuss the temporal and spatial structure of the luminosity from laser-driven shock unloading in aluminum foils. We demonstrate that shock velocity can be measured by observing the time interval between shock emergence across two thicknesses and show data for shocks of 1.3 and 2.1 Mbar. The fact that we observe shock fronts cleanly breaking through steps as small as 3 μm indicates that the shock front thickness is very small in the few megabar region; this is the first experimental verification that these fronts are not more than a few micrometers thick. We present approximate measurements of free-surface velocity. Finally, we speculate on the use of these techniques to obtain detailed equation-of-state data

  15. Shock-induced chemistry in organic materials

    Energy Technology Data Exchange (ETDEWEB)

    Dattelbaum, Dana M [Los Alamos National Laboratory; Sheffield, Steve [Los Alamos National Laboratory; Engelke, Ray [Los Alamos National Laboratory; Manner, Virginia [Los Alamos National Laboratory; Chellappa, Raja [Los Alamos National Laboratory; Yoo, Choong - Shik [WASHINGTON STATE UNIV

    2011-01-20

    The combined 'extreme' environments of high pressure, temperature, and strain rates, encountered under shock loading, offer enormous potential for the discovery of new paradigms in chemical reactivity not possible under more benign conditions. All organic materials are expected to react under these conditions, yet we currently understand very little about the first bond-breaking steps behind the shock front, such as in the shock initiation of explosives, or shock-induced reactivity of other relevant materials. Here, I will present recent experimental results of shock-induced chemistry in a variety of organic materials under sustained shock conditions. A comparison between the reactivity of different structures is given, and a perspective on the kinetics of reaction completion under shock drives.

  16. Experimental methods of shock wave research

    CERN Document Server

    Seiler, Friedrich

    2016-01-01

    This comprehensive and carefully edited volume presents a variety of experimental methods used in Shock Waves research. In 14 self contained chapters this 9th volume of the “Shock Wave Science and Technology Reference Library” presents the experimental methods used in Shock Tubes, Shock Tunnels and Expansion Tubes facilities. Also described is their set-up and operation. The uses of an arc heated wind tunnel and a gun tunnel are also contained in this volume. Whenever possible, in addition to the technical description some typical scientific results obtained using such facilities are described. Additionally, this authoritative book includes techniques for measuring physical properties of blast waves and laser generated shock waves. Information about active shock wave laboratories at different locations around the world that are not described in the chapters herein is given in the Appendix, making this book useful for every researcher involved in shock/blast wave phenomena.

  17. Motion of shocks through interplanetary streams

    International Nuclear Information System (INIS)

    Burlaga, L.F.; Scudder, J.D.

    1975-01-01

    A model for the motion of flare-generated shocks through interplanetary streams is presented, illustrating the effects of a stream-shock interaction on the shock strength and geometry. It is a gas dynamic calculation based on Whitham's method and on an empirical approximation for the relevant characteristics of streams. The results show that the Mach number of a shock can decrease appreciably to near unity in the interaction region ahead of streams and that the interaction of a spherically symmetric shock with a spiral-shaped corotating stream can cause significant distortions of the initial shock front geometry. The geometry of the February 15--16, 1967, shock discussed by Lepping and Chao (1972) is qualitatively explained by this model

  18. Do oil shocks predict economic policy uncertainty?

    Science.gov (United States)

    Rehman, Mobeen Ur

    2018-05-01

    Oil price fluctuations have influential role in global economic policies for developed as well as emerging countries. I investigate the role of international oil prices disintegrated into structural (i) oil supply shock, (ii) aggregate demand shock and (iii) oil market specific demand shocks, based on the work of Kilian (2009) using structural VAR framework on economic policies uncertainty of sampled markets. Economic policy uncertainty, due to its non-linear behavior is modeled in a regime switching framework with disintegrated structural oil shocks. Our results highlight that Indian, Spain and Japanese economic policy uncertainty responds to the global oil price shocks, however aggregate demand shocks fail to induce any change. Oil specific demand shocks are significant only for China and India in high volatility state.

  19. Shock Wave Dynamics in Weakly Ionized Plasmas

    Science.gov (United States)

    Johnson, Joseph A., III

    1999-01-01

    An investigation of the dynamics of shock waves in weakly ionized argon plasmas has been performed using a pressure ruptured shock tube. The velocity of the shock is observed to increase when the shock traverses the plasma. The observed increases cannot be accounted for by thermal effects alone. Possible mechanisms that could explain the anomalous behavior include a vibrational/translational relaxation in the nonequilibrium plasma, electron diffusion across the shock front resulting from high electron mobility, and the propagation of ion-acoustic waves generated at the shock front. Using a turbulence model based on reduced kinetic theory, analysis of the observed results suggest a role for turbulence in anomalous shock dynamics in weakly ionized media and plasma-induced hypersonic drag reduction.

  20. Li-ion conduction in the LiBH4:LiI system from Density Functional Theory calculations and Quasi-Elastic Neutron Scattering

    DEFF Research Database (Denmark)

    Myrdal, Jon Steinar Gardarsson; Blanchard, Didier; Sveinbjörnsson, Dadi Þorsteinn

    2013-01-01

    The hexagonal high-temperature polymorph of LiBH4 is stabilized by solid solution with LiI to exhibit superionic Li+ ionic conductivity at room temperature. Herein, the mechanisms for the Li+ diffusion are investigated for the first time by density functional theory (DFT) calculations coupled...

  1. Understanding LiOH chemistry in a ruthenium-catalyzed Li-O{sub 2} battery

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Tao; Liu, Zigeng; Kim, Gunwoo; Grey, Clare P. [Department of Chemistry, University of Cambridge (United Kingdom); Frith, James T.; Garcia-Araez, Nuria [Department of Chemistry, University of Southampton (United Kingdom)

    2017-12-11

    Non-aqueous Li-O{sub 2} batteries are promising for next-generation energy storage. New battery chemistries based on LiOH, rather than Li{sub 2}O{sub 2}, have been recently reported in systems with added water, one using a soluble additive LiI and the other using solid Ru catalysts. Here, the focus is on the mechanism of Ru-catalyzed LiOH chemistry. Using nuclear magnetic resonance, operando electrochemical pressure measurements, and mass spectrometry, it is shown that on discharging LiOH forms via a 4 e{sup -} oxygen reduction reaction, the H in LiOH coming solely from added H{sub 2}O and the O from both O{sub 2} and H{sub 2}O. On charging, quantitative LiOH oxidation occurs at 3.1 V, with O being trapped in a form of dimethyl sulfone in the electrolyte. Compared to Li{sub 2}O{sub 2}, LiOH formation over Ru incurs few side reactions, a critical advantage for developing a long-lived battery. An optimized metal-catalyst-electrolyte couple needs to be sought that aids LiOH oxidation and is stable towards attack by hydroxyl radicals. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  2. Behavior of pellet injected Li ions into heliotron E plasmas

    International Nuclear Information System (INIS)

    Kondo, K.; Christou, C.; Ida, K.

    1996-07-01

    Li pellet injection has provided a complex plasma with a large fraction of Li ions, which is characterized by intense emissions from Li I and III. The spatial profiles of the fully ionized Li 3+ ions are measured by charge exchange recombination spectroscopy with a resolution of 13 mm, and the local decay time of the injected Li ion has been estimated. The spectral profile of the charge exchange recombination line of Li 2+ from n=5 to n=4 shows a complicated structure, which depends of Li 3+ density. The effects on other intrinsic impurities and recycled Li are also discussed. (author)

  3. Study on Reflected Shock Wave/Boundary Layer Interaction in a Shock Tube

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Dong Wook; Kim, Tae Ho; Kim, Heuy Dong [Andong Nat’l Univ., Andong (Korea, Republic of)

    2017-07-15

    The interaction between a shock wave and a boundary layer causes boundary layer separation, shock train, and in some cases, strong unsteadiness in the flow field. Such a situation is also observed in a shock tube, where the reflected shock wave interacts with the unsteady boundary layer. However, only a few studies have been conducted to investigate the shock train phenomenon in a shock tube. In the present study, numerical studies were conducted using the two-dimensional axisymmetric domain of a shock tube, and compressible Navier-Stokes equations were solved to clarify the flow characteristics of shock train phenomenon inside a shock tube. A detailed wave diagram was developed based on the present computational results, which were validated with existing experimental data.

  4. Insight into magnetorheological shock absorbers

    CERN Document Server

    Gołdasz, Janusz

    2015-01-01

    This book deals with magnetorheological fluid theory, modeling and applications of automotive magnetorheological dampers. On the theoretical side a review of MR fluid compositions and key factors affecting the characteristics of these fluids is followed by a description of existing applications in the area of vibration isolation and flow-mode shock absorbers in particular. As a majority of existing magnetorheological devices operates in a so-called flow mode a critical review is carried out in that regard. Specifically, the authors highlight common configurations of flow-mode magnetorheological shock absorbers, or so-called MR dampers that have been considered by the automotive industry for controlled chassis applications. The authors focus on single-tube dampers utilizing a piston assembly with one coil or multiple coils and at least one annular flow channel in the piston.

  5. Magnetohydrodynamic shocks in molecular clouds

    International Nuclear Information System (INIS)

    Chernoff, D.F.

    1985-01-01

    Part one develops the mathematical and physical theory of one-dimensional, time-independent subalfvenic flow in partially ionized gas with magnetic fields, for application to shocks in molecular clouds. Unlike normal gas-dynamic shocks, the neutral flow may be continuous and cool if the gas radiates efficiently and does not self-ionize. Analytic solutions are given in the limit that the neutral gas is either adiabatic or isothermal (cold). Numerical techniques are developed and applied to find the neutral flow under general circumstances. Part two extends the theory and results of part one in three ways: (1) to faster, superalfvenic flow, (2) to complex gases containing heavy charged particles (grains) in addition to ions, containing heavy charged particles (grains) in addition to ions, electrons and neutrals, and (3) to the entire range in (Omega tau), the ratio of charged particle damping time to gyroperiod, expected in gas flows in molecular clouds

  6. Synthesis, Structure, and Li-Ion Conductivity of LiLa(BH4)3X, X = Cl, Br, I

    DEFF Research Database (Denmark)

    Payandeh GharibDoust, SeyedHosein; Brighi, Matteo; Sadikin, Yolanda

    2017-01-01

    In this work, a new type of addition reaction between La(BH4)3 and LiX, X = Cl, Br, I, is used to synthesize LiLa(BH4)3Cl and two new compounds LiLa(BH4)3X, X = Br, I. This method increases the amounts of LiLa(BH4)3X and the sample purity. The highest Li-ion conductivity is observed for LiLa(BH4)...

  7. MHD shocks in the ISM

    Science.gov (United States)

    Chernoff, D. F.; Hollenbach, David J.; Mckee, Christopher F.

    1990-01-01

    Researchers survey shock solutions of a partially ionized gas with a magnetic field. The gas is modeled by interacting neutral, ion, electron and charged grain components. They employ a small neutral-ion chemical network to follow the dissociation and ionization of the major species. Cooling by molecular hydrogen (rotational, vibrational and dissociation), grains and dipole molecules is included. There are three basic types of solutions (C, C asterisk, and J) and some more complicated flows involving combinations of the basic types. The initial preshock conditions cover hydrogen nuclei densities of 1 less than n less than 10(exp 10) cm(-3) and shock velocities of 5 less than v(sub s) less than 60 km/s. The magnetic field is varied over 5 decades and the sensitivity of the results to grain parameters, UV and cosmic ray fluxes is ascertained. The parameter space is quite complicated, but there exist some simple divisions. When the initial ionization fraction is small (chi sub i less than 10(-5)), there is a sharp transition between fully C solutions at low velocity and strong J solutions at high velocity. When the initial ionization fraction is larger, C asterisk and/or very weak J shocks are present at low velocities in addition to the C solutions. The flow again changes to strong J shocks at high velocities. When the ionization fraction is large and the flow is only slightly greater than the bulk Alfven velocity, there is a complicated mixture of C, C asterisk and J solutions.

  8. Measuring resilience to energy shocks

    OpenAIRE

    Molyneaux, Lynette; Brown, Colin; Foster, John; Wagner, Liam

    2015-01-01

    Measuring energy security or resilience in energy is, in the main, confined to indicators which are used for comparative purposes or to show trends rather than provide empirical evidence of resilience to unpredicted crises. In this paper, the electricity systems of the individual states within the United States of America are analysed for their response to the 1973-1982 and the 2003-2012 oil price shocks. Empirical evidence is sought for elements which are present in systems that experience r...

  9. Coronal mass ejection shock fronts containing the two types of intermediate shocks

    International Nuclear Information System (INIS)

    Steinolfson, R.S.; Hundhausen, A.J.

    1990-01-01

    Numerical solutions of the time-dependent, magnetohydrodynamic (MHD) equations in two dimensions are used to demonstrate the formation of both types of intermediate shocks in a single shock front for physical conditions that are an idealization of those expected to occur in some observed coronal mass ejections. The key to producing such a shock configuration in the simulations is the use of an initial atmosphere containing a magnetic field representative of that in a coronal streamer with open field lines overlying a region of closed field lines. Previous attempts using just open field lines (perpendicular to the surface) produced shock configurations containing just one of the two intermediate shock types. A schematic of such a shock front containing both intermediate shock types has been constructed previously based solely on the known properties of MHD shocks from the Rankine-Hugoniot equations and specific requirements placed on the shock solution at points along the front where the shock normal and upstream magnetic field are aligned. The shock front also contains, at various locations along the front, a hydrodynamic (nonmagnetic) shock, a switch-on shock, and a fast shock in addition to the intermediate shocks. This particular configuration occurs when the shock front speed exceeds the upstream (preshock) intermediate wave speed but is less than a critical speed defined in the paper (equation 1) along at least some portion of the shock front. A distinctive feature of the front is that it is concave upward (away from the surface) near the region where the field in the preshock plasma is normal to the front of near the central portion of the shock front

  10. Sound velocity of tantalum under shock compression in the 18–142 GPa range

    Energy Technology Data Exchange (ETDEWEB)

    Xi, Feng, E-mail: xifeng@caep.cn; Jin, Ke; Cai, Lingcang, E-mail: cai-lingcang@aliyun.com; Geng, Huayun; Tan, Ye; Li, Jun [National Key Laboratory of Shock Waves and Detonation Physics, Institute of Fluid Physics, CAEP, P.O. Box 919-102 Mianyang, Sichuan 621999 (China)

    2015-05-14

    Dynamic compression experiments of tantalum (Ta) within a shock pressure range from 18–142 GPa were conducted driven by explosive, a two-stage light gas gun, and a powder gun, respectively. The time-resolved Ta/LiF (lithium fluoride) interface velocity profiles were recorded with a displacement interferometer system for any reflector. Sound velocities of Ta were obtained from the peak state time duration measurements with the step-sample technique and the direct-reverse impact technique. The uncertainty of measured sound velocities were analyzed carefully, which suggests that the symmetrical impact method with step-samples is more accurate for sound velocity measurement, and the most important parameter in this type experiment is the accurate sample/window particle velocity profile, especially the accurate peak state time duration. From these carefully analyzed sound velocity data, no evidence of a phase transition was found up to the shock melting pressure of Ta.

  11. Experimental investigation of shock wave - bubble interaction

    Energy Technology Data Exchange (ETDEWEB)

    Alizadeh, Mohsen

    2010-04-09

    In this work, the dynamics of laser-generated single cavitation bubbles exposed to lithotripter shock waves has been investigated experimentally. The energy of the impinging shock wave is varied in several steps. High-speed photography and pressure field measurements simultaneously with image acquisition provide the possibility of capturing the fast bubble dynamics under the effect of the shock wave impact. The pressure measurement is performed using a fiber optic probe hydrophone (FOPH) which operates based on optical diagnostics of the shock wave propagating medium. After a short introduction in chapter 1 an overview of the previous studies in chapter 2 is presented. The reported literatures include theoretical and experimental investigations of several configurations of physical problems in the field of bubble dynamics. In chapter 3 a theoretical description of propagation of a shock wave in a liquid like water has been discussed. Different kinds of reflection of a shock wave at an interface are taken into account. Undisturbed bubble dynamics as well as interaction between a planar shock wave and an initially spherical bubble are explored theoretically. Some physical parameters which are important in this issue such as the velocity of the shock-induced liquid jet, Kelvin impulse and kinetic energy are explained. The shock waves are generated in a water filled container by a focusing piezoelectric generator. The shock wave profile has a positive part with pulse duration of ∼1 μs followed by a longer tension tail (i.e. ∼3 μs). In chapter 4 high-speed images depict the propagation of a shock wave in the water filled tank. The maximum pressure is also derived for different intensity levels of the shock wave generator. The measurement is performed in the free field (i.e. in the absence of laser-generated single bubbles). In chapter 5 the interaction between lithotripter shock waves and laserinduced single cavitation bubbles is investigated experimentally. An

  12. External proton and Li beams

    International Nuclear Information System (INIS)

    Schuff, Juan A.; Burlon, Alejandro A.; Debray, Mario E.; Kesque, Jose M.; Kreiner, Andres J.; Stoliar, Pablo A.; Naab, Fabian; Ozafran, Mabel J.; Vazquez, Monica E.; Perez de la Hoz, A.; Somacal, Hector; Valda, Alejandro; Canevas, S.; Ruffolo, M.; Tasat, D.R.; Muhlmann, M. C.

    2000-01-01

    In the frame of a feasibility study to introduce proton therapy in Argentina in a collaborative agreement between the Physics and Radiobiology Departments of the National Atomic Energy Commission or Argentina and the Centre de Protontherapie de Orsay, France, external proton and Li beams were produced at the TANDAR accelerator in Buenos Aires. The specific aim of this work was to start radiobiology studies on cell cultures and small laboratory animals. In particular we seek to determine here the relative biological effectiveness, RBE, for proton and Li beams as a function of energy for different tumor and normal cell lines. The 24 MeV proton beam was diffused using a 25 μm gold foil and extracted through a Kapton window to obtain a homogeneous field (constant to 95%) of about 7 cm in diameter. Measurements were carried out with quasi-monoenergetic beams (of 20.2 ± 0.07 MeV, 2.9 ± 0.10 MeV y 1.5 ± 0.1 MeV for protons and 21.4 ± 0.4 MeV for Lithium). Proton fluence and Bragg peaks were measured. The dose delivered in each case was monitored on-line with a calibrated transmission ionization chamber. Three cell lines PDV, PDVC 57 and V 79 (as a reference) were irradiated with γ-rays, proton and lithium beams with linear energy transfer (LET) from 2 to 100 keV/μm. RBE values in the range of 1.2-5.9 were obtained. In addition preliminary studies on chromosomal aberrations and viability of alveolar macrophages were carried out. (author)

  13. Fabrication and characterization of 6Li-enriched Li2TiO3 pebbles for a high Li-burnup irradiation test

    International Nuclear Information System (INIS)

    Tsuchiya, Kunihiko; Kawamura, Hiroshi

    2006-10-01

    Lithium titanate (Li 2 TiO 3 ) pebbles are considered to be a candidate material of tritium breeders for fusion reactor from viewpoints of easy tritium release at low temperatures (about 300degC) and chemical stability. In the present study, trial fabrication tests of 6 Li-enriched Li 2 TiO 3 pebbles of 1mm in diameter were carried out by a wet process with a dehydration reaction, and characteristics of the 6 Li-enriched Li 2 TiO 3 pebbles were evaluated for preparation of a high Li-burnup test in a testing reactor. Powder of 96at% 6 Li-enriched Li 2 TiO 3 was prepared by a solid state reaction, and two kinds of 6 Li-enriched Li 2 TiO 3 pebbles, namely un-doped and TiO 2 -doped Li 2 TiO 3 pebbles, were fabricated by the wet process. Based on results of the pebble fabrication tests, two kinds of 6 Li-enriched Li 2 TiO 3 pebbles were successfully fabricated with target values (density: 80-85%T.D., grain size: 2 TiO 3 pebbles was a satisfying value of about 1.05. Contact strength of these pebbles was about 6300MPa, which was almost the same as that of the Li 2 TiO 3 pebbles with natural Li. (author)

  14. Particle Acceleration in Two Converging Shocks

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xin; Wang, Na; Shan, Hao [Xinjiang Astronomical Observatory, Chinese Academy of Sciences, Urumqi 830011 (China); Giacalone, Joe [Lunar and Planetary Laboratory, University of Arizona, Tucson AZ 85721 (United States); Yan, Yihua [CAS Key Laboratory of Solar Activity, National Astronomical Observatories, Beijing 100012 (China); Ding, Mingde, E-mail: wangxin@xao.ac.cn [Key Laboratory of Modern Astronomy and Astrophysics (Nanjing University) Ministry of Education, Nanjing 210093 (China)

    2017-06-20

    Observations by spacecraft such as ACE , STEREO , and others show that there are proton spectral “breaks” with energy E {sub br} at 1–10 MeV in some large CME-driven shocks. Generally, a single shock with the diffusive acceleration mechanism would not predict the “broken” energy spectrum. The present paper focuses on two converging shocks to identify this energy spectral feature. In this case, the converging shocks comprise one forward CME-driven shock on 2006 December 13 and another backward Earth bow shock. We simulate the detailed particle acceleration processes in the region of the converging shocks using the Monte Carlo method. As a result, we not only obtain an extended energy spectrum with an energy “tail” up to a few 10 MeV higher than that in previous single shock model, but also we find an energy spectral “break” occurring on ∼5.5 MeV. The predicted energy spectral shape is consistent with observations from multiple spacecraft. The spectral “break,” then, in this case is caused by the interaction between the CME shock and Earth’s bow shock, and otherwise would not be present if Earth were not in the path of the CME.

  15. Simulation of turbulent flows containing strong shocks

    International Nuclear Information System (INIS)

    Fryxell, Bruce; Menon, Suresh

    2008-01-01

    Simulation of turbulent flows with strong shocks is a computationally challenging problem. The requirements for a method to produce accurate results for turbulence are orthogonal to those needed to treat shocks properly. In order to prevent an unphysical rate of decay of turbulent structures, it is necessary to use a method with very low numerical dissipation. Because of this, central difference schemes are widely used. However, computing strong shocks with a central difference scheme can produce unphysical post-shock oscillations that corrupt the entire flow unless additional dissipation is added. This dissipation can be difficult to localize to the area near the shock and can lead to inaccurate treatment of the turbulence. Modern high-resolution shock-capturing methods usually use upwind algorithms to provide the dissipation necessary to stabilize shocks. However, this upwind dissipation can also lead to an unphysical rate of decay of the turbulence. This paper discusses a hybrid method for simulating turbulent flows with strong shocks that couples a high-order central difference scheme with a high-resolution shock-capturing method. The shock-capturing method is used only in the vicinity of discontinuities in the flow, whereas the central difference scheme is used in the remainder of the computational domain. Results of this new method will be shown for a variety of test problems. Preliminary results for a realistic application involving detonation in gas-particle flows will also be presented.

  16. Electron velocity distributions near collisionless shocks

    International Nuclear Information System (INIS)

    Feldman, W.C.

    1984-01-01

    Recent studies of the amount of electron heating and of the shapes of electron velocity distributions across shocks near the earth are reviewed. It is found that electron heating increases with increasing shock strength but is always less than the ion heating. The scale length of electron heating is also less than that for the ions. Electron velocity distributions show characteristic shapes which depend on the strength of the shocks. At the weaker shocks, electron heating is mostly perpendicular to the ambient magnetic field, bar B, and results in Gaussian-shaped velocity distributions at low-to-moderate energies. At the stronger shocks, parallel heating predominates resulting in flat-topped velocity distributions. A reasonable interpretation of these results indicates that at the weaker shocks electron heating is dominated by a tendency toward conservation of the magnetic moment. At the stronger fast-mode shocks, this heating is thought to be dominated by an acceleration parallel to bar B produced by the macroscopic shock electric field followed by beam driven plasma instabilities. Some contribution to the heating at the stronger shocks from conservation of the magnetic moment and cross-field current-driven instabilities cannot be ruled out. Although the heating at slow-mode shocks is also dominated by instabilities driven by magnetic field-aligned electron beams, their acceleration mechanism is not yet established

  17. Spallation reactions in shock waves at supernova explosions and related problems

    Energy Technology Data Exchange (ETDEWEB)

    Ustinova, G. K., E-mail: ustinova@dubna.net.ru [RAS, V.I. Vernadsky Institute of Geochemistry and Analytical Chemistry (Russian Federation)

    2013-05-15

    The isotopic anomalies of some extinct radionuclides testify to the outburst of a nearby supernova just before the collapse of the protosolar nebula, and to the fact that the supernova was Sn Ia, i.e. the carbon-detonation supernova. A key role of spallation reactions in the formation of isotopic anomalies in the primordial matter of the Solar System is revealed. It is conditioned by the diffusive acceleration of particles in the explosive shock waves, which leads to the amplification of rigidity of the energy spectrum of particles and its enrichment with heavier ions. The quantitative calculations of such isotopic anomalies of many elements are presented. It is well-grounded that the anomalous Xe-HL in meteoritic nanodiamonds was formed simultaneously with nanodiamonds themselves during the shock wave propagation at the Sn Ia explosion. The possible effects of shock wave fractionation of noble gases in the atmosphere of planets are considered. The origin of light elements Li, Be and B in spallation reactions, predicted by Fowler in the middle of the last century, is argued. All the investigated isotopic anomalies give the evidence for the extremely high magnetohydrodynamics (MHD) conditions at the initial stage of free expansion of the explosive shock wave from Sn Ia, which can be essential in solution of the problem of origin of cosmic rays. The specific iron-enriched matter of Sn Ia and its MHD-separation in turbulent processes must be taking into account in the models of origin of the Solar System.

  18. Li plating as unwanted side reaction in commercial Li-ion cells - A review

    Science.gov (United States)

    Waldmann, Thomas; Hogg, Björn-Ingo; Wohlfahrt-Mehrens, Margret

    2018-04-01

    Deposition of Lithium metal on anodes contributes significantly to ageing of Li-ion cells. Lithium deposition is connected not only to a drastic limitation of life-time, but also to fast-charging capability and safety issues. Lithium deposition in commercial Li-ion cells is not limited to operation conditions at low temperatures. In recent publications various types of commercial cells were investigated using complimentary analysis methods. Five cell types studied in literature (18650, 26650, pouch) serve as a basis for comparison when and why Li deposition happens in commercial Li-ion cells. In the present paper, we reviewed literature on (i) causes, (ii) hints and evidences for Li deposition, (iii) macroscopic morphology of Li deposition/plating, (iv) ageing mechanisms and shapes of capacity fade curves involving Li deposition, and (v) influences of Li deposition on safety. Although often discussed, safety issues regarding Li deposition are not only limited to dendrite growth and internal short circuits, but also to exothermic reactions in the presence of Lithium metal. Furthermore, we tried to connect knowledge from different length scales including the macroscopic level (Li-ion cells, operating conditions, gradients in cells, electrochemical tests, safety tests), the microscopic level (electrodes, particles, microstructure), and the atomic level (atoms, ions, molecules, energy barriers).

  19. Mechanistic insights of Li+ diffusion within doped LiFePO4 from Muon Spectroscopy.

    Science.gov (United States)

    Johnson, Ian D; Ashton, Thomas E; Blagovidova, Ekaterina; Smales, Glen J; Lübke, Mechthild; Baker, Peter J; Corr, Serena A; Darr, Jawwad A

    2018-03-07

    The Li + ion diffusion characteristics of V- and Nb-doped LiFePO 4 were examined with respect to undoped LiFePO 4 using muon spectroscopy (µSR) as a local probe. As little difference in diffusion coefficient between the pure and doped samples was observed, offering D Li values in the range 1.8-2.3 × 10 -10  cm 2 s -1 , this implied the improvement in electrochemical performance observed within doped LiFePO 4 was not a result of increased local Li + diffusion. This unexpected observation was made possible with the µSR technique, which can measure Li + self-diffusion within LiFePO 4 , and therefore negated the effect of the LiFePO 4 two-phase delithiation mechanism, which has previously prevented accurate Li + diffusion comparison between the doped and undoped materials. Therefore, the authors suggest that µSR is an excellent technique for analysing materials on a local scale to elucidate the effects of dopants on solid-state diffusion behaviour.

  20. Nuclear reaction rates and primordial 6Li

    International Nuclear Information System (INIS)

    Nollett, K.M.; Schramm, D.N.; Lemoine, M.; Schramm, D.N.; Lemoine, M.; Schramm, D.N.

    1997-01-01

    We examine the possibility that big-bang nucleosynthesis (BBN) may produce nontrivial amounts of 6 Li. If a primordial component of this isotope could be observed, it would provide a new fundamental test of big-bang cosmology, as well as new constraints on the baryon density of the universe. At present, however, theoretical predictions of the primordial 6 Li abundance are extremely uncertain due to difficulties in both theoretical estimates and experimental determinations of the 2 H(α,γ) 6 Li radiative capture reaction cross section. We also argue that present observational capabilities do not yet allow the detection of primeval 6 Li in very metal-poor stars of the galactic halo. However, if the critical cross section is very high in its plausible range and the baryon density is relatively low, then improvements in 6 Li detection capabilities may allow the establishment of 6 Li as another product of BBN. It is also noted that a primordial 6 Li detection could help resolve current concerns about the extragalactic D/H determination. copyright 1997 The American Physical Society

  1. Computer simulations of collisionless shock waves

    International Nuclear Information System (INIS)

    Leroy, M.M.

    1984-01-01

    A review of the contributions of particle computer simulations to the understanding of the physics of magnetic shock waves in collisionless plasmas is presented. The emphasis is on the relation between the computer simulation results, spacecraft observations of shocks in space, and related theories, rather than on technical aspects of the numerics. It is shown that much has been learned from the comparison of ISEE spacecraft observations of the terrestrial bow shock and particle computer simulations concerning the quasi-perpendicular, supercritical shock (ion scale structure, ion reflection mechanism and ultimate dissipation processes). Particle computer simulations have also had an appreciable prospective role in the investigation of the physics of quasi-parallel shocks, about which still little is known observationally. Moreover, these numerical techniques have helped to clarify the process of suprathermal ion rejection by the shock into the foreshock, and the subsequent evolution of the ions in the foreshock. 95 references

  2. Molecular dynamics simulation of laser shock phenomena

    Energy Technology Data Exchange (ETDEWEB)

    Fukumoto, Ichirou [Japan Atomic Energy Research Inst., Kansai Research Establishment, Advanced Photon Research Center, Neyagawa, Osaka (Japan).

    2001-10-01

    Recently, ultrashort-pulse lasers with high peak power have been developed, and their application to materials processing is expected as a tool of precision microfabrication. When a high power laser irradiates, a shock wave propagates into the material and dislocations are generated. In this paper, laser shock phenomena of the metal were analyzed using the modified molecular dynamics method, which has been developed by Ohmura and Fukumoto. The main results obtained are summarized as follows: (1) The shock wave induced by the Gaussian beam irradiation propagates radially from the surface to the interior. (2) A lot of dislocations are generated at the solid-liquid interface by the propagation of a shock wave. (3) Some dislocations are moved instantaneously with the velocity of the longitudinal wave when the shock wave passes, and their velocity is not larger than the transverse velocity after the shock wave has passed. (author)

  3. Entropy Generation Across Earth's Bow Shock

    Science.gov (United States)

    Parks, George K.; McCarthy, Michael; Fu, Suiyan; Lee E. s; Cao, Jinbin; Goldstein, Melvyn L.; Canu, Patrick; Dandouras, Iannis S.; Reme, Henri; Fazakerley, Andrew; hide

    2011-01-01

    Earth's bow shock is a transition layer that causes an irreversible change in the state of plasma that is stationary in time. Theories predict entropy increases across the bow shock but entropy has never been directly measured. Cluster and Double Star plasma experiments measure 3D plasma distributions upstream and downstream of the bow shock that allow calculation of Boltzmann's entropy function H and his famous H-theorem, dH/dt O. We present the first direct measurements of entropy density changes across Earth's bow shock. We will show that this entropy generation may be part of the processes that produce the non-thermal plasma distributions is consistent with a kinetic entropy flux model derived from the collisionless Boltzmann equation, giving strong support that solar wind's total entropy across the bow shock remains unchanged. As far as we know, our results are not explained by any existing shock models and should be of interests to theorists.

  4. Remote shock sensing and notification system

    Science.gov (United States)

    Muralidharan, Govindarajan; Britton, Charles L.; Pearce, James; Jagadish, Usha; Sikka, Vinod K.

    2008-11-11

    A low-power shock sensing system includes at least one shock sensor physically coupled to a chemical storage tank to be monitored for impacts, and an RF transmitter which is in a low-power idle state in the absence of a triggering signal. The system includes interference circuitry including or activated by the shock sensor, wherein an output of the interface circuitry is coupled to an input of the RF transmitter. The interface circuitry triggers the RF transmitting with the triggering signal to transmit an alarm message to at least one remote location when the sensor senses a shock greater than a predetermined threshold. In one embodiment the shock sensor is a shock switch which provides an open and a closed state, the open state being a low power idle state.

  5. Role of echocardiography in reducing shock reversal time in pediatric septic shock: a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Ahmed A. EL‐Nawawy

    2018-01-01

    Conclusion: Serial echocardiography provided crucial data for early recognition of septic myocardial dysfunction and hypovolemia that was not apparent on clinical assessment, allowing a timely management and resulting in shock reversal time reduction among children with septic shock.

  6. The earth's foreshock, bow shock, and magnetosheath

    Science.gov (United States)

    Onsager, T. G.; Thomsen, M. F.

    1991-01-01

    Studies directly pertaining to the earth's foreshock, bow shock, and magnetosheath are reviewed, and some comparisons are made with data on other planets. Topics considered in detail include the electron foreshock, the ion foreshock, the quasi-parallel shock, the quasi-perpendicular shock, and the magnetosheath. Information discussed spans a broad range of disciplines, from large-scale macroscopic plasma phenomena to small-scale microphysical interactions.

  7. The earth's foreshock, bow shock, and magnetosheath

    International Nuclear Information System (INIS)

    Onsager, T.G.; Thomsen, M.F.

    1991-01-01

    Studies directly pertaining to the earth's foreshock, bow shock, and magnetosheath are reviewed, and some comparisons are made with data on other planets. Topics considered in detail include the electron foreshock, the ion foreshock, the quasi-parallel shock, the quasi-perpendicular shock, and the magnetosheath. Information discussed spans a broad range of disciplines, from large-scale macroscopic plasma phenomena to small-scale microphysical interactions. 184 refs

  8. Nonequilibrium chemistry in shocked molecular clouds

    International Nuclear Information System (INIS)

    Iglesias, E.R.; Silk, J.

    1978-01-01

    The gas phase chemistry is studied behind a 10 km s -1 shock propagating into a dense molecular cloud. Our principal conclusions are that the concentrations of certain molecules (CO, NH 3 , HCN, N 2 ) are unperturbed by the shock; other molecules (H 2 CO, CN, HCO + ) are greatly decreased in abundance; and substantial amounts of H 2 O, HCO, and CH 4 are produced. Approximately 10 6 yr (independent of the density) must elapse after shock passage before chemical equilibrium is attained

  9. Reaction effects in diffusive shock acceleration

    International Nuclear Information System (INIS)

    Drury, L.Oc.

    1984-01-01

    The effects of the reaction of accelerated particles back on the shock wave in the diffusive-shock-acceleration model of cosmic-ray generation are investigated theoretically. Effects examined include changes in the shock structure, modifications of the input and output spectra, scattering effects, and possible instabilities in the small-scale structure. It is pointed out that the latter two effects are applicable to any spatially localized acceleration mechanism. 14 references

  10. PIV tracer behavior on propagating shock fronts

    International Nuclear Information System (INIS)

    Glazyrin, Fyodor N; Mursenkova, Irina V; Znamenskaya, Irina A

    2016-01-01

    The present work was aimed at the quantitative particle image velocimetry (PIV) measurement of a velocity field near the front of a propagating shock wave and the study of the dynamics of liquid tracers crossing the shock front. For this goal, a shock tube with a rectangular cross-section (48  ×  24 mm) was used. The flat shock wave with Mach numbers M  =  1.4–2.0 propagating inside the tube channel was studied as well as an expanding shock wave propagating outside the channel with M  =  1.2–1.8 at its main axis. The PIV imaging of the shock fronts was carried out with an aerosol of dioctyl sebacate (DEHS) as tracer particles. The pressures of the gas in front of the shock waves studied ranged from 0.013 Mpa to 0.1 MPa in the series of experiments. The processed PIV data, compared to the 1D normal shock theory, yielded consistent values of wake velocity immediately behind the plain shock wave. Special attention was paid to the blurring of the velocity jump on the shock front due to the inertial particle lag and peculiarities of the PIV technique. A numerical algorithm was developed for analysis and correction of the PIV data on the shock fronts, based on equations of particle-flow interaction. By application of this algorithm, the effective particle diameter of the DEHS aerosol tracers was estimated as 1.03  ±  0.12 μm. A number of different formulations for particle drag were tested with this algorithm, with varying success. The results show consistency with previously reported experimental data obtained for cases of stationary shock waves. (paper)

  11. X-ray diffraction studies of structures of Be, Al, LiF, Fe+3%Si, Si, SiO2, KCl under dynamic pressures from 2 Gpa to 20 Gpa

    International Nuclear Information System (INIS)

    Egorov, L.A.; Barenboim, A.I.; Mokhova, V.V.; Dorohin, V.V.; Samoilov, A.I.

    1997-01-01

    Currently, the only direct method to study behaviour of solid crystal substance structures under dynamic compression is method to record X-rays diffraction pictures of crystal structures under shock compression. Thepaper presents results of X-rays diffraction measurements concerning structural parameters of shock compressed substances at pressures higher than Hugoniot elastic limit (Be, Al, LiF, Fe+3%Si), lower than Hugoniot elastic limit (Si, SiO 2 , LiF) and in the area of pressures of phase transformation beginning (KCl, Si). Recorded states of shock-compressed substance structures demonstrate identity of structural deformations at pressures higher and lower than Hugoniot elastic limit as well as at pressures above the phase transformation point, which can be characterized as single-axial deformations. (orig.)

  12. Distillation of LiCl from the LiCl-Li2O molten salt of the electrolytic reduction process

    International Nuclear Information System (INIS)

    Kim, I.S.; Oh, S.C.; Im, H.S.; Hur, J.M.; Lee, H.S.

    2013-01-01

    Electrolytic reduction of the uranium oxide in LiCl-Li 2 O molten salt for the treatment of spent nuclear fuel requires the separation of the residual salt from the reduced metal product, which contains about 20 wt% salt. In order to separate the residual salt and reuse it in the electrolytic reduction, a vacuum distillation process was developed. Lab-scale distillation equipment was designed and installed in an argon atmosphere glove box. The equipment consisted of an evaporator in which the reduced metal product was contained and exposed to a high temperature and reduced pressure; a receiver; and a vertically oriented condenser that operated at a temperature below the melting point of lithium chloride. We performed experiments with LiCl-Li 2 O salt to evaluate the evaporation rate of LiCl salt and varied the operating temperature to discern its effect on the behavior of salt evaporation. Complete removal of the LiCl salt from the evaporator was accomplished by reducing the internal pressure to <100 mTorr and heating to 900 deg C. We achieved evaporation efficiency as high as 100 %. (author)

  13. Charge carrier density in Li-intercalated graphene

    KAUST Repository

    Kaloni, Thaneshwor P.; Cheng, Yingchun; Kahaly, M. Upadhyay; Schwingenschlö gl, Udo

    2012-01-01

    The electronic structures of bulk C 6Li, Li-intercalated free-standing bilayer graphene, and Li-intercalated bilayer and trilayer graphene on SiC(0 0 0 1) are studied using density functional theory. Our estimate of Young's modulus suggests that Li

  14. Condensed matter at high shock pressures

    International Nuclear Information System (INIS)

    Nellis, W.J.; Holmes, N.C.; Mitchell, A.C.; Radousky, H.B.; Hamilton, D.

    1985-01-01

    Experimental techniques are described for shock waves in liquids: Hugoniot equation-of-state, shock temperature and emission spectroscopy, electrical conductivity, and Raman spectroscopy. Experimental data are reviewed and presented in terms of phenomena that occur at high densities and temperatures in shocked He, Ar, N 2 , CO, SiO 2 -aerogel, H 2 O, and C 6 H 6 . The superconducting properties of Nb metal shocked to 100 GPa (1 Mbar) and recovered intact are discussed in terms of prospects for synthesizing novel, metastable materials. Ultrahigh pressure data for Cu is reviewed in the range 0.3 to 6TPa (3 to 60 Mbar). 56 refs., 9 figs., 1 tab

  15. Radio emission from coronal and interplanetary shocks

    International Nuclear Information System (INIS)

    Cane, H.V.

    1987-01-01

    Observational data on coronal and interplanetary (IP) type II burst events associated with shock-wave propagation are reviewed, with a focus on the past and potential future contributions of space-based observatories. The evidence presented by Cane (1983 and 1984) in support of the hypothesis that the coronal (metric) and IP (kilometric) bursts are due to different shocks is summarized, and the fast-drift kilometric events seen at the same time as metric type II bursts (and designated shock-accelerated or shock-associated events) are characterized. The need for further observations at 0.5-20 MHz is indicated. 20 references

  16. Advanced and Exploratory Shock Sensing Mechanisms.

    Energy Technology Data Exchange (ETDEWEB)

    Nelsen, Nicholas H. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kolb, James D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kulkarni, Akshay G. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sorscher, Zachary [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Habing, Clayton D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mathis, Allen [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Beller, Zachary J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-09-01

    Mechanical component response to shock environments must be predictable in order to ensure reliability and safety. Whether the shock input results from accidental drops during transportation to projectile impact scenarios, the system must irreversibly transition into a safe state that is incapable of triggering the component . With this critical need in mind, the 2017 Nuclear Weapons Summer Product Realization Institute (NW SPRINT) program objective sought the design of a passive shock failsafe with emphasis on additively manufactured (AM) components. Team Advanced and Exploratory (A&E) responded to the challenge by designing and delivering multiple passive shock sensing mech anisms that activate within a prescribed mechanical shock threshold. These AM failsafe designs were tuned and validated using analytical and computational techniques including the shock response spectrum (SRS) and finite element analysis (FEA). After rapid prototyping, the devices experienced physical shock tests conducted on Sandia drop tables to experimentally verify performance. Keywords: Additive manufacturing, dynamic system, failsafe, finite element analysis, mechanical shock, NW SPRINT, shock respon se spectrum

  17. Irreversible thermodynamics of overdriven shocks in solids

    International Nuclear Information System (INIS)

    Wallace, D.C.

    1981-01-01

    An isotropic solid capable of transporting heat and of undergoing dissipative plastic flow, is treated. The shock is assumed to be a steady wave, and any phase changes or macroscopic inhomogeneities which might be induced by the shock are neglected. Under these conditions it is established that for an overdriven shock, no solution is possible without heat transport, and when the heat transport is governed by the steady conduction equation, no solution is possible without plastic dissipation as well. Upper and lower bounds are established for the thermodynamic variables, namely the shear stress, temperature, entropy, plastic strain, and heat flux, as functions of compression through the shock

  18. The source of real and nominal exchange rate fluctuations in Thailand: Real shock or nominal shock

    OpenAIRE

    Le Thanh, Binh

    2015-01-01

    This paper examines the source of exchange rate fluctuations in Thailand. We employed a structural vector auto-regression (SVAR) model with the long-run neutrality restriction of Blanchard and Quah (1989) to investigate the changes in real and nominal exchange rates from 1994 to 2015. In this paper, we assume that there are two types of shocks which related to exchange rate movements: real shocks and nominal shocks. The empirical analysis indicates that real shocks are the fundamental compon...

  19. Model for shock wave chaos.

    Science.gov (United States)

    Kasimov, Aslan R; Faria, Luiz M; Rosales, Rodolfo R

    2013-03-08

    We propose the following model equation, u(t) + 1/2(u(2)-uu(s))x = f(x,u(s)) that predicts chaotic shock waves, similar to those in detonations in chemically reacting mixtures. The equation is given on the half line, xorder partial differential equation. The chaos arises in the equation thanks to an interplay between the nonlinearity of the inviscid Burgers equation and a novel forcing term that is nonlocal in nature and has deep physical roots in reactive Euler equations.

  20. Adaptive inertial shock-absorber

    International Nuclear Information System (INIS)

    Faraj, Rami; Holnicki-Szulc, Jan; Knap, Lech; Seńko, Jarosław

    2016-01-01

    This paper introduces and discusses a new concept of impact absorption by means of impact energy management and storage in dedicated rotating inertial discs. The effectiveness of the concept is demonstrated in a selected case-study involving spinning management, a recently developed novel impact-absorber. A specific control technique performed on this device is demonstrated to be the main source of significant improvement in the overall efficiency of impact damping process. The influence of various parameters on the performance of the shock-absorber is investigated. Design and manufacturing challenges and directions of further research are formulated. (paper)

  1. Iowa LiDAR Mapping Project

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — This is collection level metadata for LAS and ASCII data files from the statewide Iowa Lidar Project. The Iowa Light Detection and Ranging (LiDAR) Project collects...

  2. USGS Atchafalaya 2 LiDAR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Light Detection and Ranging (LiDAR) dataset is a survey of the Atchafalaya Basin project area. The entire survey area for Atchafalaya encompasses approximately...

  3. EKA tootedisaini üliõpilane...

    Index Scriptorium Estoniae

    2005-01-01

    Eesti Kunstiakadeemia tootedisaini osakonna IV kursuse üliõpilane Riho Tiivel võitis Itaalias toimunud disainikonkursi "ReAL 13 - Eating Anywhere" peapreemia oma alumiiniumist lusikaga "Spoon Container"

  4. Li-ion Battery Aging Datasets

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set has been collected from a custom built battery prognostics testbed at the NASA Ames Prognostics Center of Excellence (PCoE). Li-ion batteries were run...

  5. Li'l Red Schoolhouse workshops

    Science.gov (United States)

    1993-01-01

    Education specialists at Stennis conduct staff development workshops for elementary and secondary teachers of math, science and technology and other subjects as well as specialized workshops conducted in the NASA Li'l Red Schoolhouse.

  6. Neutron flux measurement with 6Li and 7Li dual glass scintillators by γ compensation method

    International Nuclear Information System (INIS)

    Ji Changsong; Zhang Shulan; Zhang Shuheng

    1996-01-01

    Based on the characteristics of 6 Li glass scintillator which is sensitive to both neutron and gamma rays, and 7 Li glass scintillator which is sensitive to gamma rays only, a new method of detecting weak neutron flux under interference of strong gamma radiation has been investigated by means of 6 Li- 7 Li pair glass scintillator gamma compensation method. The result of neutron flux measurement by above-mentioned method with an error of about 1% when the gamma ray interference is up to 18.7% has been obtained

  7. Neutron flux measurement with 6Li and 7Li dual glass scintillators by γ compensation method

    International Nuclear Information System (INIS)

    Ji Changsong; Zhang Shulan; Zhang Shuheng

    1998-01-01

    Based on the characteristics of 6 Li glass scintillator which is sensitive to both neutron and gamma rays, and 7 Li glass scintillator which is sensitive to gamma rays only, a new method of detecting weak neutron flux under interference of strong gamma radiation has been investigated by mans of 6 Li- 7 Li dual glass scintillator gamma compensation method. The result of neutron flux measurement by above-mentioned method with an error of about 1% when the gamma ray interference is up to 18.7% has been obtained

  8. Uniform second Li ion intercalation in solid state ϵ-LiVOPO{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Wangoh, Linda W.; Quackenbush, Nicholas F. [Department of Physics, Applied Physics and Astronomy, Binghamton University, Binghamton, New York 13902 (United States); Sallis, Shawn [Materials Science and Engineering, Binghamton University, Binghamton, New York 13902 (United States); Wiaderek, Kamila M.; Ma, Lu; Wu, Tianpin; Chapman, Karena W. [X-ray Science Division, Advanced Photon Source, Argonne National Laboratory, Argonne, Illinois 60439 (United States); Lin, Yuh-Chieh; Ong, Shyue Ping [Department of NanoEngineering, University of California San Diego, 9500 Gilman Drive 0448, La Jolla, California 92093 (United States); Wen, Bohua; Chernova, Natasha A.; Whittingham, M. Stanley [NECCES, Binghamton University, Binghamton, New York 13902 (United States); Guo, Jinghua [Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Lee, Tien-Lin; Schlueter, Christoph [Diamond Light Source Ltd., Harwell Science and Innovation Campus, Didcot, Oxfordshire OX11 0DE (United Kingdom); Piper, Louis F. J., E-mail: lpiper@binghamton.edu [Department of Physics, Applied Physics and Astronomy, Binghamton University, Binghamton, New York 13902 (United States); Materials Science and Engineering, Binghamton University, Binghamton, New York 13902 (United States)

    2016-08-01

    Full, reversible intercalation of two Li{sup +} has not yet been achieved in promising VOPO{sub 4} electrodes. A pronounced Li{sup +} gradient has been reported in the low voltage window (i.e., second lithium reaction) that is thought to originate from disrupted kinetics in the high voltage regime (i.e., first lithium reaction). Here, we employ a combination of hard and soft x–ray photoelectron and absorption spectroscopy techniques to depth profile solid state synthesized LiVOPO{sub 4} cycled within the low voltage window only. Analysis of the vanadium environment revealed no evidence of a Li{sup +} gradient, which combined with almost full theoretical capacity confirms that disrupted kinetics in the high voltage window are responsible for hindering full two lithium insertion. Furthermore, we argue that the uniform Li{sup +} intercalation is a prerequisite for the formation of intermediate phases Li{sub 1.50}VOPO{sub 4} and Li{sub 1.75}VOPO{sub 4}. The evolution from LiVOPO{sub 4} to Li{sub 2}VOPO{sub 4} via the intermediate phases is confirmed by direct comparison between O K–edge absorption spectroscopy and density functional theory.

  9. Characteristics of new LiF preparations and sensitised LiF

    Energy Technology Data Exchange (ETDEWEB)

    Driscoll, C M.H.; O' Hagan, J B; Mundy, S J; Todd, C D; McWhan, A F; Dodson, J

    1986-01-01

    The patent governing the preparation and production of lithium fluoride (LiF) awarded to the Harshaw Chemical Co. has expired. Other companies have become interested in developing additional preparations of this material. Two of these preparations include LiF:Mg,Ti manufactured by Vinten Instruments plc and high sensitivity LiF:Mg, Cu,P distributed by them. The properties of these materials, including sensitivity, dose threshold, photon energy response, reusability and storage characteristics, are presented in this paper and compared with those of Harshaw TLD-100 and with those of sensitised LiF.

  10. Molecular evolution of the Li/li chemical defence polymorphism in white clover (Trifolium repens L.).

    Science.gov (United States)

    Olsen, K M; Sutherland, B L; Small, L L

    2007-10-01

    White clover (Trifolium repens) is naturally polymorphic for cyanogenesis (hydrogen cyanide release following tissue damage). The ecological factors favouring cyanogenic and acyanogenic plants have been examined in numerous studies over the last half century, making this one of the best-documented examples of an adaptive polymorphism in plants. White clover cyanogenesis is controlled by two, independently segregating Mendelian genes: Ac/ac controls the presence/absence of cyanogenic glucosides; and Li/li controls the presence/absence of their hydrolysing enzyme, linamarase. In this study, we examine the molecular evolution and population genetics of Li as it relates to the cyanogenesis polymorphism. We report here that Li exists as a single-copy gene in plants possessing linamarase activity, and that the absence of enzyme activity in li/li plants is correlated with the absence of much or all of the gene from the white clover genome. Consistent with this finding, we confirm by reverse transcription-polymerase chain reaction that Li gene expression is absent in plants lacking enzyme activity. In a molecular population genetic analysis of Li and three unlinked genes using a worldwide sample of clover plants, we find an absence of nucleotide variation and statistically significant deviations from neutrality at Li; these findings are consistent with recent positive directional selection at this cyanogenesis locus.

  11. Uniform second Li ion intercalation in solid state ϵ-LiVOPO4

    International Nuclear Information System (INIS)

    Wangoh, Linda W.; Quackenbush, Nicholas F.; Sallis, Shawn; Wiaderek, Kamila M.; Ma, Lu; Wu, Tianpin; Chapman, Karena W.; Lin, Yuh-Chieh; Ong, Shyue Ping; Wen, Bohua; Chernova, Natasha A.; Whittingham, M. Stanley; Guo, Jinghua; Lee, Tien-Lin; Schlueter, Christoph; Piper, Louis F. J.

    2016-01-01

    Full, reversible intercalation of two Li + has not yet been achieved in promising VOPO 4 electrodes. A pronounced Li + gradient has been reported in the low voltage window (i.e., second lithium reaction) that is thought to originate from disrupted kinetics in the high voltage regime (i.e., first lithium reaction). Here, we employ a combination of hard and soft x–ray photoelectron and absorption spectroscopy techniques to depth profile solid state synthesized LiVOPO 4 cycled within the low voltage window only. Analysis of the vanadium environment revealed no evidence of a Li + gradient, which combined with almost full theoretical capacity confirms that disrupted kinetics in the high voltage window are responsible for hindering full two lithium insertion. Furthermore, we argue that the uniform Li + intercalation is a prerequisite for the formation of intermediate phases Li 1.50 VOPO 4 and Li 1.75 VOPO 4 . The evolution from LiVOPO 4 to Li 2 VOPO 4 via the intermediate phases is confirmed by direct comparison between O K–edge absorption spectroscopy and density functional theory.

  12. Ab initio identification of the Li-rich phase in LiFePO4.

    Science.gov (United States)

    Zeng, Hua; Gu, Yue; Teng, Gaofeng; Liu, Yimeng; Zheng, Jiaxin; Pan, Feng

    2018-06-27

    A recent discovery of anionic redox activity in Li-rich layered compounds opens a new direction for the design of high-capacity cathode materials for lithium-ion batteries. Here using extensive ab initio calculations, the thermodynamic existence of the Li-rich phase in LiFePO4 to form Li1+xFe1-xPO4 with x not exceeding 12.5% has been proved. Anionic redox activity and structural stability during delithiation are further investigated. Interestingly, it is found that Li1+xFe1-xPO4 cannot be delithiated completely and thus cannot achieve extra capacity by anionic redox activity, because the local oxygen-ion redox will cause the fracture of the rigid framework formed by phosphate tetrahedral polyanions. Although an extra capacity cannot be realized, the excess Li-ions at Fe sites can enhance the Li-ion diffusivity along the adjacent [010] channel and contribute to the shift from 1D to 2D/3D diffusion. This study provides a fresh perspective on olivine-type LiFePO4 and offers some important clues on designing Li-rich cathode materials with high energy density.

  13. [100]-Oriented LiFePO4 Nanoflakes toward High Rate Li-Ion Battery Cathode.

    Science.gov (United States)

    Li, Zhaojin; Peng, Zhenzhen; Zhang, Hui; Hu, Tao; Hu, Minmin; Zhu, Kongjun; Wang, Xiaohui

    2016-01-13

    [100] is believed to be a tough diffusion direction for Li(+) in LiFePO4, leading to the belief that the rate performance of [100]-oriented LiFePO4 is poor. Here we report the fabrication of 12 nm-thick [100]-oriented LiFePO4 nanoflakes by a simple one-pot solvothermal method. The nanoflakes exhibit unexpectedly excellent electrochemical performance, in stark contrast to what was previously believed. Such an exceptional result is attributed to a decreased thermodynamic transformation barrier height (Δμb) associated with increased active population.

  14. EPR experiments in LiTbF4, LiHoF4, and LiErF4 at submillimeter frequencies

    DEFF Research Database (Denmark)

    Magariño, J.; Tuchendler, J.; Beauvillain, P.

    1980-01-01

    Electron-paramagnetic-resonance experiments in LiTbF4, LiHoF4, and LiErF4 have been performed at frequencies between 70 and 600 GHz, in magnetic fields up to 60 kG and in the temperature range 1.4......Electron-paramagnetic-resonance experiments in LiTbF4, LiHoF4, and LiErF4 have been performed at frequencies between 70 and 600 GHz, in magnetic fields up to 60 kG and in the temperature range 1.4...

  15. Simplified PCR protocols for INNO-LiPA HBV Genotyping and INNO-LiPA HBV PreCore assays

    NARCIS (Netherlands)

    Qutub, Mohammed O.; Germer, Jeffrey J.; Rebers, Sjoerd P. H.; Mandrekar, Jayawant N.; Beld, Marcel G. H. M.; Yao, Joseph D. C.

    2006-01-01

    INNO-LiPA HBV Genotyping (LiPA HBV GT) and INNO-LiPA HBV PreCore (LiPA HBV PC) are commercially available assays for hepatitis B virus (HBV) characterization. These assays are labor-intensive and may be prone to exogenous DNA contamination due to their use of nested PCR amplification procedures and

  16. Influence of defects on the thermal conductivity of compressed LiF

    Science.gov (United States)

    Jones, R. E.; Ward, D. K.

    2018-02-01

    Defect formation in LiF, which is used as an observation window in ramp and shock experiments, has significant effects on its transmission properties. Given the extreme conditions of the experiments it is hard to measure the change in transmission directly. Using molecular dynamics, we estimate the change in conductivity as a function of the concentration of likely point and extended defects using a Green-Kubo technique with careful treatment of size effects. With this data, we form a model of the mean behavior and its estimated error; then, we use this model to predict the conductivity of a large sample of defective LiF resulting from a direct simulation of ramp compression as a demonstration of the accuracy of its predictions. Given estimates of defect densities in a LiF window used in an experiment, the model can be used to correct the observations of thermal energy through the window. In addition, the methodology we develop is extensible to modeling, with quantified uncertainty, the effects of a variety of defects on the thermal conductivity of solid materials.

  17. Water vapor concentration dependence and temperature dependence of Li mass loss from Li{sub 2}TiO{sub 3} with excess Li and Li{sub 4}SiO{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Shimozori, Motoki [Interdisciplinary Graduate School of Engineering Science, Kyushu University, 6-1, Kasugakoen, Kasuga, Fukuoka 816-8580 (Japan); Katayama, Kazunari, E-mail: kadzu@nucl.kyushu-u.ac.jp [Interdisciplinary Graduate School of Engineering Science, Kyushu University, 6-1, Kasugakoen, Kasuga, Fukuoka 816-8580 (Japan); Hoshino, Tsuyoshi [Breeding Functional Materials Development Group, Department of Blanket Systems Research, Rokkasho Fusion Institute, Sector of Fusion Research and Development, Japan Atomic Energy Agency, 2-166 Obuch, Omotedate, Rokkasho-mura, Kamikita-gun, Aomori 039-3212 (Japan); Ushida, Hiroki; Yamamoto, Ryotaro; Fukada, Satoshi [Interdisciplinary Graduate School of Engineering Science, Kyushu University, 6-1, Kasugakoen, Kasuga, Fukuoka 816-8580 (Japan)

    2015-10-15

    Highlights: • Li mass loss from Li{sub 2.11}TiO{sub 3} increased proportionally to water vapor pressure. • Li mass loss from Li{sub 2.11}TiO{sub 3} at 600 °C was significantly smaller than expected. • Differences of Li mass loss behavior from Li{sub 2.11}TiO{sub 3} and Li{sub 4}SiO{sub 4} were shown. - Abstract: In this study, weight reduction of Li{sub 2}TiO{sub 3} with excess Li and Li{sub 4}SiO{sub 4} at elevated temperatures under hydrogen atmosphere or water vapor atmosphere was investigated. The Li mass loss for the Li{sub 2}TiO{sub 3} at 900 °C was 0.4 wt% under 1000 Pa H{sub 2} atmosphere and 1.5 wt% under 50 Pa H{sub 2}O atmosphere. The Li mass loss for the Li{sub 2}TiO{sub 3} increased proportionally to the water vapor pressure in the range from 50 to 200 Pa at 900 °C and increased with increasing temperature from 700 to 900 °C although Li mass loss at 600 °C was significantly smaller than expected. It was found that water vapor concentration dependence and temperature dependence of Li mass loss for the Li{sub 2}TiO{sub 3} and the Li{sub 4}SiO{sub 4} used in this work were quite different. Water vapor is released from the ceramic breeder materials into the purge gas due to desorption of adsorbed water and water formation reaction. The released water vapor possibly promotes Li mass loss with the formation of LiOH on the surface.

  18. Converging shocks in elastic-plastic solids.

    Science.gov (United States)

    Ortega, A López; Lombardini, M; Hill, D J

    2011-11-01

    We present an approximate description of the behavior of an elastic-plastic material processed by a cylindrically or spherically symmetric converging shock, following Whitham's shock dynamics theory. Originally applied with success to various gas dynamics problems, this theory is presently derived for solid media, in both elastic and plastic regimes. The exact solutions of the shock dynamics equations obtained reproduce well the results obtained by high-resolution numerical simulations. The examined constitutive laws share a compressible neo-Hookean structure for the internal energy e=e(s)(I(1))+e(h)(ρ,ς), where e(s) accounts for shear through the first invariant of the Cauchy-Green tensor, and e(h) represents the hydrostatic contribution as a function of the density ρ and entropy ς. In the strong-shock limit, reached as the shock approaches the axis or origin r=0, we show that compression effects are dominant over shear deformations. For an isothermal constitutive law, i.e., e(h)=e(h)(ρ), with a power-law dependence e(h) is proportional to ρ(α), shock dynamics predicts that for a converging shock located at r=R(t) at time t, the Mach number increases as M is proportional to [log(1/R)](α), independently of the space index s, where s=2 in cylindrical geometry and 3 in spherical geometry. An alternative isothermal constitutive law with p(ρ) of the arctanh type, which enforces a finite density in the strong-shock limit, leads to M is proportional to R(-(s-1)) for strong shocks. A nonisothermal constitutive law, whose hydrostatic part e(h) is that of an ideal gas, is also tested, recovering the strong-shock limit M is proportional to R(-(s-1)/n(γ)) originally derived by Whitham for perfect gases, where γ is inherently related to the maximum compression ratio that the material can reach, (γ+1)/(γ-1). From these strong-shock limits, we also estimate analytically the density, radial velocity, pressure, and sound speed immediately behind the shock. While the

  19. Double shock experiments and reactive flow modeling on LX-17 to understand the reacted equation of state

    International Nuclear Information System (INIS)

    Vandersall, Kevin S; Garcia, Frank; Fried, Laurence E; Tarver, Craig M

    2014-01-01

    Experimental data from measurements of the reacted state of an energetic material are desired to incorporate reacted states in modeling by computer codes. In a case such as LX-17 (92.5% TATB and 7.5% Kel-F by weight), where the time dependent kinetics of reaction is still not fully understood and the reacted state may evolve over time, this information becomes even more vital. Experiments were performed to measure the reacted state of LX-17 using a double shock method involving the use of two flyer materials (with known properties) mounted on the projectile that send an initial shock through the material close to or above the Chapman-Jouguet (CJ) state followed by a second shock at a higher magnitude into the detonated material. By measuring the parameters of the first and second shock waves, information on the reacted state can be obtained. The LX-17 detonation reaction zone profiles plus the arrival times and amplitudes of reflected shocks in LX-17 detonation reaction products were measured using Photonic Doppler Velocimetry (PDV) probes and an aluminum foil coated LiF window. A discussion of this work will include the experimental parameters, velocimetry profiles, data interpretation, reactive CHEETAH and Ignition and Growth modeling, as well as detail on possible future experiments.

  20. Shock compression profiles in ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Grady, D.E.; Moody, R.L.

    1996-03-01

    An investigation of the shock compression properties of high-strength ceramics has been performed using controlled planar impact techniques. In a typical experimental configuration, a ceramic target disc is held stationary, and it is struck by plates of either a similar ceramic or by plates of a well-characterized metal. All tests were performed using either a single-stage propellant gun or a two-stage light-gas gun. Particle velocity histories were measured with laser velocity interferometry (VISAR) at the interface between the back of the target ceramic and a calibrated VISAR window material. Peak impact stresses achieved in these experiments range from about 3 to 70 GPa. Ceramics tested under shock impact loading include: Al{sub 2}O{sub 3}, AlN, B{sub 4}C, SiC, Si{sub 3}N{sub 4}, TiB{sub 2}, WC and ZrO{sub 2}. This report compiles the VISAR wave profiles and experimental impact parameters within a database-useful for response model development, computational model validation studies, and independent assessment of the physics of dynamic deformation on high-strength, brittle solids.

  1. Shock-resistant scintillation detector

    International Nuclear Information System (INIS)

    Novak, W.P.

    1979-01-01

    A unique scintillation detector unit is disclosed which employs a special light transfer and reflector means that encases and protects the scintillator crystal against high g forces. The light transfer means comprises a flexible silicon rubber optical material bonded between the crystal and the optical window and having an axial thickness sufficient to allow the scintillator to move axially inside the container under high g forces without destroying the bonds. The reflector means comprises a soft elastic silicone rubber sleeve having a multiplicity of closely arranged tapered protrusions radiating toward and engaging the periphery of the scintillator crystal to cushion shocks effectively and having a reflective material, such as aluminum oxide powder, in the spaces between the protrusions. The reflector means provides improved shock absorption because of the uniform support and cushioning action of the protrusions and also provides the detector with high efficiency. The silicon rubber composition is specially compounded to include a large amount of aluminum oxide which enables the rubber to function effectively as a light reflector

  2. Ionic debye screening in dense liquid plasmas observed for Li+p, d reactions with liquid Li target

    International Nuclear Information System (INIS)

    Kasagi, J.; Yonemura, H.; Toriyabe, Y.; Nakagawa, A.; Sugawara, T.; Wang Tieshan

    2009-01-01

    Thick target yields of α particles emitted in the 6 Li(d,α) 4 He and 7 Li(p,α) 4 He reactions were measured for Li target in the solid and liquid phase. Observed reaction rates for the liquid Li are always larger than those for the solid. This suggests that the stopping power of hydrogen ion in the liquid Li metal might be smaller than in the solid. Using the empirically obtained stopping power for the liquid Li, we have deduced the screening potentials of the Li+p and Li+d reactions in both phases. The deduced screening potential for the liquid Li is about 500 eV larger than for the solid. This difference is attributed to the effect of liquefied Li + ions. It is concluded that the ionic screening is much stronger than the electronic screening in a low-temperature dense plasmas. (authors)

  3. Ionic Debye Screening in Dense Liquid Plasmas Observed for Li+p,d Reactions with Liquid Li Target

    Institute of Scientific and Technical Information of China (English)

    J.Kasagi; H.Yonemura; Y.Toriyabe; A.Nakagawa; T.Sugawara; WANG Tie-shan

    2009-01-01

    Thick target yields of a particles emitted in the ~6Li(d,a)~4 He and ~7Li(p,a)~4 He reactions were measured for Li target in the solid and liquid phase.Observed reaction rates for the liquid Li are always larger than those for the solid.This suggests that the stopping power of hydrogen ion in the liquid Li metal might be smaller than in the solid.Using the empirically obtained stopping power for the liquid Li,we have deduced the screening potentials of the Li+p and Li+d reactions in both phases.The deduced screening potential for the liquid Li is about 500 eV larger than for the solid.This difference is attributed to the effect of liquefied Li~+ ions.It is concluded that the ionic screening is much stronger than the electronic screening in a low-temperature dense plasmas.

  4. Li diffusion and the effect of local structure on Li mobility in Li2O-SiO2 glasses.

    Science.gov (United States)

    Bauer, Ute; Welsch, Anna-Maria; Behrens, Harald; Rahn, Johanna; Schmidt, Harald; Horn, Ingo

    2013-12-05

    Aimed to improve the understanding of lithium migration mechanisms in ion conductors, this study focuses on Li dynamics in binary Li silicate glasses. Isotope exchange experiments and conductivity measurements were carried out to determine self-diffusion coefficients and activation energies for Li migration in Li2Si3O7 and Li2Si6O13 glasses. Samples of identical composition but different isotope content were combined for diffusion experiments in couples or triples. Diffusion profiles developed between 511 and 664 K were analyzed by femtosecond laser ablation combined with multiple collector inductively coupled plasma mass spectrometry (fs LA-MC-ICP-MS) and secondary ion mass spectrometry (SIMS). Analyses of diffusion profiles and comparison of diffusion data reveal that the isotope effect of lithium diffusion in silicate glasses is rather small, consistent with classical diffusion behavior. Ionic conductivity of glasses was measured between 312 and 675 K. The experimentally obtained self-diffusion coefficient, D(IE), and ionic diffusion coefficient, D(σ), derived from specific DC conductivity provided information about correlation effects during Li diffusion. The D(IE)/D(σ) is higher for the trisilicate (0.27 ± 0.05) than that for the hexasilicate (0.17 ± 0.02), implying that increasing silica content reduces the efficiency of Li jumps in terms of long-range movement. This trend can be rationalized by structural concepts based on nuclear magnetic resonance (NMR) and Raman spectroscopy as well as molecular dynamic simulations, that is, lithium is percolating in low-dimensional, alkali-rich regions separated by a silica-rich matrix.

  5. The ''injection problem'' for quasiparallel shocks

    International Nuclear Information System (INIS)

    Zank, G. P.; Rice, W. K. M.; le Roux, J. A.; Cairns, I. H.; Webb, G. M.

    2001-01-01

    For a particle to be accelerated diffusively at a shock by the first-order Fermi acceleration mechanism, the particle must be sufficiently energetic that it can scatter across all the micro- and macrostructure of the shock, experiencing compression between the converging upstream and downstream states. This is the well-known ''injection problem.'' Here the interaction of ions with the ramp of a quasiparallel shock is investigated. Some ions incident on the shock experience specular reflection, caused either by the cross-shock electrostatic potential or by mirroring as the magnetic field is bent and compressed through the ramp. Scattering of reflected ions by self-generated and pre-existing turbulence in the region upstream of the shock then acts to trap backstreaming ions and return them to the ramp, where some experience further reflections. Such repeated reflections and scattering energize a subpopulation of ions up to energies sufficiently large that they can be diffusively shock accelerated. Two ion distributions are considered: pickup ions which are assumed to be described by a shell distribution, are thermal solar wind ions which may be described by a kappa distribution. Injection efficiencies are found analytically to be very high for pickup ions and much lower for thermal solar wind ions, suggesting that this injection mechanism, stochastic reflected ion or SRI acceleration, is a natural precursor for the acceleration of the anomalous cosmic ray component at a quasiparallel shock. While significantly less efficient, SRI acceleration is also viable for thermal solar wind ions described by a kappa distribution

  6. PRECURSORS TO INTERSTELLAR SHOCKS OF SOLAR ORIGIN

    Energy Technology Data Exchange (ETDEWEB)

    Gurnett, D. A.; Kurth, W. S. [University of Iowa, Department of Physics and Astronomy, Iowa City, IA 52242 (United States); Stone, E. C.; Cummings, A. C. [California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Krimigis, S. M.; Decker, R. B. [Applied Physics Laboratory/JHU, 11100 Johns Hopkins Road, Laurel, MD 20723 (United States); Ness, N. F. [Catholic University of America, 620 Michigan Avenue NE, Washington, DC 20064 (United States); Burlaga, L. F., E-mail: donald-gurnett@uiowa.edu [NASA Goddard Space Flight Center, 8800 Greenbelt Road, Greenbelt, MD 20771 (United States)

    2015-08-20

    On or about 2012 August 25, the Voyager 1 spacecraft crossed the heliopause into the nearby interstellar plasma. In the nearly three years that the spacecraft has been in interstellar space, three notable particle and field disturbances have been observed, each apparently associated with a shock wave propagating outward from the Sun. Here, we present a detailed analysis of the third and most impressive of these disturbances, with brief comparisons to the two previous events, both of which have been previously reported. The shock responsible for the third event was first detected on 2014 February 17 by the onset of narrowband radio emissions from the approaching shock, followed on 2014 May 13 by the abrupt appearance of intense electron plasma oscillations generated by electrons streaming outward ahead of the shock. Finally, the shock arrived on 2014 August 25, as indicated by a jump in the magnetic field strength and the plasma density. Various disturbances in the intensity and anisotropy of galactic cosmic rays were also observed ahead of the shock, some of which are believed to be caused by the reflection and acceleration of cosmic rays by the magnetic field jump at the shock, and/or by interactions with upstream plasma waves. Comparisons to the two previous weaker events show somewhat similar precursor effects, although differing in certain details. Many of these effects are very similar to those observed in the region called the “foreshock” that occurs upstream of planetary bow shocks, only on a vastly larger spatial scale.

  7. Corporate Policies with Permanent and Transitory Shocks

    NARCIS (Netherlands)

    J-P. Decamps (Jean-Paul); S. Gryglewicz (Sebastian); E. Morellec (Erwan); S. Villeneuve (Stephane)

    2016-01-01

    textabstractWe model the financing, cash holdings, and hedging policies of a firm facing financing frictions and subject to permanent and transitory cash flow shocks. We show that permanent and transitory shocks generate distinct, sometimes opposite, effects on corporate policies and use the model

  8. Shock dynamics in layered periodic media

    KAUST Repository

    Ketcheson, David I.; Leveque, Randall J.

    2012-01-01

    of shock waves in a one-dimensional periodic layered medium by a computational study of time-reversibility and entropy evolution. We find that periodic layered media tend to inhibit shock formation. For small initial conditions and large impedance variation

  9. Particle acceleration and shock wave structure

    International Nuclear Information System (INIS)

    DRURY, L.O'C.

    1989-01-01

    A significant determinant in the large-scale structure and evolution of strong collisionless shocks under astrophysical conditions is probably the acceleration of charged particles. The reaction of these particles on the dynamical structure of the shock wave is discussed both theoretically and in the light of recent numerical calculations. Astrophysical implications for the evolution of supernova remnants, are considered. (author). 15 refs

  10. Laser shock wave and its applications

    Science.gov (United States)

    Yang, Chaojun; Zhang, Yongkang; Zhou, Jianzhong; Zhang, Fang; Feng, Aixin

    2007-12-01

    The technology of laser shock wave is used to not only surface modification but also metal forming. It can be divided into three parts: laser shock processing, laser shock forming (LSF) and laser peenforming(LPF). Laser shock processing as a surface treatment to metals can make engineering components have a residual compressive stress so that it obviously improves their fatigue strength and stress corrosion performances, while laser shock forming (LSF) is a novel technique that is used in plastic deformation of sheet metal recently and Laser peen forming (LPF) is another new sheet metal forming process presented in recent years. They all can be carried out by a high-power and repetition pulse Nd:Glass laser device made by Jiangsu University. Laser shock technology has characterized of ultrahigh pressure and high strain rate (10 6 - 10 7s -1). Now, for different materials, we are able to form different metals to contours and shapes and simultaneity leave their surfaces in crack-resistant compressive stress state. The results show that the technology of laser shock wave can strengthen surface property and prolong fatigue life and especially can deform metals to shapes that could not be adequately made using conventional methods. With the development of the technology of laser shock wave, the applied fields of laser will become greater and greater.

  11. Introduction to Shock Waves and Shock Wave Research

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, William Wyatt [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-02

    M-9 and a number of other organizations at LANL and elsewhere study materials in dynamic processes. Often, this is described as “shock wave research,” but in reality is broader than is implied by that term. Most of our work is focused on dynamic compression and associated phenomena, but you will find a wide variety of things we do that, while related, are not simple compression of materials, but involve a much richer variety of phenomena. This tutorial will introduce some of the underlying physics involved in this work, some of the more common types of phenomena we study, and common techniques. However, the list will not be exhaustive by any means.

  12. Shock loading predictions from application of indicial theory to shock-turbulence interactions

    Science.gov (United States)

    Keefe, Laurence R.; Nixon, David

    1991-01-01

    A sequence of steps that permits prediction of some of the characteristics of the pressure field beneath a fluctuating shock wave from knowledge of the oncoming turbulent boundary layer is presented. The theory first predicts the power spectrum and pdf of the position and velocity of the shock wave, which are then used to obtain the shock frequency distribution, and the pdf of the pressure field, as a function of position within the interaction region. To test the validity of the crucial assumption of linearity, the indicial response of a normal shock is calculated from numerical simulation. This indicial response, after being fit by a simple relaxation model, is used to predict the shock position and velocity spectra, along with the shock passage frequency distribution. The low frequency portion of the shock spectra, where most of the energy is concentrated, is satisfactorily predicted by this method.

  13. Shock-induced devolatilization of calcite

    Science.gov (United States)

    Boslough, M. B.; Ahrens, T. J.; Vizgirda, J.; Becker, R. H.; Epstein, S.

    1982-01-01

    Experimental measurements of the release adiabats by Vizgirda (1981) indicate that substantial vaporization takes place upon release from shock pressures of 37 GPa for calcite and 14 GPa for aragonite. The present investigation includes the first controlled partial vaporization experiments on calcite. The experiments were conducted to test the predictions of the release adiabat experiments. The quantities of the gaseous species produced from shocked calcite and their carbon and oxygen isotopic compositions were determined, and the shock-induced effect on the Mn(2+) electron spin resonance spectrum in the shock-recovered calcite was observed. On the basis of the obtained results, it is concluded that shock stresses at the 17-18 GPa level give rise to volatilization of 0.03-0.3 (mole) percent of calcite to CO2 and CO. The devolatilization of calcite occurs at low pressure at significantly lower entropy densities than predicted on the basis of thermodynamic continuum models.

  14. Shock waves in helium at low temperatures

    International Nuclear Information System (INIS)

    Liepmann, H.W.; Torczynski, J.R.

    1986-01-01

    Results are reported from studies of the properties of low temperature He-4 using shock waves as a probe. Ideal shock tube theory is used to show that sonic speeds of Mach 40 are attainable in He at 300 K. Viscosity reductions at lower temperatures minimize boundary layer effects at the side walls. A two-fluid model is described to account for the phase transition which He undergoes at temperatures below 2.2 K, after which the quantum fluid (He II) and the normal compressed superfluid (He I) coexist. Analytic models are provided for pressure-induced shocks in He I and temperature-induced shock waves (called second sound) which appear in He II. The vapor-fluid interface of He I is capable of reflecting second and gasdynamic sound shocks, which can therefore be used as probes for studying phase transitions between He I and He II. 17 references

  15. Analytical extension of curved shock theory

    Science.gov (United States)

    Emanuel, G.

    2018-03-01

    Curved shock theory (CST) is limited to shock waves in a steady, two-dimensional or axisymmetric (2-Ax) flow of a perfect gas. A unique feature of CST is its use of intrinsic coordinates that result in an elegant and useful formulation for flow properties just downstream of a shock. For instance, the downstream effect of upstream vorticity, shock wave curvature, and the upstream pressure gradient along a streamline is established. There have been several attempts to extend CST, as mentioned in the text. Removal of the steady, 2-Ax, and perfect gas limitations, singly or in combination, requires an appropriate formulation of the shock wave's jump relations and the intrinsic coordinate Euler equations. Issues discussed include flow plane versus osculating plane, unsteady flow, vorticity, an imperfect gas, etc. The extension of CST utilizes concepts from differential geometry, such as the osculating plane, streamline torsion, and the Serret-Frenet equations.

  16. 28th International Symposium on Shock Waves

    CERN Document Server

    2012-01-01

    The University of Manchester hosted the 28th International Symposium on Shock Waves between 17 and 22 July 2011. The International Symposium on Shock Waves first took place in 1957 in Boston and has since become an internationally acclaimed series of meetings for the wider Shock Wave Community. The ISSW28 focused on the following areas: Blast Waves, Chemically Reacting Flows, Dense Gases and Rarefied Flows, Detonation and Combustion, Diagnostics, Facilities, Flow Visualisation, Hypersonic Flow, Ignition, Impact and Compaction, Multiphase Flow, Nozzle Flow, Numerical Methods, Propulsion, Richtmyer-Meshkov, Shockwave Boundary Layer Interaction, Shock Propagation and Reflection, Shock Vortex Interaction, Shockwave Phenomena and Applications, as well as Medical and Biological Applications. The two Volumes contain the papers presented at the symposium and serve as a reference for the participants of the ISSW 28 and individuals interested in these fields.

  17. Barrier experiment: Shock initiation under complex loading

    Energy Technology Data Exchange (ETDEWEB)

    Menikoff, Ralph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-01-12

    The barrier experiments are a variant of the gap test; a detonation wave in a donor HE impacts a barrier and drives a shock wave into an acceptor HE. The question we ask is: What is the trade-off between the barrier material and threshold barrier thickness to prevent the acceptor from detonating. This can be viewed from the perspective of shock initiation of the acceptor subject to a complex pressure drive condition. Here we consider key factors which affect whether or not the acceptor undergoes a shock-to-detonation transition. These include the following: shock impedance matches for the donor detonation wave into the barrier and then the barrier shock into the acceptor, the pressure gradient behind the donor detonation wave, and the curvature of detonation front in the donor. Numerical simulations are used to illustrate how these factors affect the reaction in the acceptor.

  18. Calculation of the πsup(+)sup(7)Li → pesup(+)esup(-)sup(6)Li

    International Nuclear Information System (INIS)

    Avakov, G.V.; Blokhintsev, L.D.; Blokhintseva, T.D.

    1985-01-01

    The π +7 Li → p e + e -6 Li reaction have been considered in the framework of the nucleon cluster model and of the shell model. The cross section of this reaction have been calculated at the pion kinetic energy 380 MeV. The comparison with the available experimental data has been carried out

  19. Association and Diffusion of Li(+) in Carboxymethylcellulose Solutions for Environmentally Friendly Li-ion Batteries.

    Science.gov (United States)

    Casalegno, Mosè; Castiglione, Franca; Passarello, Marco; Mele, Andrea; Passerini, Stefano; Raos, Guido

    2016-07-21

    Carboxymethylcellulose (CMC) has been proposed as a polymeric binder for electrodes in environmentally friendly Li-ion batteries. Its physical properties and interaction with Li(+) ions in water are interesting not only from the point of view of electrode preparation-processability in water is one of the main reasons for its environmental friendliness-but also for its possible application in aqueous Li-ion batteries. We combine molecular dynamics simulations and variable-time pulsed field gradient spin-echo (PFGSE) NMR spectroscopy to investigate Li(+) transport in CMC-based solutions. Both the simulations and experimental results show that, at concentrations at which Li-CMC has a gel-like consistency, the Li(+) diffusion coefficient is still very close to that in water. These Li(+) ions interact preferentially with the carboxylate groups of CMC, giving rise to a rich variety of coordination patterns. However, the diffusion of Li(+) in these systems is essentially unrestricted, with a fast, nanosecond-scale exchange of the ions between CMC and the aqueous environment. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  20. Electrochemical behavior of Li/LiV3O8 secondary cells

    Science.gov (United States)

    Bak, Hyo Rim; Lee, Jae Ha; Kim, Bok Ki; Yoon, Woo Young

    2013-03-01

    Li/LiV3O8 secondary cells with Li-foil and Li-powder anodes were fabricated, and their electrical properties were compared. Using the powder anode, a cell with an initial discharge capacity of 260 mAh g-1 that could be operated for over 100 cycles was obtained. The porous Li-powder electrode was safely synthesized by pressing an emulsion droplet onto an SUS mesh. A threefold increase in the electrical conductivity of the LiV3O8 cathode was achieved by the addition of carbon using a vibration pot mill. Using the powder anode resulted in 80% capacity retention at the 100th cycle, while that using the foil electrode was 46%; the 1.0 Crate/ 0.1 C-rate capacity ratio also increased from 44% to 60%. A cell employing the LiV3O8-carbon composite cathode showed better electrical performance, a capacity retention of 90% after 50 cycles, and an increase in rate capacity ratio. The crystal structure and morphology of the LiV3O8-C composite were investigated by x-ray diffraction and scanning electron microscopy.

  1. The astrophysical reaction 8Li(n,gamma)9Li from measurements by reverse kinematics

    OpenAIRE

    Bertulani, Carlos A.

    1998-01-01

    We study the breakup of 9Li projectiles in high energy (28.5 MeV/u) collisions with heavy nuclear targets (208Pb). The wave functions are calculated using a single-particle model for 9Li, and a simple optical potential model for the scattering part. A good agreement with measured data is obtained with insignificant E2 contribution.

  2. Configuring PSx tetrahedral clusters in Li-excess Li7P3S11 solid electrolyte

    Directory of Open Access Journals (Sweden)

    Wo Dum Jung

    2018-04-01

    Full Text Available We demonstrate that the Li-ion conductivity can be improved by adding a certain amount of Li (x = 0.25–0.5 as a charge carrier to the composition of glass-ceramic Li7+xP3S11. Structural analysis clarified that the structural changes caused by the ratio of ortho-thiophosphate tetrahedra PS43− and pyro-thiophosphate ditetrahedra P2S74− affect the Li-ion conductivity. The ratio of PS43− and P2S74− varies depending on x and the highest Li-ion conductivity (2.5 × 10−3 S cm−1 at x = 0.25. All-solid-state LiNi0.8Co0.15Al0.05O2/Li7.25P3S11/In-metal cell exhibits the discharge capacity of 106.2 mAh g−1. This ion conduction enhancement from excess Li is expected to contribute to the future design of sulfide-type electrolytes.

  3. Small-Scale Shock Testing of Propellants and Ingredients

    National Research Council Canada - National Science Library

    Dawley, S

    2004-01-01

    .... The use of small-scale gap testing to evaluate the shock sensitivity of individual propellant ingredients and propellant formulations is a valuable method for experimentally establishing shock...

  4. Coulomb excitation of {sup 8}Li

    Energy Technology Data Exchange (ETDEWEB)

    Assuncao, Marlete; Britos, Tatiane Nassar [Universidade Federal de Sao Paulo (UNIFESP), SP (Brazil). Dept. de Ciencias Exatas e da Terra; Descouvemont, Pierre [Universite Libre de Bruxelles (ULB), Brussels (Belgium). Physique Nucleaire Theorique et Physique Mathematique; Lepine-Szily, Alinka; Lichtenthaler Filho, Rubens; Barioni, Adriana; Silva, Diego Medeiros da; Pereira, Dirceu; Mendes Junior, Djalma Rosa; Pires, Kelly Cristina Cezaretto; Gasques, Leandro Romero; Morais, Maria Carmen; Added, Nemitala; Neto Faria, Pedro; Rec, Rafael [Universidade de Sao Paulo (IF/USP), SP (Brazil). Inst. de Fisica. Dept. de Fisica Nuclear

    2012-07-01

    Full text: This work shows the Coulomb Excitation of {sup 8}Li on targets that have effectively behavior of Rutherford in angles and energies of interest for determining the value of the B(E2) electromagnetic transition. Theoretical aspects involved in this type of measure, known as COULEX [1], and some results in the literature [2-3] will be presented. Some problems with the targets and measurement system while performing an experiment on Coulomb Excitation of {sup 8}Li will be discussed: the energy resolution, background, possible contributions of the primary beam and also the excited states of the target near the region of elastic and inelastic peaks. They will be illustrated by measurements of the Coulomb Excitation of {sup 8}Li on targets of {sup 197}Au and {sup 208}Pb using the system RIBRAS(Brazilian Radioactive Ion Beam). In this case, the {sup 8}Li beam(T{sub 1/2} = 838 ms)is produced by {sup 9}Be({sup 7}Li;{sup 8} Li){sup 8}Be reaction from RIBRAS system which is installed at Instituto de Fisica of the Universidade de Sao Paulo. The primary {sup 7L}i beam is provided by Pelletron Accelerator. [1] K. Alder and A. Winther, Electromagnetic Excitation, North-Holland, New York, 1975; [2] P. Descouvemont and D. Baye, Phys. Letts. B 292, 235-238, 1992; [3] J. A. Brown, F. D. Becchetti, J. W. Jaenecke, K, Ashktorab, and D. A. Roberts, J. J. Kolata, R. J. Smith, and K. Lamkin, R. E. Warner, Phys. Rev. Letts., 66, 19, 1991; [4] R. J. Smith, J. J Kolata, K. Lamkin and A. Morsard, F. D. Becchetti, J. A. Brown, W. Z. Liu, J. W. Jaenecke, and D. A. Roberts, R. E. Warner, Phys. Rev. C, 43, 5, 1991. (author)

  5. Surface instabilities in shock loaded granular media

    Science.gov (United States)

    Kandan, K.; Khaderi, S. N.; Wadley, H. N. G.; Deshpande, V. S.

    2017-12-01

    The initiation and growth of instabilities in granular materials loaded by air shock waves are investigated via shock-tube experiments and numerical calculations. Three types of granular media, dry sand, water-saturated sand and a granular solid comprising PTFE spheres were experimentally investigated by air shock loading slugs of these materials in a transparent shock tube. Under all shock pressures considered here, the free-standing dry sand slugs remained stable while the shock loaded surface of the water-saturated sand slug became unstable resulting in mixing of the shocked air and the granular material. By contrast, the PTFE slugs were stable at low pressures but displayed instabilities similar to the water-saturated sand slugs at higher shock pressures. The distal surfaces of the slugs remained stable under all conditions considered here. Eulerian fluid/solid interaction calculations, with the granular material modelled as a Drucker-Prager solid, reproduced the onset of the instabilities as seen in the experiments to a high level of accuracy. These calculations showed that the shock pressures to initiate instabilities increased with increasing material friction and decreasing yield strain. Moreover, the high Atwood number for this problem implied that fluid/solid interaction effects were small, and the initiation of the instability is adequately captured by directly applying a pressure on the slug surface. Lagrangian calculations with the directly applied pressures demonstrated that the instability was caused by spatial pressure gradients created by initial surface perturbations. Surface instabilities are also shown to exist in shock loaded rear-supported granular slugs: these experiments and calculations are used to infer the velocity that free-standing slugs need to acquire to initiate instabilities on their front surfaces. The results presented here, while in an idealised one-dimensional setting, provide physical understanding of the conditions required to

  6. Measurements of the fundamental thermodynamic parameters of Li/BCX and Li/SOCl2 cells

    Science.gov (United States)

    Kalu, E. E.; White, R. E.; Darcy, E. C.

    1992-01-01

    Two experimental techniques - equilibrium or reversible cell discharge and measurement of open circuit potential as a function of temperature - are used to determine the thermodynamic data needed to estimate the heat generation characteristics of Li/BCX and Li/SOCl2 cells. The results obtained showed that the reversible cell potential, the temperature dependence of the reversible cell potential, and the thermoneutral potential of the BCX cell were 3.74 V, -0.857 +/- 0.198 mV/K, and 3.994 +/- 0.0603 V, respectively. The respective values obtained for the Li/SOCl2 cell were 3.67 V, -0.776 +/- 0.255 mV/K, and 3.893 +/- 0.0776 V. The difference between the thermoneutral potential of Li/BCX and Li/SCl2 cells is attributable to the difference in their electroactive components.

  7. 7Li(d,p)8Li transfer reaction in the NCSM/RGM approach

    Science.gov (United States)

    Raimondi, F.; Hupin, G.; Navrátil, P.; Quaglioni, S.

    2018-03-01

    Recently, we applied an ab initio method, the no-core shell model combined with the resonating group method, to the transfer reactions with light p-shell nuclei as targets and deuteron as the projectile. In particular, we studied the elastic scattering of deuterium on 7Li and the 7Li(d,p)8Li transfer reaction starting from a realistic two-nucleon interaction. In this contribution, we review of our main results on the 7Li(d,p)8Li transfer reaction, and we extend the study of the relevant reaction channels, by showing the dominant resonant phase shifts of the scattering matrix. We assess also the impact of the polarization effects of the deuteron below the breakup on the positive-parity resonant states in the reaction. For this purpose, we perform an analysis of the convergence trend of the phase and eigenphase shifts, with respect to the number of deuteron pseudostates included in the model space.

  8. Relaxation-phenomena in LiAl/FeS-cells

    Science.gov (United States)

    Borger, W.; Kappus, W.; Panesar, H. S.

    A theoretical model of the capacity of strongly relaxing electrochemical systems is applied to the LiAl/FeS system. Relaxation phenomena in LiAl and FeS electrodes can be described by this model. Experimental relaxation data indicate that lithium transport through the alpha-LiAl layer to the particle surface is the capacity limiting process at high discharge current density in the LiAl electrode in LiCl-KCl and LiF-LiCl-LiBr mixtures. Strong relaxation is observed in the FeS electrode with LiCl-KCl electrolyte caused by lithium concentration gradients and precipitation of KCl in the pores.

  9. Modeling Li-ion conductivity in LiLa(PO{sub 3}){sub 4} powder

    Energy Technology Data Exchange (ETDEWEB)

    Mounir, Ferhi, E-mail: ferhi.mounir@gmail.com [Laboratoire de Physicochimie des Materiaux Mineraux et leurs Applications, Centre National des Recherches en Sciences des Materiaux, BP No. 73, 8027 Soliman (Tunisia); Karima, Horchani-Naifer [Laboratoire de Physicochimie des Materiaux Mineraux et leurs Applications, Centre National des Recherches en Sciences des Materiaux, BP No. 73, 8027 Soliman (Tunisia); Khaled, Ben Saad [Laboratoire de Photovoltaieque, Centre des Recherches et des Technologies de l' Energie, Technopole Borj Cedria, BP No. 95, 2050 Hammam Lif (Tunisia); Mokhtar, Ferid [Laboratoire de Physicochimie des Materiaux Mineraux et leurs Applications, Centre National des Recherches en Sciences des Materiaux, BP No. 73, 8027 Soliman (Tunisia)

    2012-07-01

    Polycrystalline powder and single-crystal of LiLa(PO{sub 3}){sub 4} are synthesized by solid state reaction and flux technique, respectively. A morphological description of the obtained product was made based on scanning electron microscopy micrographs. The obtained powder was characterized by X-ray powder diffraction, FTIR and Raman spectroscopies. Ionic conductivity of the LiLa(PO{sub 3}){sub 4} powder was measured and evaluated over a temperature range from 553 to 913 K. Single crystals of LiLa(PO{sub 3}){sub 4} are characterized by single-crystal X-ray diffraction. The LiLa(PO{sub 3}){sub 4} structure was found to be isotypic with LiNd(PO{sub 3}){sub 4}. It crystallizes in the monoclinic system with space group C2/c and cell parameters: a=16.635(6) A, b=7.130(3) A, c=9.913(3) A, {beta}=126.37(4) Degree-Sign , V=946.72(6) A{sup 3} and Z=4. The LiLa(PO{sub 3}){sub 4} structure was described as an alternation between spiraling chains (PO{sub 3}){sub n} and (La{sup 3+}, Li{sup +}) cations along the b direction. The small Li{sup +} ions, coordinated to four oxygen atoms, were located in the large connected cavities created between the LaO{sub 8} polyhedra and the polyphosphate chains. The jumping of Li{sup +} through tunnels of the crystalline network was investigated using complex impedance spectroscopy. The close value of the activation energies calculated through the analysis of conductivity data and loss spectra indicate that the transport in the investigated system is through hopping mechanism. The correlation between ionic conductivity of LiLa(PO{sub 3}){sub 4} and its crystallographic structure was investigated and the most probably transport pathway model was determined.

  10. Modeling Li-ion conductivity in LiLa(PO3)4 powder

    International Nuclear Information System (INIS)

    Mounir, Ferhi; Karima, Horchani-Naifer; Khaled, Ben Saad; Mokhtar, Férid

    2012-01-01

    Polycrystalline powder and single-crystal of LiLa(PO 3 ) 4 are synthesized by solid state reaction and flux technique, respectively. A morphological description of the obtained product was made based on scanning electron microscopy micrographs. The obtained powder was characterized by X-ray powder diffraction, FTIR and Raman spectroscopies. Ionic conductivity of the LiLa(PO 3 ) 4 powder was measured and evaluated over a temperature range from 553 to 913 K. Single crystals of LiLa(PO 3 ) 4 are characterized by single-crystal X-ray diffraction. The LiLa(PO 3 ) 4 structure was found to be isotypic with LiNd(PO 3 ) 4 . It crystallizes in the monoclinic system with space group C2/c and cell parameters: a=16.635(6) Å, b=7.130(3) Å, c=9.913(3) Å, β=126.37(4)°, V=946.72(6) Å 3 and Z=4. The LiLa(PO 3 ) 4 structure was described as an alternation between spiraling chains (PO 3 ) n and (La 3+ , Li + ) cations along the b direction. The small Li + ions, coordinated to four oxygen atoms, were located in the large connected cavities created between the LaO 8 polyhedra and the polyphosphate chains. The jumping of Li + through tunnels of the crystalline network was investigated using complex impedance spectroscopy. The close value of the activation energies calculated through the analysis of conductivity data and loss spectra indicate that the transport in the investigated system is through hopping mechanism. The correlation between ionic conductivity of LiLa(PO 3 ) 4 and its crystallographic structure was investigated and the most probably transport pathway model was determined.

  11. Design and operation of thermal-convection loops for corrosion measurements in LiF--LiCl--LiBr

    International Nuclear Information System (INIS)

    Keiser, J.R.; DeVan, J.H.

    1979-01-01

    Using a most sophisticated design of a thermal-convection loop to study the corrosion behavior of type 316 stainless steel and the salt mixture LiF--LiCl--LiBr is reported. The corrosion rate is being determined as a function of time and temperature through weight change measurements. The maximum corrosion rate measured is about 20 μm/year on removable corrosion specimens. Controlled potential voltammetry has been found to be satisfactory and is being used to monitor the oxidation potential of the salt. Measurements demonstrate the effect on the oxidation potential of impurities introduced during specimen insertion, and techniques should show the effect of a lithium addition on the oxidation potential

  12. Mechanisms of emission of particles charged in 6Li + 6Li and 6Li + 10B reactions at low energies

    International Nuclear Information System (INIS)

    Quebert, Jean

    1964-01-01

    The lithium 6 nucleus is a projectile of interest to study nuclear reactions at low energy due to the possibility to obtain high heats of reaction, and to its structure which can play an important role in the projectile-target interaction. This research thesis focused on the study of two low-energy reactions provoked by lithium projectiles. These reactions are studied within the framework of the theoretical model of aggregates. The first part presents the experimental conditions of both reactions, reports the development and analysis of nuclear plates, and the transformation of a given type of particle histogram into a spectrum in the mass centre system. The next parts report the study of the 6 Li + 6 Li reaction (previous results, kinematic analysis, spectrum of secondary particles, theoretical analysis of results) and of the 6 Li + 10 B reaction (previous results, experimental results, study of the continuous spectrum of alpha particle, reaction mechanisms)

  13. Transport properties of LiF under strong compression: modeling using advanced electronic structure methods and classical molecular dynamics

    Science.gov (United States)

    Mattsson, Thomas R.; Jones, Reese; Ward, Donald; Spataru, Catalin; Shulenburger, Luke; Benedict, Lorin X.

    2015-06-01

    Window materials are ubiquitous in shock physics and with high energy density drivers capable of reaching multi-Mbar pressures the use of LiF is increasing. Velocimetry and temperature measurements of a sample through a window are both influenced by the assumed index of refraction and thermal conductivity, respectively. We report on calculations of index of refraction using the many-body theory GW and thermal ionic conductivity using linear response theory and model potentials. The results are expected to increase the accuracy of a broad range of high-pressure shock- and ramp compression experiments. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Company, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL85000.

  14. Effects of Atwood number on shock focusing in shock-cylinder interaction

    Science.gov (United States)

    Ou, Junfeng; Ding, Juchun; Luo, Xisheng; Zhai, Zhigang

    2018-02-01

    The evolution of shock-accelerated heavy-gas cylinder surrounded by the air with different Atwood numbers (A_t=0.28, 0.50, 0.63) is investigated, concentrating on shock focusing and jet formation. Experimentally, a soap film technique is used to generate an ideal two-dimensional discontinuous gas cylinder with a clear surface, which can guarantee the observation of shock wave movements inside the cylinder. Different Atwood numbers are realized by different mixing ratios of SF_6 and air inside the cylinder. A high-speed schlieren system is adopted to capture the shock motions and jet morphology. Numerical simulations are also performed to provide more information. The results indicate that an inward jet is formed for low Atwood numbers, while an outward jet is generated for high Atwood numbers. Different Atwood numbers will lead to the differences in the relative velocities between the incident shock and the refraction shock, which ultimately results in the differences in shock competition near the downstream pole. The morphology and feature of the jet are closely associated with the position and intensity of shock focusing. The pressure and vorticity contours indicate that the jet formation should be attributed to the pressure pulsation caused by shock focusing, and the jet development is ascribed to the vorticity induction. Finally, a time ratio proposed in the previous work for determining the shock-focusing type is verified by experiments.

  15. Shock Mechanism Analysis and Simulation of High-Power Hydraulic Shock Wave Simulator

    Directory of Open Access Journals (Sweden)

    Xiaoqiu Xu

    2017-01-01

    Full Text Available The simulation of regular shock wave (e.g., half-sine can be achieved by the traditional rubber shock simulator, but the practical high-power shock wave characterized by steep prepeak and gentle postpeak is hard to be realized by the same. To tackle this disadvantage, a novel high-power hydraulic shock wave simulator based on the live firing muzzle shock principle was proposed in the current work. The influence of the typical shock characteristic parameters on the shock force wave was investigated via both theoretical deduction and software simulation. According to the obtained data compared with the results, in fact, it can be concluded that the developed hydraulic shock wave simulator can be applied to simulate the real condition of the shocking system. Further, the similarity evaluation of shock wave simulation was achieved based on the curvature distance, and the results stated that the simulation method was reasonable and the structural optimization based on software simulation is also beneficial to the increase of efficiency. Finally, the combination of theoretical analysis and simulation for the development of artillery recoil tester is a comprehensive approach in the design and structure optimization of the recoil system.

  16. A Prognostic Model for Development of Profound Shock among Children Presenting with Dengue Shock Syndrome.

    Directory of Open Access Journals (Sweden)

    Phung Khanh Lam

    Full Text Available To identify risk factors and develop a prediction model for the development of profound and recurrent shock amongst children presenting with dengue shock syndrome (DSS.We analyzed data from a prospective cohort of children with DSS recruited at the Paediatric Intensive Care Unit of the Hospital for Tropical Disease in Ho Chi Minh City, Vietnam. The primary endpoint was "profound DSS", defined as ≥2 recurrent shock episodes (for subjects presenting in compensated shock, or ≥1 recurrent shock episodes (for subjects presenting initially with decompensated/hypotensive shock, and/or requirement for inotropic support. Recurrent shock was evaluated as a secondary endpoint. Risk factors were pre-defined clinical and laboratory variables collected at the time of presentation with shock. Prognostic model development was based on logistic regression and compared to several alternative approaches.The analysis population included 1207 children of whom 222 (18% progressed to "profound DSS" and 433 (36% had recurrent shock. Independent risk factors for both endpoints included younger age, earlier presentation, higher pulse rate, higher temperature, higher haematocrit and, for females, worse hemodynamic status at presentation. The final prognostic model for "profound DSS" showed acceptable discrimination (AUC=0.69 for internal validation and calibration and is presented as a simple score-chart.Several risk factors for development of profound or recurrent shock among children presenting with DSS were identified. The score-chart derived from the prognostic models should improve triage and management of children presenting with DSS in dengue-endemic areas.

  17. Heat shock proteins of higher plants

    International Nuclear Information System (INIS)

    Key, J.L.; Lin, C.Y.; Chen, Y.M.

    1981-01-01

    The pattern of protein synthesis changes rapidly and dramatically when the growth temperture of soybean seedling tissue is increased from 28 0 C (normal) to about 40 0 C (heat shock). The synthesis of normal proteins is greatly decreased and a new set of proteins, heat shock proteins, is induced. The heat shock proteins of soybean consist of 10 new bands on one-dimensional NaDodSO 4 gels; a more complex pattern is observed on two-dimensional gels. when the tissue is returned to 28 0 C after 4 hr at 40 0 C, there is progressive decline in the synthesis of heat shock proteins and reappearance of a normal pattern of synthesis by 3 or 4 hr. In vitro translation of poly(A) + RNAs isolated from tissued grown at 28 and 40 0 C shows that the heat shock proteins are translated from a ndw set of mRNAs induced at 40 0 C; furthermore, the abundant class mRNAs for many of the normal proteins persist even though they are translated weakly (or not at all) in vivo at 40 or 42.5 0 C. The heat shock response in soybean appears similar to the much-studied heat shock phenomenon in Drosophila

  18. Overview of shock waves in medicine

    Science.gov (United States)

    Cleveland, Robin O.

    2003-10-01

    A brief overview of three applications of shock waves is presented. Shock wave lithotripsy (SWL) has been in clinical use for more than 20 years. In the United States it is used to treat more than 80% of kidney stone cases and has wide acceptance with patients because it is a noninvasive procedure. Despite SWLs enormous success there is no agreement on how shock waves comminute stones. There is also a general acceptance that shock waves lead to trauma to the soft tissue of the kidney. Yet there has been little forward progress in developing lithotripters which provide comminution with less side-effects, indeed the original machine is still considered the gold standard. The last decade has seen the advent of new shock wave devices for treating principally musculoskeletal indications, such as plantar fasciitis, tennis elbow, and bone fractures that do not heal. This is referred to as shock wave therapy (SWT). The mechanisms by which SWT works are even less well understood than SWL and the consequences of bioeffects have also not been studied in detail. Shock waves have also been shown to be effective at enhancing drug delivery into cells and assisting with gene transfection. [Work partially supported by NIH.

  19. Structure of Energetic Particle Mediated Shocks Revisited

    International Nuclear Information System (INIS)

    Mostafavi, P.; Zank, G. P.; Webb, G. M.

    2017-01-01

    The structure of collisionless shock waves is often modified by the presence of energetic particles that are not equilibrated with the thermal plasma (such as pickup ions [PUIs] and solar energetic particles [SEPs]). This is relevant to the inner and outer heliosphere and the Very Local Interstellar Medium (VLISM), where observations of shock waves (e.g., in the inner heliosphere) show that both the magnetic field and thermal gas pressure are less than the energetic particle component pressures. Voyager 2 observations revealed that the heliospheric termination shock (HTS) is very broad and mediated by energetic particles. PUIs and SEPs contribute both a collisionless heat flux and a higher-order viscosity. We show that the incorporation of both effects can completely determine the structure of collisionless shocks mediated by energetic ions. Since the reduced form of the PUI-mediated plasma model is structurally identical to the classical cosmic ray two-fluid model, we note that the presence of viscosity, at least formally, eliminates the need for a gas sub-shock in the classical two-fluid model, including in that regime where three are possible. By considering parameters upstream of the HTS, we show that the thermal gas remains relatively cold and the shock is mediated by PUIs. We determine the structure of the weak interstellar shock observed by Voyager 1 . We consider the inclusion of the thermal heat flux and viscosity to address the most general form of an energetic particle-thermal plasma two-fluid model.

  20. Impaired Fracture Healing after Hemorrhagic Shock

    Directory of Open Access Journals (Sweden)

    Philipp Lichte

    2015-01-01

    Full Text Available Impaired fracture healing can occur in severely injured patients with hemorrhagic shock due to decreased soft tissue perfusion after trauma. We investigated the effects of fracture healing in a standardized pressure controlled hemorrhagic shock model in mice, to test the hypothesis that bleeding is relevant in the bone healing response. Male C57/BL6 mice were subjected to a closed femoral shaft fracture stabilized by intramedullary nailing. One group was additionally subjected to pressure controlled hemorrhagic shock (HS, mean arterial pressure (MAP of 35 mmHg for 90 minutes. Serum cytokines (IL-6, KC, MCP-1, and TNF-α were analyzed 6 hours after shock. Fracture healing was assessed 21 days after fracture. Hemorrhagic shock is associated with a significant increase in serum inflammatory cytokines in the early phase. Histologic analysis demonstrated a significantly decreased number of osteoclasts, a decrease in bone quality, and more cartilage islands after hemorrhagic shock. μCT analysis showed a trend towards decreased bone tissue mineral density in the HS group. Mechanical testing revealed no difference in tensile failure. Our results suggest a delay in fracture healing after hemorrhagic shock. This may be due to significantly diminished osteoclast recruitment. The exact mechanisms should be studied further, particularly during earlier stages of fracture healing.

  1. Structure of Energetic Particle Mediated Shocks Revisited

    Energy Technology Data Exchange (ETDEWEB)

    Mostafavi, P.; Zank, G. P. [Department of Space Science, University of Alabama in Huntsville, Huntsville, AL 35899 (United States); Webb, G. M. [Center for Space Plasma and Aeronomic Research (CSPAR), University of Alabama in Huntsville, Huntsville, AL 35899 (United States)

    2017-05-20

    The structure of collisionless shock waves is often modified by the presence of energetic particles that are not equilibrated with the thermal plasma (such as pickup ions [PUIs] and solar energetic particles [SEPs]). This is relevant to the inner and outer heliosphere and the Very Local Interstellar Medium (VLISM), where observations of shock waves (e.g., in the inner heliosphere) show that both the magnetic field and thermal gas pressure are less than the energetic particle component pressures. Voyager 2 observations revealed that the heliospheric termination shock (HTS) is very broad and mediated by energetic particles. PUIs and SEPs contribute both a collisionless heat flux and a higher-order viscosity. We show that the incorporation of both effects can completely determine the structure of collisionless shocks mediated by energetic ions. Since the reduced form of the PUI-mediated plasma model is structurally identical to the classical cosmic ray two-fluid model, we note that the presence of viscosity, at least formally, eliminates the need for a gas sub-shock in the classical two-fluid model, including in that regime where three are possible. By considering parameters upstream of the HTS, we show that the thermal gas remains relatively cold and the shock is mediated by PUIs. We determine the structure of the weak interstellar shock observed by Voyager 1 . We consider the inclusion of the thermal heat flux and viscosity to address the most general form of an energetic particle-thermal plasma two-fluid model.

  2. Shock propagation in a heterogeneous medium

    International Nuclear Information System (INIS)

    Elbaz, D.

    2011-01-01

    In the frame of the inertial confinement fusion in direct drive, the use of foams as ablator allows the reduction of hydrodynamic instabilities created on the target by the direct laser irradiation. The foam is made up of carbon (CH) fibers impregnated of cryogenic deuterium-tritium (DT). In the past, studies have been carried out considering this foam to be a homogeneous medium. Yet, the foam presents heterogeneous features. We study the effects of this heterogeneity on the shock velocity when the laser irradiates the target. Thanks to experimental and numerical studies, we show that the shock propagates faster in the heterogeneous medium than in the homogeneous one with the same averaged density. This velocity gap depends on the presence rate of the CH fibers in the foam, the density ratio, the adiabatic coefficient and the foam geometry. We model the foam by different ways, more and more complex. The shock velocity modification is due to the baroclinicity which, during the interaction between the shock front and the interface, creates a vorticity deposition, responsible for the shock acceleration. Accordingly, an interface, which is plane and perpendicular to the front shock, maximizes the vorticity deposition and increases the velocity gaps between heterogeneous and homogeneous media. We found a correlation between the kinetic energy behind the shock front and the velocities relative difference. We compared our results with two analytical models. However, the system is not closed, so we can't for the moment develop a predictive model. (author) [fr

  3. Energetics of the terrestrial bow shock

    Science.gov (United States)

    Hamrin, Maria; Gunell, Herbert; Norqvist, Patrik

    2017-04-01

    The solar wind is the primary energy source for the magnetospheric energy budget. Energy can enter through the magnetopause both as kinetic energy (plasma entering via e.g. magnetic reconnection and impulsive penetration) and as electromagnetic energy (e.g. by the conversion of solar wind kinetic energy into electromagnetic energy in magnetopause generators). However, energy is extracted from the solar wind already at the bow shock, before it encounters the terrestrial magnetopause. At the bow shock the supersonic solar wind is slowed down and heated, and the region near the bow shock is known to host many complex processes, including the accelerating of particles and the generation of waves. The processes at and near the bow shock can be discussed in terms of energetics: In a generator (load) process kinetic energy is converted to (from) electromagnetic energy. Bow shock regions where the solar wind is decelerated correspond to generators, while regions where particles are energized (accelerated and heated) correspond to loads. Recently, it has been suggested that currents from the bow shock generator should flow across the magnetosheath and connect to the magnetospause current systems [Siebert and Siscoe, 2002; Lopez et al., 2011]. In this study we use data from the Magnetospheric MultiScale (MMS) mission to investigate the energetics of the bow shock and the current closure, and we compare with the MHD simulations of Lopez et al., 2011.

  4. Radiative shocks with electron thermal conduction

    International Nuclear Information System (INIS)

    Borkowski, Kazimierz.

    1988-01-01

    The authors studies the influence of electron thermal conduction on radiative shock structure for both one- and two-temperature plasmas. The dimensionless ratio of the conductive length to the cooling length determines whether or not conduction is important, and shock jump conditions with conduction are established for a collisionless shock front. He obtains approximate solutions with the assumptions that the ionization state of the gas is constant and the cooling rate is a function of temperature alone. In the absence of magnetic fields, these solutions indicate that conduction noticeably influences normal-abundance interstellar shocks with velocities 50-100 km s -1 and dramatically affects metal-dominated shocks over a wide range of shock velocities. Magnetic fields inhibit conduction, but the conductive energy flux and the corresponding decrease in the post-shock electron temperature may still be appreciable. He calculates detailed steady-state radiative shock models in gas composed entirely of oxygen, with the purpose of explaining observations of fast-moving knots in Cas A and other oxygen-rich supernova remnants (SNRs). The O III ion, whose forbidden emission usually dominates the observed spectra, is present over a wide range of shock velocities, from 100 to 170 kms -1 . All models with conduction have extensive warm photoionization zones, which provides better agreement with observed optical (O I) line strengths. However, the temperatures in these zones could be lowered by (Si II) 34.8 μm and (Ne II) 12.8 μm cooling if Si and Ne are present in appreciable abundance relative to O. Such low temperatures would be inconsistent with the observed (O I) emission in oxygen-rich SNRs

  5. Viscosity of Ga-Li liquid alloys

    Science.gov (United States)

    Vidyaev, Dmitriy; Boretsky, Evgeny; Verkhorubov, Dmitriy

    2018-03-01

    The measurement of dynamic viscosity of Ga-Li liquid alloys has been performed using low-frequency vibrational viscometer at five temperatures in the range 313-353 K and four gallium-based dilute alloy compositions containing 0-1.15 at.% Li. It was found that the viscosity of the considered alloys increases with decreasing temperature and increasing lithium concentration in the above ranges. It was shown that dependence of the viscosity of Ga-Li alloys in the investigated temperature range has been described by Arrhenius equation. For this equation the activation energy of viscous flow and pre-exponential factor were calculated. This study helped to determine the conditions of the alkali metals separating process in gallam-exchange systems.

  6. DSMC Computations for Regions of Shock/Shock and Shock/Boundary Layer Interaction

    Science.gov (United States)

    Moss, James N.

    2001-01-01

    This paper presents the results of a numerical study of hypersonic interacting flows at flow conditions that include those for which experiments have been conducted in the Calspan-University of Buffalo Research Center (CUBRC) Large Energy National Shock (LENS) tunnel and the ONERA R5Ch low-density wind tunnel. The computations are made with the direct simulation Monte Carlo (DSMC) method of Bird. The focus is on Mach 9.3 to 11.4 flows about flared axisymmetric configurations, both hollow cylinder flares and double cones. The results presented highlight the sensitivity of the calculations to grid resolution, provide results concerning the conditions for incipient separation, and provide information concerning the flow structure and surface results for the extent of separation, heating, pressure, and skin friction.

  7. Temperature measurements of shock-compressed deuterium

    International Nuclear Information System (INIS)

    Holmes, N.C.; Ross, M.; Nellis, W.J.

    1994-11-01

    The authors measured the temperatures of single and double-shocked D 2 and H 2 up to 85 GPa (0.85 Mbar) and 5,200 K. While single shock temperatures, at pressures to 23 GPa, agree well with previous models, the double shock temperatures are as much as 40% lower than predicted. This is believed to be caused by molecular dissociation, and a new model of the hydrogen EOS at extreme conditions has been developed which correctly predicts their observations. These data and model have important implications for programs which use condensed-phase hydrogen in implosion systems

  8. Recent oil price shock and Tunisian economy

    International Nuclear Information System (INIS)

    Jbir, Rafik; Zouari-Ghorbel, Sonia

    2009-01-01

    The objective of this paper is to study the oil prices-macroeconomy relationship by the analysis of the role of subsidy policy. The vector autoregression (VAR) method was employed to analyze the data over the period 1993 Q1 - 2007 Q3. The results of the model using both linear and non-linear specifications indicate that there is no direct impact of oil price shock on the economic activity. The shock of oil prices affects economic activity indirectly. The most significant channel by which the effects of the shock are transmitted is the government's spending. (author)

  9. Delayed Failure in a Shock Loaded Alumina

    International Nuclear Information System (INIS)

    Cooper, G. A.; Millett, J. C. F.; Bourne, N. K.; Dandekar, D. P.

    2006-01-01

    Manganin stress gauges have been used to measure the lateral stress in a shock-loaded alumina. In combination with known longitudinal stresses, these have been used to determine the shear strength of this material, behind the shock front. The two-step nature of the lateral stress traces shows a slow moving front behind the main shock, behind which shear strength undergoes a significant decrease. Results also show that this front decreases markedly in velocity as the HEL is crossed, suggesting that limited plasticity occurs during inelastic deformation. Finally, comparison of measured shear strengths with other aluminas shows a high degree of agreement

  10. Turbulent energy generated by accelerations and shocks

    International Nuclear Information System (INIS)

    Mikaelian, K.O.

    1986-01-01

    The turbulent energy generated at the interface between two fluids undergoing a constant acceleration or a shock is calculated. Assuming linear density profiles in the mixed region we find E/sub turbulent//E/sub directed/ = 2.3A 2 % (constant acceleration) and 9.3A 2 % (shock), where A is the Atwood number. Diffusion models predict somewhat less turbulent energy and a density profile with a tail extending into the lower density fluid. Eddy sizes are approximately 27% (constant acceleration) and 17% (shock) of the mixing depth into the heavier fluid. 6 refs., 3 figs

  11. THE NEW DETECTIONS OF 7Li/6Li ISOTOPIC RATIO IN THE INTERSTELLAR MEDIA

    International Nuclear Information System (INIS)

    Kawanomoto, S.; Kajino, T.; Aoki, W.; Ando, H.; Noguchi, K.; Tanaka, W.; Bessell, M.; Suzuki, T. K.; Honda, S.; Izumiura, H.; Kambe, E.; Okita, K.; Watanabe, E.; Yoshida, M.; Sadakane, K.; Sato, B.; Tajitsu, A.; Takada-Hidai, M.

    2009-01-01

    We have determined the isotopic abundance ratio of 7 Li/ 6 Li in the interstellar media (ISMs) along lines of sight to HD169454 and HD250290 using the High-Dispersion Spectrograph on the Subaru Telescope. We also observed ζ Oph for comparison with previous data. The observed abundance ratios were 7 Li/ 6 Li = 8.1 +3.6 -1.8 and 6.3 +3.0 -1.7 for HD169454 and HD250290, respectively. These values are in reasonable agreement with those observed previously in the solar neighborhood ISMs within ±2σ error bars and are also consistent with our measurement of 7 Li/ 6 Li = 7.1 +2.9 -1.6 for a cloud along the line of sight to ζ Oph. This is good evidence for homogeneous mixing and instantaneous recycling of the gas component in the Galactic disk. We also discuss several source compositions of 7 Li, Galactic cosmic-ray interactions, stellar nucleosynthesis, and big bang nucleosynthesis.

  12. Electrochemical behaviors of wax-coated Li powder/Li 4Ti 5O 12 cells

    Science.gov (United States)

    Park, Han Eol; Seong, Il Won; Yoon, Woo Young

    The wax-coated Li powder specimen was effectively synthesized using the drop emulsion technique (DET). The wax layer on the powder was verified by SEM, Focused Ion Beam (FIB), EDX and XPS. The porosity of a sintered wax-coated Li electrode was measured by linear sweep voltammetry (LSV) and compared with that of a bare, i.e., un-coated Li electrode. The electrochemical behavior of the wax-coated Li powder anode cell was examined by the impedance analysis and cyclic testing methods. The cyclic behavior of the wax-coated Li powder anode with the Li 4Ti 5O 12 (LTO) cathode cell was examined at a constant current density of 0.35 mA cm -2 with the cut-off voltages of 1.2-2.0 V at 25 °C. Over 90% of the initial capacity of the cell remained even after the 300th cycle. The wax-coated Li powder was confirmed to be a stable anode material.

  13. Annihilation of antiferromagnetic order in LiCoO2 by excess Li

    International Nuclear Information System (INIS)

    Sugiyama, Jun; Ikedo, Yutaka; Nozaki, Hiroshi; Mukai, Kazuhiko; Andreica, Daniel; Amato, Alex; Menetrier, Michel; Carlier, Dany; Delmas, Claude

    2009-01-01

    In order to elucidate the origin of antiferromagnetic (AF) order below 30 K in LiCoO 2 , in which all the Co 3+ ions are in a low-spin state with S=0, the magnetic nature of the Li-excess sample Li 1.04 Co 0.96 O 1.96 was studied by muon-spin spectroscopy in the temperature range between 1.8 and 100 K. Although disordered localized moments appeared below 25 K, static AF order was not detected even at 1.8 K. Moreover, a small amount of excess Li ions (4%) and oxygen vacancies (2%) was found to change ∼50% of the sample into a magnetically disordered phase at 1.8 K. The stoichiometric LiCoO 2 , which was prepared from the same starting materials to those for the Li-excess sample, showed an AF transition at 30 K, while the volume fraction of the AF phase was 10% even at 1.8 K. This therefore excludes the possible role of the excess Li + on the formation of static AF order.

  14. Preparation and Characterisation of LiFePO4/CNT Material for Li-Ion Batteries

    Directory of Open Access Journals (Sweden)

    Rushanah Mohamed

    2011-01-01

    Full Text Available Li-ion battery cathode materials were synthesised via a mechanical activation and thermal treatment process and systematically studied. LiFePO4/CNT composite cathode materials were successfully prepared from LiFePO4 material. The synthesis technique involved growth of carbon nanotubes onto the LiFePO4 using a novel spray pyrolysis-modified CVD technique. The technique yielded LiFePO4/CNT composite cathode material displaying good electrochemical activity. The composite cathode exhibited excellent electrochemical performances with 163 mAh/g discharge capacity with 94% cycle efficiency at a 0.1 C discharge rate in the first cycle, with a capacity fade of approximately 10% after 30 cycles. The results indicate that carbon nanotube addition can enable LiFePO4 to display a higher discharge capacity at a fast rate with high efficiency. The research is of potential interest for the application of carbon nanotubes as a new conducting additive in cathode preparation and for the development of high-power Li-ion batteries for hybrid electric vehicles.

  15. LiFePO4/polymer/natural graphite: low cost Li-ion batteries

    International Nuclear Information System (INIS)

    Zaghib, K.; Striebel, K.; Guerfi, A.; Shim, J.; Armand, M.; Gauthier, M

    2004-01-01

    The aging and performance of natural graphite/PEO-based gel electrolyte/LiFePO 4 cells are reported. The gel polymer electrolytes were produced by electron-beam irradiation and then soaked in a liquid electrolyte. The natural graphite anode in gel electrolyte containing LiBF4-EC/GBL exhibited high reversible capacity (345 mAh/g) and high coulombic efficiency (91%). The LiFePO 4 cathode in the same gel-polymer exhibited a reversible capacity of 160 mAh/g and 93% coulombic efficiency. Better performance was obtained at high-rate discharge with 6% carbon additive in the cathode, however the graphite anode performance suffers at high rate. The Li-ion gel polymer battery shows a capacity fade of 13% after 180 cycles and has poor performance at low temperature due to low diffusion of the lithium to the graphite in the GBL system. The LiFePO 4 /gel/Li system has an excellent rate capacity. LiFePO 4 cathode material is suitable for HEV application

  16. Li14P2O3N6 and Li7PN4: Computational study of two nitrogen rich crystalline LiPON electrolyte materials

    Science.gov (United States)

    Al-Qawasmeh, Ahmad; Holzwarth, N. A. W.

    2017-10-01

    Two lithium oxonitridophosphate materials are computationally examined and found to be promising solid electrolytes for possible use in all solid-state batteries having metallic Li anodes - Li14P2O3N6 and Li7PN4. The first principles simulations are in good agreement with the structural analyses reported in the literature for these materials and the computed total energies indicate that both materials are stable with respect to decomposition into binary and ternary products. The computational results suggest that both materials are likely to form metastable interfaces with Li metal. The simulations also find both materials to have Li ion migration activation energies comparable or smaller than those of related Li ion electrolyte materials. Specifically, for Li7PN4, the experimentally measured activation energy can be explained by the migration of a Li ion vacancy stabilized by a small number of O2- ions substituting for N3- ions. For Li14P2O3N6, the activation energy for Li ion migration has not yet been experimentally measured, but simulations predict it to be smaller than that measured for Li7PN4.

  17. NASA Goddards LiDAR, Hyperspectral and Thermal (G-LiHT) Airborne Imager

    Science.gov (United States)

    Cook, Bruce D.; Corp, Lawrence A.; Nelson, Ross F.; Middleton, Elizabeth M.; Morton, Douglas C.; McCorkel, Joel T.; Masek, Jeffrey G.; Ranson, Kenneth J.; Ly, Vuong; Montesano, Paul M.

    2013-01-01

    The combination of LiDAR and optical remotely sensed data provides unique information about ecosystem structure and function. Here, we describe the development, validation and application of a new airborne system that integrates commercial off the shelf LiDAR hyperspectral and thermal components in a compact, lightweight and portable system. Goddard's LiDAR, Hyperspectral and Thermal (G-LiHT) airborne imager is a unique system that permits simultaneous measurements of vegetation structure, foliar spectra and surface temperatures at very high spatial resolution (approximately 1 m) on a wide range of airborne platforms. The complementary nature of LiDAR, optical and thermal data provide an analytical framework for the development of new algorithms to map plant species composition, plant functional types, biodiversity, biomass and carbon stocks, and plant growth. In addition, G-LiHT data enhance our ability to validate data from existing satellite missions and support NASA Earth Science research. G-LiHT's data processing and distribution system is designed to give scientists open access to both low- and high-level data products (http://gliht.gsfc.nasa.gov), which will stimulate the community development of synergistic data fusion algorithms. G-LiHT has been used to collect more than 6,500 km2 of data for NASA-sponsored studies across a broad range of ecoregions in the USA and Mexico. In this paper, we document G-LiHT design considerations, physical specifications, instrument performance and calibration and acquisition parameters. In addition, we describe the data processing system and higher-level data products that are freely distributed under NASA's Data and Information policy.

  18. Complex Urban LiDAR Data Set

    OpenAIRE

    Jeong, Jinyong; Cho, Younggun; Shin, Young-Sik; Roh, Hyunchul; Kim, Ayoung

    2018-01-01

    This paper presents a Light Detection and Ranging (LiDAR) data set that targets complex urban environments. Urban environments with high-rise buildings and congested traffic pose a significant challenge for many robotics applications. The presented data set is unique in the sense it is able to capture the genuine features of an urban environment (e.g. metropolitan areas, large building complexes and underground parking lots). Data of two-dimensional (2D) and threedimensional (3D) LiDAR, which...

  19. The LiC detector toy program

    International Nuclear Information System (INIS)

    Regler, Meinhard; Valentan, Manfred; Fruehwirth, Rudolf

    2007-01-01

    This note describes the 'LiC Detector Toy' ('LiC' for Linear Collider) software tool which has been developed for detector design studies, aiming at investigating the resolution of reconstructed track parameters for the purpose of comparing and optimizing various detector setups. It consists of a simplified simulation of the detector measurements, taking into account multiple scattering, followed by full single track reconstruction using the Kalman filter. The tool is written in MATLAB and may be installed on a laptop. It can easily be used as a black-box tool by non-experts, but also adapted to individual needs

  20. Achromatic Cooling Channel with Li Lenses

    Energy Technology Data Exchange (ETDEWEB)

    Balbekov, V. [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States)

    2002-04-29

    A linear cooling channel with Li lenses, solenoids, and 201 MHz RF cavities is considered. A special lattice design is used to minimize chromatic aberrations by suppression of several betatron resonances. Transverse emittance of muon beam decreases from 2 mm to 0.5 mm at the channel of about 110 m length. Longitudinal heating is modest, therefore transmission of the channel is rather high: 96% without decay and 90% with decay. Minimal beam emittance achievable by similar channel estimated as about 0.25 mm at surface field of Li lenses 10 T.

  1. Si(Li) X-ray detector

    International Nuclear Information System (INIS)

    Yuan Xianglin; Li Zhiyong; Hong Xiuse

    1990-08-01

    The fabrication technology of the 10∼80 mm 2 Si(Li) X-ray detectors are described and some problems concerning technology and measurement are discussed. The specifications of the detectors are shown as well. The Si(Li) X-ray detector is a kind of low energy X-ray detectors. Owing to very high energy resolution, fine linearity and high detection efficiency in the range of low energy X-rays, it is widely used in the fields of nuclear physics, medicine, geology and environmental protection, etc,. It is also a kernel component for the scanning electron microscope and X-ray fluorescence analysis systems

  2. Underwater electrical wire explosion: Shock wave from melting being overtaken by shock wave from vaporization

    Science.gov (United States)

    Li, Liuxia; Qian, Dun; Zou, Xiaobing; Wang, Xinxin

    2018-05-01

    The shock waves generated by an underwater electrical wire explosion were investigated. A microsecond time-scale pulsed current source was used to trigger the electrical explosion of copper wires with a length of 5 cm and a diameter of 200 μm. The energy-storage capacitor was charged to a relatively low energy so that the energy deposited onto the wire was not large enough to fully vaporize the whole wire. Two shock waves were recorded with a piezoelectric gauge that was located at a position of 100 mm from the exploding wire. The first and weak shock wave was confirmed to be the contribution from wire melting, while the second and stronger shock wave was the contribution from wire vaporization. The phenomenon whereby the first shock wave generated by melting being overtaken by the shock wave due to vaporization was observed.

  3. Multiple spacecraft observations of interplanetary shocks Four spacecraft determination of shock normals

    Science.gov (United States)

    Russell, C. T.; Mellott, M. M.; Smith, E. J.; King, J. H.

    1983-01-01

    ISEE 1, 2, 3, IMP 8, and Prognoz 7 observations of interplanetary shocks in 1978 and 1979 provide five instances where a single shock is observed by four spacecraft. These observations are used to determine best-fit normals for these five shocks. In addition to providing well-documented shocks for future investigations these data allow the evaluation of the accuracy of several shock normal determination techniques. When the angle between upstream and downstream magnetic field is greater than 20 deg, magnetic coplanarity can be an accurate single spacecraft method. However, no technique based solely on the magnetic measurements at one or multiple sites was universally accurate. Thus, the use of overdetermined shock normal solutions, utilizing plasma measurements, separation vectors, and time delays together with magnetic constraints, is recommended whenever possible.

  4. Study of the 6Li(p,π+)7Li reaction at 600 MeV

    International Nuclear Information System (INIS)

    Bauer, T.; Beurtey, R.; Boudard, A.; Bruge, G.; Chaumeaux, A.; Couvert, P.; Duhm, H.H.; Garreta, D.; Matoba, M.; Terrein, Y.; Aslanides, E.; Bertini, R.; Brochard, F.; Gorodetzky, Ph.; Hibou, F.; Bimbot, L.; Le Bornec, Y.; Tatischeff, B.; Dillig, M.

    1977-01-01

    The positive pion production through the 6 Li(p,π + ) reaction at 600 MeV has been studied using the high-resolution magnetic spectrometer SPES I. Differential cross sections have been measured from 5 0 to 35 0 sub(lab). The 6 Li(p,π + ) reaction feeds preferentially the 4.63 MeV 7/2 - level of 7 Li. The results of a calculation based on two- and three-nucleon diagrams with π and rho exchange between the projectile and a bound nucleon are also presented. (Auth.)

  5. The optical potential for 6Li-6Li elastic scattering at 156 MeV

    International Nuclear Information System (INIS)

    Micek, S.; Majka, Z.; Klewe-Nebenius, H.; Rebel, H.; Gils, H.J.

    1984-10-01

    Elastic scattering of 6 Li from 6 Li has been studied for the beam energy of 156 MeV. The experimental differential cross section has been analysed on the basis of the optical model using various phenomenological forms. The spin-orbit interaction proves to be less significant. A semi-microscopic double-folding cluster model which generates the real part of the optical potential by an antisymmetrized d-α cluster wave function of 6 Li and α-α, d-d and d-α interactions is well able to describe the experimental data. (orig.) [de

  6. The sup 8 Li(n,. gamma. ) sup 9 Li reaction and primordial nucleosynthesis

    Energy Technology Data Exchange (ETDEWEB)

    Mao, Z Q; Champagne, A E [Princeton Univ., NJ (USA). Dept. of Physics

    1991-01-01

    Shell-model calculations, using both p-shell and spd-shell interactions, have been used to predict the spectroscopic properties of low-lying states in {sup 9}Li. From this information, we have obtained new estimates for the rate of the {sup 8}Li(n,{gamma}){sup 9}Li reaction, which may act to limit the production of heavy elements during an inhomogeneous big bang. The two calculations produce reaction rates which differ by about a factor of 2 at the temperatures of interest, demonstrating the uncertainties in this approach. However, the spd calculation appears to be the more reliable of the two. (orig.).

  7. Role of dopants in LiF:Mg,Cu, LiF:Mg,P and LiF:Mg,Cu,P detectors

    International Nuclear Information System (INIS)

    Mohammadi, Kh.; Moussavi Zarandi, A.; Afarideh, H.; Shahmaleki, S.

    2013-01-01

    In this study, electronic structure of LiF crystal doped with Mg,Cu,P impurities was studied with WIEN2k code on the basis of FPLAPW+lo method. Results show that in Mg-doped LiF composition, an electronic trap was created with impurity concentration of 1.56% and 3.125%. In this condition, the electronic trap with increasing the percentage of the impurities up to 4.687% is annihilated. It was found, that by doping of Mg and Cu or P simultaneously, a hole-trap is created in valence band. It was realized that in LiF:Mg,Cu, LiF:Mg,P and LiF:Mg,Cu,P, Cu impurity and Li atom, have a key role in creation of levels which lead to create electronic and hole traps. Mg impurity and F atom, only have a role in creation of electronic traps. In addition, P impurity has a main role in creation of the electronic and hole traps in LiF:Mg,Cu,P. The activation energy of electronic and hole trap in LiF:Mg,Cu, LiF:Mg,P and LiF:Mg,Cu,P crystalline lattice were obtained as 0.3 and 5.5 eV, 0.92 and 3.4 eV and 0.75 and 3.1 eV, respectively. - Graphical abstract: Figure (a) and (b) shows changes in electronic structure and band gap energy of LiF crystal due to presence of Mg and Cu, Mg and P ions respectively. - Highlights: • Electronic structure of LiF, LiF:Mg,Cu, LiF:Mg,P and LiF:Mg,Cu,P materials were studied with WIEN2K code. • In LiF:Mg,Cu and LiF:Mg,Cu,P, Li atom and Cu impurity have a key role in creation of levels. • F atom and Mg impurity only have a role in creation of electronic traps. • In LiF:Mg,Cu,P, P impurity has a main role in creation of electronic and hole traps

  8. Reliability assessment of competing risks with generalized mixed shock models

    International Nuclear Information System (INIS)

    Rafiee, Koosha; Feng, Qianmei; Coit, David W.

    2017-01-01

    This paper investigates reliability modeling for systems subject to dependent competing risks considering the impact from a new generalized mixed shock model. Two dependent competing risks are soft failure due to a degradation process, and hard failure due to random shocks. The shock process contains fatal shocks that can cause hard failure instantaneously, and nonfatal shocks that impact the system in three different ways: 1) damaging the unit by immediately increasing the degradation level, 2) speeding up the deterioration by accelerating the degradation rate, and 3) weakening the unit strength by reducing the hard failure threshold. While the first impact from nonfatal shocks comes from each individual shock, the other two impacts are realized when the condition for a new generalized mixed shock model is satisfied. Unlike most existing mixed shock models that consider a combination of two shock patterns, our new generalized mixed shock model includes three classic shock patterns. According to the proposed generalized mixed shock model, the degradation rate and the hard failure threshold can simultaneously shift multiple times, whenever the condition for one of these three shock patterns is satisfied. An example using micro-electro-mechanical systems devices illustrates the effectiveness of the proposed approach with sensitivity analysis. - Highlights: • A rich reliability model for systems subject to dependent failures is proposed. • The degradation rate and the hard failure threshold can shift simultaneously. • The shift is triggered by a new generalized mixed shock model. • The shift can occur multiple times under the generalized mixed shock model.

  9. Research on feature extraction techniques of Hainan Li brocade pattern

    Science.gov (United States)

    Zhou, Yuping; Chen, Fuqiang; Zhou, Yuhua

    2016-03-01

    Hainan Li brocade skills has been listed as world non-material cultural heritage preservation, therefore, the research on Hainan Li brocade patterns plays an important role in Li brocade culture inheritance. The meaning of Li brocade patterns was analyzed and the shape feature extraction techniques to original Li brocade patterns were advanced in this paper, based on the contour tracking algorithm. First, edge detection was made on the design patterns, and then the morphological closing operation was used to smooth the image, and finally contour tracking was used to extract the outer contours of Li brocade patterns. The extracted contour features were processed by means of morphology, and digital characteristics of contours are obtained by invariant moments. At last, different patterns of Li brocade design are briefly analyzed according to the digital characteristics. The results showed that the pattern extraction method to Li brocade pattern shapes is feasible and effective according to above method.

  10. Li Isotope Studies of Olivine in Mantle Xenoliths by SIMS

    Science.gov (United States)

    Bell, D. R.; Hervig, R. L.; Buseck, P. R.

    2005-01-01

    Variations in the ratio of the stable isotopes of Li are a potentially powerful tracer of processes in planetary and nebular environments [1]. Large differences in the 7Li/6Li ratio between the terrestrial upper mantle and various crustal materials make Li isotope composition a potentially powerful tracer of crustal recycling processes on Earth [2]. Recent SIMS studies of terrestrial mantle and Martian meteorite samples report intra-mineral Li isotope zoning [3-5]. Substantial Li isotope heterogeneity also exists within and between the components of chondritic meteorites [6,7]. Experimental studies of Li diffusion suggest the potential for rapid isotope exchange at elevated temperatures [8]. Large variations in 7Li, exceeding the range of unaltered basalts, occur in terrestrial mantle-derived xenoliths from individual localities [9]. The origins of these variations are not fully understood.

  11. A New Li Anode Technology for Improved Performance, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Lithium (Li) metal-based rechargeable batteries have many advantages over Li-ion systems including significantly higher energy density, lower cost, and the option of...

  12. LiDAR data for the Delta Area of California

    Data.gov (United States)

    California Natural Resource Agency — LiDAR data for the Delta Area of California from the California Department of Water Resources. Bare earth grids from LiDAR.This data is in ESRI Grid format with 2...

  13. Tallinnasse kogunesid üliõpilasliidrid üle Euroopa

    Index Scriptorium Estoniae

    2011-01-01

    Euroopa Üliõpilasliit korraldas Tallinnas 2.-5. mail konverentsi „Financing of higher education - financing the students future”, kus osalesid 120 üliõpilasesindajat 40-st riigist üle Euroopa

  14. Charge carrier density in Li-intercalated graphene

    KAUST Repository

    Kaloni, Thaneshwor P.

    2012-05-01

    The electronic structures of bulk C 6Li, Li-intercalated free-standing bilayer graphene, and Li-intercalated bilayer and trilayer graphene on SiC(0 0 0 1) are studied using density functional theory. Our estimate of Young\\'s modulus suggests that Li-intercalation increases the intrinsic stiffness. For decreasing Li-C interaction, the Dirac point shifts to the Fermi level and the associated band splitting vanishes. For Li-intercalated bilayer graphene on SiC(0 0 0 1) the splitting at the Dirac point is tiny. It is also very small at the two Dirac points of Li-intercalated trilayer graphene on SiC(0 0 0 1). For all the systems under study, a large enhancement of the charge carrier density is achieved by Li intercalation. © 2012 Elsevier B.V. All rights reserved.

  15. Diffusion of Li+ ion on graphene: A DFT study

    International Nuclear Information System (INIS)

    Zheng Jiming; Ren Zhaoyu; Guo Ping; Fang Li; Fan Jun

    2011-01-01

    Density functional theory investigations show that the Li + ion is stabilized at Center of hexagonal carbon ring with the distance of 1.84 Å from graphene surface. The potential barrier of Li + ion diffusion on the graphene surface, about 0.32 eV, is much lower than that of Li + ion penetrating the carbon ring which is 10.68 eV. When a vacancy of graphene exists, potential barrier about 10.25 eV for Li + ion penetrating the defect is still high, and the ability of the vacancy to sizing the Li + ion is also observed. Electronic densities of states show that the formation of a localized bond between Li atom and edge carbon of vacancy is the main reason for high potential barrier when Li + ion penetrate a vacancy. While Coulomb repulsion is the control factor for high potential barrier in case of Li + ion penetrating a carbon ring.

  16. New Li Battery Chemistry for Improved Performance, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — Current state-of-the-art Lithium (Li) or Li-ion systems are unable to meet the performance goals of space-rated rechargeable batteries for many NASA's future robotic...

  17. Li2 NH-LiBH4 : a Complex Hydride with Near Ambient Hydrogen Adsorption and Fast Lithium Ion Conduction.

    Science.gov (United States)

    Wang, Han; Cao, Hujun; Zhang, Weijin; Chen, Jian; Wu, Hui; Pistidda, Claudio; Ju, Xiaohua; Zhou, Wei; Wu, Guotao; Etter, Martin; Klassen, Thomas; Dornheim, Martin; Chen, Ping

    2018-01-26

    Complex hydrides have played important roles in energy storage area. Here a complex hydride made of Li 2 NH and LiBH 4 was synthesized, which has a structure tentatively indexed using an orthorhombic cell with a space group of Pna2 1 and lattice parameters of a=10.121, b=6.997, and c=11.457 Å. The Li 2 NH-LiBH 4 sample (in a molar ratio of 1:1) shows excellent hydrogenation kinetics, starting to absorb H 2 at 310 K, which is more than 100 K lower than that of pristine Li 2 NH. Furthermore, the Li + ion conductivity of the Li 2 NH-LiBH 4 sample is about 1.0×10 -5  S cm -1 at room temperature, and is higher than that of either Li 2 NH or LiBH 4 at 373 K. Those unique properties of the Li 2 NH-LiBH 4 complex render it a promising candidate for hydrogen storage and Li ion conduction. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Atomic simulations for configurations and solid-liquid interface of Li-Fe and Li-Cu icosahedra

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jianyu, E-mail: hnieyjy@aliyun.com [Hunan Institute of Engineering (China); Hu, Wangyu [Hunan University, College of Materials Science and Engineering (China); Dai, Xiongying [Hunan Institute of Engineering, College of Science (China)

    2017-04-15

    The melting point of Li is lower than that of Fe (or Cu); thus, solid-liquid interfaces can be easily formed on Li-Fe and Li-Cu nanoalloys. In this work, the configurations and solid-liquid interfaces of Li-Fe and Li-Cu icosahedra are studied using Monte Carlo and molecular dynamics methods. The atomic interactions are described by the analytic embedded-atom method. The dependence of composition, temperature, and nanoparticle size on the configurations and thermal stabilities of nanoalloys is discussed. The behavior of the Li-Fe and Li-Cu nanoalloys in segregation, configuration, and thermal stability is investigated. A different behavior of surface segregation of Li atoms is observed for the two types of nanoalloys. The interface between the Li and Fe atoms is clear. Mixing of Li with Cu at larger nanoparticle sizes is found because of low heat of formation in the system. The configurations of the Li-Fe and Li-Cu nanoalloys are related to the competition between surface segregation and alloying. The thermal stability of Li in the two types of nanoalloys is enhanced by the support of the Fe (or Cu) solid substrate.

  19. Low-Intensity Extracorporeal Shock Wave Therapy Enhances Brain-Derived Neurotrophic Factor Expression through PERK/ATF4 Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Bohan Wang

    2017-02-01

    Full Text Available Low-intensity extracorporeal shock wave therapy (Li-ESWT is used in the treatment of erectile dysfunction, but its mechanisms are not well understood. Previously, we found that Li-ESWT increased the expression of brain-derived neurotrophic factor (BDNF. Here we assessed the underlying signaling pathways in Schwann cells in vitro and in penis tissue in vivo after nerve injury. The result indicated that BDNF were significantly increased by the Li-ESWT after nerve injury, as well as the expression of BDNF in Schwann cells (SCs, RT4-D6P2T in vitro. Li-ESWT activated the protein kinase RNA-like endoplasmic reticulum (ER kinase (PERK pathway by increasing the phosphorylation levels of PERK and eukaryotic initiation factor 2a (eIF2α, and enhanced activating transcription factor 4 (ATF4 in an energy-dependent manner. In addition, GSK2656157—an inhibitor of PERK—effectively inhibited the effect of Li-ESWT on the phosphorylation of PERK, eIF2α, and the expression of ATF4. Furthermore, silencing ATF4 dramatically attenuated the effect of Li-ESWT on the expression of BDNF, but had no effect on hypoxia-inducible factor (HIF1α or glial cell-derived neurotrophic factor (GDNF in Schwann cells. In conclusion, our findings shed new light on the underlying mechanisms by which Li-ESWT may stimulate the expression of BDNF through activation of PERK/ATF4 signaling pathway. This information may help to refine the use of Li-ESWT to further improve its clinical efficacy.

  20. A novel dual-salts of LiTFSI and LiODFB in LiFePO4-based batteries for suppressing aluminum corrosion and improving cycling stability

    Science.gov (United States)

    Li, Faqiang; Gong, Yan; Jia, Guofeng; Wang, Qinglei; Peng, Zhengjun; Fan, Wei; Bai, Bing

    2015-11-01

    The strong corrosion behavior at the Al current collector restricts the application range of lithium bis (trifluoromethanesulfonylimide) (LiTFSI), despite its high stability against water and thermal. SEM, LSV and Tafel curves proved that adding LiODFB into LiTFSI-based electrolytes could suppress aluminum corrosion caused by LiTFSI-based electrolytes. The cycling stability and rate capability of LiFePO4-based batteries using LiTFSI0.6-LiODFB0.4-based electrolytes is excellent as compared to LiFePO4-based batteries using LiPF6-based electrolytes.

  1. Shock wave physics group (M-6)

    International Nuclear Information System (INIS)

    Morris, C.E.

    1981-01-01

    Experimental facilities and activities of the shock wave physics group at LASL are described. The facilities include a compressed gas gun, two-stage gas gun, high explosive facilities, and a pulsed megagauss field facility

  2. Integrated microelectromechanical gyroscope under shock loads

    Science.gov (United States)

    Nesterenko, T. G.; Koleda, A. N.; Barbin, E. S.

    2018-01-01

    The paper presents a new design of a shock-proof two-axis microelectromechanical gyroscope. Without stoppers, the shock load enables the interaction between the silicon sensor elements. Stoppers were installed in the gyroscope to prevent the contact interaction between electrodes and spring elements with fixed part of the sensor. The contact of stoppers occurs along the plane, thereby preventing the system from serious contact stresses. The shock resistance of the gyroscope is improved by the increase in its eigenfrequency at which the contact interaction does not occur. It is shown that the shock load directed along one axis does not virtually cause the movement of sensing elements along the crosswise axes. Maximum stresses observed in the proposed gyroscope at any loading direction do not exceed the value allowable for silicon.

  3. Tribology Aspect of Rubber Shock Absorbers Development

    Directory of Open Access Journals (Sweden)

    M. Banić

    2013-09-01

    Full Text Available Rubber is a very flexible material with many desirable properties Which enable its broad use in engineering practice. Rubber or rubber-metal springs are widely used as anti-vibration or anti-shock components in technical systems. Rubber-metal springs are usually realized as a bonded assembly, however especially in shock absorbers, it is possible to realize free contacts between rubber and metal parts. In previous research it authors was observed that friction between rubber and metal in such case have a significant influence on the damping characteristics of shock absorber. This paper analyzes the development process of rubber or rubber-metal shock absorbers realized free contacts between the constitutive parts, starting from the design, construction, testing and operation, with special emphasis on the development of rubber-metal springs for the buffing and draw gear of railway vehicles.

  4. Role of drifts in diffusive shock acceleration

    International Nuclear Information System (INIS)

    Decker, R.B.

    1988-01-01

    The role played by shock-associated drifts during the diffusive acceleration of charged particles at collisionless MHD shocks is evaluated. In the rest frame of the shock, the total energy gained by a particle is shown to result from two coupled acceleration mechanisms, the usual first-order Fermi mechanism and the drift mechanism. When averaged over a distribution of particles, the ratio of the drift-associated energy gain to the total energy is found to be independent of the total energy at a given theta1 (the angle between the shock normal and the unperturbed upstream magnetic field) in agreement with theoretical predictions. No evidence is found for drift-associated deceleration, suggesting that drifts always augment acceleration. 35 references

  5. Shock Thermodynamic Applied Research Facility (STAR)

    Data.gov (United States)

    Federal Laboratory Consortium — The STAR facility, within Sandia's Solid Dynamic Physics Department, is one of a few institutions in the world with a major shock-physics program. This is the only...

  6. Nonequilibrium recombination after a curved shock wave

    Science.gov (United States)

    Wen, Chihyung; Hornung, Hans

    2010-02-01

    The effect of nonequilibrium recombination after a curved two-dimensional shock wave in a hypervelocity dissociating flow of an inviscid Lighthill-Freeman gas is considered. An analytical solution is obtained with the effective shock values derived by Hornung (1976) [5] and the assumption that the flow is ‘quasi-frozen’ after a thin dissociating layer near the shock. The solution gives the expression of dissociation fraction as a function of temperature on a streamline. A rule of thumb can then be provided to check the validity of binary scaling for experimental conditions and a tool to determine the limiting streamline that delineates the validity zone of binary scaling. The effects on the nonequilibrium chemical reaction of the large difference in free stream temperature between free-piston shock tunnel and equivalent flight conditions are discussed. Numerical examples are presented and the results are compared with solutions obtained with two-dimensional Euler equations using the code of Candler (1988) [10].

  7. Critical point anomalies include expansion shock waves

    Energy Technology Data Exchange (ETDEWEB)

    Nannan, N. R., E-mail: ryan.nannan@uvs.edu [Mechanical Engineering Discipline, Anton de Kom University of Suriname, Leysweg 86, PO Box 9212, Paramaribo, Suriname and Process and Energy Department, Delft University of Technology, Leeghwaterstraat 44, 2628 CA Delft (Netherlands); Guardone, A., E-mail: alberto.guardone@polimi.it [Department of Aerospace Science and Technology, Politecnico di Milano, Via La Masa 34, 20156 Milano (Italy); Colonna, P., E-mail: p.colonna@tudelft.nl [Propulsion and Power, Delft University of Technology, Kluyverweg 1, 2629 HS Delft (Netherlands)

    2014-02-15

    From first-principle fluid dynamics, complemented by a rigorous state equation accounting for critical anomalies, we discovered that expansion shock waves may occur in the vicinity of the liquid-vapor critical point in the two-phase region. Due to universality of near-critical thermodynamics, the result is valid for any common pure fluid in which molecular interactions are only short-range, namely, for so-called 3-dimensional Ising-like systems, and under the assumption of thermodynamic equilibrium. In addition to rarefaction shock waves, diverse non-classical effects are admissible, including composite compressive shock-fan-shock waves, due to the change of sign of the fundamental derivative of gasdynamics.

  8. Shock Wave Science and Technology Reference Library

    CERN Document Server

    2007-01-01

    Shock waves in multiphase flows refers to a rich variety of phenomena of interest to physicists, chemists, and fluid dynamicists, as well as mechanical, biomedical and aeronautical engineers. This volume treats shock and expansion waves in (bullet) complex, bubbly liquids (L van Wijngaarden, Y Tomita, V Kedrinskii) and (bullet) cryogenic liquids (M Murakami) and examines the relationship of shock waves with (bullet) phase transitions (A Guha, CF Delale, G Schnerr, MEH van Dongen) (bullet) induced phase transitions (GEA Meier) as well as their interaction with (bullet) solid foams, textiles, porous and granular media (B Skews, DMJ Smeulders, MEH van Dongen, V Golub, O Mirova) All chapters are self-contained, so they can be read independently, although they are of course thematically interrelated. Taken together, they offer a timely reference on shock waves in multiphase flows, including new viewpoints and burgeoning developments. The book will appeal to beginners as well as professional scientists and engineer...

  9. Comments on ''Analysis of spherical imploding shocks''

    International Nuclear Information System (INIS)

    Lazarus, R.B.

    1980-01-01

    It is asserted that Fujimoto and Mishkin's article is incorrect in its claim for a pressure extremum at or behind the shock for all values of γ and in its claim for an analytical form for the similarity exponent

  10. Shock-induced modification of inorganic powders

    International Nuclear Information System (INIS)

    Graham, R.A.; Morosin, B.; Venturini, E.L.; Beauchamp, E.K.; Hammetter, W.F.

    1984-01-01

    The results of studies performed to quantify the characteristics of TiO2, ZrO2 and Si3N4 powders exposed to explosive loading and post-shock analysis are reported. The shocks were produced with plane wave generators and explosive pads impinging on steel disks, a copper recovery fixture, and then the samples. Peak pressures of 13 and 17 GPa were attained, along with 40 GPz at the center of the powder cavity. Data are provided on the changes occurring during the explosive densification and X-ray and paramagnetic studies of the products. Only fractured disks were obtained in the trials. The shock-treated materials were more free flowing than the original powders, which were fluffy. Post-shock annealing was a significant feature of the treated powders

  11. SPECIAL PURPOSE SHOCK TUBE for BLAST ASSESSMENT

    Data.gov (United States)

    Federal Laboratory Consortium — This device is a specially designed shock tube for testing fabric samples in a controlled environment. The device determines the appropriate types of sensors to be...

  12. Collisions on relativistic nuclei: shock waves

    International Nuclear Information System (INIS)

    Gudima, K.K.; Toneev, V.D.

    1976-01-01

    Experiments are analysed which indicate the possible generation of shock waves in collisions of two nuclei. Another interpretation of these data is proposed and the concerned new experiments are discussed

  13. Analysis of Z Pinch Shock Wave Experiments

    International Nuclear Information System (INIS)

    Asay, James; Budge, Kent G.; Chandler, Gordon; Fleming, Kevin; Hall, Clint; Holland, Kathleen; Konrad, Carl; Lawrence, Jeffery; Trott, Wayne; Trucano, Timothy

    1999-01-01

    In this paper, we report details of our computational study of two shock wave physics experiments performed on the Sandia Z machine in 1998. The novelty of these particular experiments is that they represent the first successful application of VISAR interferometry to diagnose shock waves generated in experimental payloads by the primary X-ray pulse of the machine. We use the Sandia shock-wave physics code ALEGRA to perform the simulations reported in this study. Our simulations are found to be in fair agreement with the time-resolved VISAR experimental data. However, there are also interesting and important discrepancies. We speculate as to future use of time-resolved shock wave data to diagnose details of the Z machine X-ray pulse in the future

  14. Shock Tube Measurements for Liquid Fuels Combustion

    National Research Council Canada - National Science Library

    Hanson, Ronald K

    2006-01-01

    ...) fundamental studies of fuel spray evaporation rates and ignition times of low-vapor pressure fuels such as JP-8, diesel fuel and normal alkane surrogates in a new aerosol shock tube using state...

  15. Condensed matter at high shock pressures

    Energy Technology Data Exchange (ETDEWEB)

    Nellis, W.J.; Holmes, N.C.; Mitchell, A.C.; Radousky, H.B.; Hamilton, D.

    1985-07-12

    Experimental techniques are described for shock waves in liquids: Hugoniot equation-of-state, shock temperature and emission spectroscopy, electrical conductivity, and Raman spectroscopy. Experimental data are reviewed and presented in terms of phenomena that occur at high densities and temperatures in shocked He, Ar, N/sub 2/, CO, SiO/sub 2/-aerogel, H/sub 2/O, and C/sub 6/H/sub 6/. The superconducting properties of Nb metal shocked to 100 GPa (1 Mbar) and recovered intact are discussed in terms of prospects for synthesizing novel, metastable materials. Ultrahigh pressure data for Cu is reviewed in the range 0.3 to 6TPa (3 to 60 Mbar). 56 refs., 9 figs., 1 tab.

  16. Shock wave science and technology reference library

    CERN Document Server

    2009-01-01

    This book, as a volume of the Shock Wave Science and Technology Reference Library, is primarily concerned with detonation waves or compression shock waves in reactive heterogeneous media, including mixtures of solid, liquid and gas phases. The topics involve a variety of energy release and control processes in such media - a contemporary research field that has found wide applications in propulsion and power, hazard prevention as well as military engineering. The six extensive chapters contained in this volume are: - Spray Detonation (SB Murray and PA Thibault) - Detonation of Gas-Particle Flow (F Zhang) - Slurry Detonation (DL Frost and F Zhang) - Detonation of Metalized Composite Explosives (MF Gogulya and MA Brazhnikov) - Shock-Induced Solid-Solid Reactions and Detonations (YA Gordopolov, SS Batsanov, and VS Trofimov) - Shock Ignition of Particles (SM Frolov and AV Fedorov) Each chapter is self-contained and can be read independently of the others, though, they are thematically interrelated. They offer a t...

  17. Comparative review of bow shocks and magnetopauses

    International Nuclear Information System (INIS)

    Lepping, R.P.

    1984-04-01

    Bow shock and magnetopauses formation is discussed. Plasma and magnetic field environments of all the planets from Mercury to Saturn were measured. It was found that all the planets have bow shocks and almost all have a magnetopause. Venus is the only planet with no measurable intrinsic magnetic field and the solar wind interacts directly with Venus ionosphere. The bow shock characteristics depend on the changing solar wind conditions. The shape of a magnetopause or any obstacle to flow depends on the three dimensional pressure profile that it presents to the solar wind. Jupiter is unusual because of the considerable amount of plasma which is contained in its magnetosphere. Magentopause boundaries in ecliptic plane projection are modelled by segments of ellipses, matched to straight lines for the magnetotool boundaries or parabolas. Specific properties of known planetary bow shocks and magnetopauses are reviewed

  18. Medical and biomedical applications of shock waves

    CERN Document Server

    Loske, Achim M

    2017-01-01

    This book provides current, comprehensive, and clear explanations of the physics behind medical and biomedical applications of shock waves. Extracorporeal shock wave lithotripsy is one of the greatest medical advances of our time, and its techniques and clinical devices are continuously evolving. Further research continues to improve the understanding of calculi fragmentation and tissue-damaging mechanisms. Shock waves are also used in orthopedics and traumatology. Possible applications in oncology, cardiology, dentistry, gene therapy, cell transfection, transformation of fungi and bacteria, as well as the inactivation of microorganisms are promising approaches for clinical treatment, industrial applications and research. Medical and Biomedical Applications of Shock Waves is useful as a guide for students, technicians and researchers working in universities and laboratories. Chemists, biologists, physicians and veterinarians, involved in research or clinical practice will find useful advice, but also engineer...

  19. Relative locations of the bow shocks of the terrestrial planets

    International Nuclear Information System (INIS)

    Russell, C.T.

    1977-01-01

    The observed bow shock encounters at Mercury, Venus and Mars are least square fit using the same technique so that their sizes and shapes can be intercompared. The shock front of Mercury most resembles the terrestrial shock in shape, and the shock stand off distance is consistent with the observed moment. The shapes of the Venus and Mars shock fronts more resemble each other than the earth's and the stand off distances are consistent with direct interaction of the solar wind with the ionosphere on the dayside. The Venus shock is closer to the planet than the Mars shock suggesting more absorption of the solar wind at Venus

  20. Orientation Dependence in Molecular Dynamics Simulations of Shocked Single Crystals

    International Nuclear Information System (INIS)

    Germann, Timothy C.; Holian, Brad Lee; Lomdahl, Peter S.; Ravelo, Ramon

    2000-01-01

    We use multimillion-atom molecular dynamics simulations to study shock wave propagation in fcc crystals. As shown recently, shock waves along the direction form intersecting stacking faults by slippage along {111} close-packed planes at sufficiently high shock strengths. We find even more interesting behavior of shocks propagating in other low-index directions: for the case, an elastic precursor separates the shock front from the slipped (plastic) region. Shock waves along the direction generate a leading solitary wave train, followed (at sufficiently high shock speeds) by an elastic precursor, and then a region of complex plastic deformation. (c) 2000 The American Physical Society

  1. THE EFFECTS OF AREA CONTRACTION ON SHOCK WAVE STRENGTH AND PEAK PRESSURE IN SHOCK TUBE

    Directory of Open Access Journals (Sweden)

    A. M. Mohsen

    2012-06-01

    Full Text Available This paper presents an experimental investigation into the effects of area contraction on shock wave strength and peak pressure in a shock tube. The shock tube is an important component of the short duration, high speed fluid flow test facility, available at the Universiti Tenaga Nasional (UNITEN, Malaysia. The area contraction was facilitated by positioning a bush adjacent to the primary diaphragm section, which separates the driver and driven sections. Experimental measurements were performed with and without the presence of the bush, at various diaphragm pressure ratios, which is the ratio of air pressure between the driver (high pressure and driven (low pressure sections. The instantaneous static pressure variations were measured at two locations close to the driven tube end wall, using high sensitivity pressure sensors, which allow the shock wave strength, shock wave speed and peak pressure to be analysed. The results reveal that the area contraction significantly reduces the shock wave strength, shock wave speed and peak pressure. At a diaphragm pressure ratio of 10, the shock wave strength decreases by 18%, the peak pressure decreases by 30% and the shock wave speed decreases by 8%.

  2. Volume production of Li- in a multicusp ion source

    International Nuclear Information System (INIS)

    Walther, S.R.; Leung, K.N.; Kunkel, W.B.

    1987-07-01

    A neutral 100kev Li beam has been used as a diagnostic tool for determining current, plasma density, and magnetic pitch angle on the Texas EXperimental Tokamak. Scale up of this diagnostic for the Tokomak Fusion Test Reactor would require use of a Li - beam because of the inefficiency of neutralizing Li + at the high energies required. This paper discusses effects to generate Li - beams from a plasma discharge. 8 refs

  3. Waves and Instabilities in Collisionless Shocks

    Science.gov (United States)

    1984-04-01

    occur in the electron foreshock and are driven by suprathermal electrons escaping into the region upstream of the shock. Both the ion-acoustic and...ULF waves occur in the ion foreshock and are associated with ions streaming into the region upstream of 11 the shock. The region downstream of the...the discussion of these waves it is useful to distinguish two regions, called the electron foreshock and the ion foreshock . Because the particles

  4. The Dynamic Quasiperpendicular Shock: Cluster Discoveries

    Czech Academy of Sciences Publication Activity Database

    Krasnoselskikh, V.; Balikhin, M.; Walker, S. N.; Schwartz, S.; Sundkvist, D.; Lobzin, V.; Gedalin, M.; Bale, S. D.; Mozer, F.; Souček, Jan; Hobara, Y.; Comisel, H.

    2013-01-01

    Roč. 178, 2-4 (2013), s. 535-598 ISSN 0038-6308 Institutional support: RVO:68378289 Keywords : collisionless shocks * waves in plasmas * nonstationarity * shock scales * plasma heating and acceleration * wave-particle interactions Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 5.874, year: 2013 http://link.springer.com/article/10.1007%2Fs11214-013-9972-y

  5. Flow control for oblique shock wave reflections

    OpenAIRE

    Giepman, R.H.M.

    2016-01-01

    Shock wave-boundary layer interactions are prevalent in many aerospace applications that involve transonic or supersonic flows. Such interactions may lead to boundary layer separation, flow unsteadiness and substantial losses in the total pressure. Flow control techniques can help to mitigate these adverse effects and stabilize the interaction. This thesis focuses on passive flow control techniques for oblique shock wave reflections on flat plates and presents experimental results for both la...

  6. Public Investment, Revenue Shocks, and Borrowing Restrictions

    OpenAIRE

    Büttner, Thiess; Wildasin, David E.

    2010-01-01

    This paper lays out a theory of taxation and public investment in an intertemporal setting under conditions of revenue shocks. Without borrowing restrictions, the optimal policy is characterized by smooth time paths of taxes and public investment. While the introduction of formal borrowing restrictions leads to some precautionary savings, it gives rise to fluctuations in public investment in response to adverse but also favorable revenue shocks. This theoretical result is tested empirically u...

  7. Optical Probes for Laser Induced Shocks

    Science.gov (United States)

    1992-03-01

    target by the strong water. As the shock passes the material interface, it is pressure transients. only partially transmitted. The shock pressure is...T. Swimm , J. Appl. Phys. 61, evaporated, t1137(1987). vapor flow substantially. The coupling coefficient thus de- 3 v. A. Batanov and V. B. Fedorov...Waist-Surface Distance [mm] isurface on the drilling mechanismC Positive ( negative ) To roughly estimate the total recoil momentum positions

  8. Fast Electrocardiogram Amplifier Recovery after Defibrillation Shock

    Directory of Open Access Journals (Sweden)

    Ivan Dotsinsky

    2005-04-01

    Full Text Available A procedure for fast ECG amplifier recovery after defibrillation shocks was developed and simulated in the MATLAB environment. Exponentially decaying post-shock voltages have been recorded. Signals from the AHA database are taken and mixed with the recorded exponential disturbances. The algorithm applies moving averaging (comb filter on the compound input signal, thereby obtaining the samples of the disturbance. They are currently subtracted from the input signal. The results obtained show that its recovery is practically instantaneous.

  9. Pressurized-thermal-shock experiments

    International Nuclear Information System (INIS)

    Whitman, G.D.; McCulloch, R.W.

    1982-01-01

    The primary objective of the ORNL pressurized-thermal-shock (PTS) experiments is to verify analytical methods that are used to predict the behavior of pressurized-water-reactor vessels under these accident conditions involving combined pressure and thermal loading. The criteria on which the experiments are based are: scale large enough to attain effective flaw border triaxial restraint and a temperature range sufficiently broad to produce a progression from frangible to ductile behavior through the wall at a given time; use of materials that can be completely characterized for analysis; stress states comparable to the actual vessel in zones of potential flaw extension; range of behavior to include cleavage initiation and arrest, cleavage initiation and arrest on the upper shelf, arrest in a high K/sub I/ gradient, warm prestressing, and entirely ductile behavior; long and short flaws with and without stainless steel cladding; and control of loads to prevent vessel burst, except as desired. A PTS test facility is under construction which will enable the establishment and control of wall temperature, cooling rate, and pressure on an intermediate test vessel (ITV) in order to simulate stress states representative of an actual reactor pressure vessel

  10. A FOCUSED TRANSPORT APPROACH TO THE TIME-DEPENDENT SHOCK ACCELERATION OF SOLAR ENERGETIC PARTICLES AT A FAST TRAVELING SHOCK

    International Nuclear Information System (INIS)

    Le Roux, J. A.; Webb, G. M.

    2012-01-01

    Some of the most sophisticated models for solar energetic particle (SEP) acceleration at coronal mass ejection driven shocks are based on standard diffusive shock acceleration theory. However, this theory, which only applies when SEP pitch-angle anisotropies are small, might have difficulty in describing first-order Fermi acceleration or the shock pre-heating and injection of SEPs into first-order Fermi acceleration accurately at lower SEP speeds where SEP pitch-angle anisotropies upstream near the shock can be large. To avoid this problem, we use a time-dependent focused transport model to reinvestigate first-order Fermi acceleration at planar parallel and quasi-parallel spherical traveling shocks between the Sun and Earth with high shock speeds associated with rare extreme gradual SEP events. The focused transport model is also used to investigate and compare three different shock pre-heating mechanisms associated with different aspects of the nonuniform cross-shock solar wind flow, namely, the convergence of the flow (adiabatic compression), the shear tensor of the flow, and the acceleration of the flow, and a fourth shock pre-heating mechanism associated with the cross-shock electric field, to determine which pre-heating mechanism contributes the most to injecting shock pre-heated source particles into the first-order Fermi acceleration process. The effects of variations in traveling shock conditions, such as increasing shock obliquity and shock slowdown, and variations in the SEP source with increasing shock distance from the Sun on the coupled processes of shock pre-heating, injection, and first-order Fermi acceleration are analyzed. Besides the finding that the cross-shock acceleration of the solar wind flow yields the dominant shock pre-heating mechanism at high shock speeds, we find that first-order Fermi acceleration at fast traveling shocks differs in a number of respects from the predictions and assumptions of standard steady-state diffusive shock

  11. Structure of dense shock-melted alkali halides: Evidence for a continuous pressure-induced structural transition in the melt

    International Nuclear Information System (INIS)

    Ross, M.; Rogers, F.J.

    1985-01-01

    Hypernetted-chain equation calculations have been made for the ion-ion pair distribution functions in shock-melted CsI, CsBr, KBr, KCl, NaCl, and LiF. The results show that the melt undergoes a gradual pressure-induced structural change from an open NaCl-like structure with six nearest neighbors of opposite charge to one that has a rare-gas close-packed-like arrangement containing about 12 neighbors of mixed charge. These effects are most pronounced for the larger ions in which the short-range repulsions are stronger relative to long-range Coulomb attractions

  12. Experimental and numerical investigation of shock wave propagation through complex geometry, gas continuous, two-phase media

    Energy Technology Data Exchange (ETDEWEB)

    Liu, James Chien-Chih [Univ. of California, Berkeley, CA (United States)

    1993-01-01

    The work presented here investigates the phenomenon of shock wave propagation in gas continuous, two-phase media. The motivation for this work stems from the need to understand blast venting consequences in the HYLIFE inertial confinement fusion (ICF) reactor. The HYLIFE concept utilizes lasers or heavy ion beams to rapidly heat and compress D-T targets injected into the center of a reactor chamber. A segmented blanket of failing molten lithium or Li2BeF4 (Flibe) jets encircles the reactors central cavity, shielding the reactor structure from radiation damage, absorbing the fusion energy, and breeding more tritium fuel.

  13. Experimental and numerical investigation of shock wave propagation through complex geometry, gas continuous, two-phase media

    International Nuclear Information System (INIS)

    Liu, J. Chien-Chih

    1993-01-01

    The work presented here investigates the phenomenon of shock wave propagation in gas continuous, two-phase media. The motivation for this work stems from the need to understand blast venting consequences in the HYLIFE inertial confinement fusion (ICF) reactor. The HYLIFE concept utilizes lasers or heavy ion beams to rapidly heat and compress D-T targets injected into the center of a reactor chamber. A segmented blanket of failing molten lithium or Li 2 BeF 4 (Flibe) jets encircles the reactors central cavity, shielding the reactor structure from radiation damage, absorbing the fusion energy, and breeding more tritium fuel

  14. Thermal shock investigation of silicon nitride

    International Nuclear Information System (INIS)

    Ziegler, G.; Leucht, R.

    1977-01-01

    In this work, the thermal shock properties of commercial reaction-bonded Si 3 N 4 quality material (RBSN), of commercial hot-pressed Si 3 N 4 (HPSN) and of different laboratory grades of hot-pressed Si 3 N 4 were examined. The thermal shock properties of RBSN quality material differ according to the structure considerably: The critical temperature difference for sample crossections of 5 x 5 or 6 x 6 mm after quenching in oil lies between 730 0 C and over 1400 0 C. The best thermal shock properties are shown by high density RBSN quality material having very fine pores and high initial strength. The results indicate that for RBSN large pores and density inhomogenities are responsible for bad thermal shock properties. Resistance to fast temperature change is higher for hot-pressed Si 3 N 4 than for RBSN quality material. In HPSN, the thermal shock results show dependence on structure. High MgO content and the associated coarse rod-shaped configuration of the β phase and structural inhomogenities affect the thermal shock properties in an adverse way. (orig.) [de

  15. Mechanical Properties of Shock-Damaged Rocks

    Science.gov (United States)

    He, Hongliang; Ahrens, T. J.

    1994-01-01

    Stress-strain tests were performed both on shock-damaged gabbro and limestone. The effective Young's modulus decreases with increasing initial damage parameter value, and an apparent work-softening process occurs prior to failure. To further characterize shock-induced microcracks, the longitudinal elastic wave velocity behavior of shock-damaged gabbro in the direction of compression up to failure was measured using an acoustic transmission technique under uniaxial loading. A dramatic increase in velocity was observed for the static compressive stress range of 0-50 MPa. Above that stress range, the velocity behavior of lightly damaged (D(sub 0) less than 0.1) gabbro is almost equal to unshocked gabbro. The failure strength of heavily-damaged (D(sub 0) greater than 0.1) gabbro is approx. 100-150 MPa, much lower than that of lightly damaged and unshocked gabbros (approx. 230-260 MPa). Following Nur's theory, the crack shape distribution was analyzed. The shock-induced cracks in gabbro appear to be largely thin penny-shaped cracks with c/a values below 5 x 10(exp -4). Moreover, the applicability of Ashby and Sammis's theory relating failure strength and damage parameter of shock-damaged rocks was examined and was found to yield a good estimate of the relation of shock-induced deficit in elastic modulus with the deficit in compressive strength.

  16. Emissive spectra of shock-heated argon

    International Nuclear Information System (INIS)

    Tang Jingyou; Gu Yan; Peng Qixian; Bai Yulin; Li Ping

    2003-01-01

    To study the radiant properties of argon under weak shock compression, an aluminum target filled with gaseous argon at ambient states was impacted by a tungsten alloy projectile which was launched from a two-stage light gun to 2.00 km/s. The radiant signals of single shock-compressed argon were recorded by a six-channel pyrometer and oscilloscopes, which varied with time linearly for the five channels from 405 nm to 700 nm and exponentially for the channel 800 nm, and the corresponding velocity of shock wave was determined to be 4.10 ± 0.09 km/s. By the present experiment, it has been shown that the absorbability of the shock-heated argon is low for visual light and the optical depths of argon gas turn from thin to thick as wavelengths gradually increase. The time-resolved spectra in the rising-front of the radiant signal in the re-shocked argon were recorded by means of an OMA, and strong emissive spectrum bands near 450 nm light-wave length but no linear spectrum were found. The emissive spectrum properties of shock-compression argon were qualitatively explained by the state parameters and ionization degree

  17. doped LiMgPO4 phosphor

    Indian Academy of Sciences (India)

    attention because of their remarkable luminescence proper- ties and .... Figure 1. (a) X-ray diffraction patterns of LiMgPO4:Tb3+ phosphor and (b) standard data. ICDD file. .... ground signal which affects the signal to noise ratio [17]. MDD was ...

  18. Orienteerumiskaart vs. LiDAR / Marek Karm

    Index Scriptorium Estoniae

    Karm, Marek

    2012-01-01

    Bakalaureusetööst, mille eesmärk oli võrrelda orienteerumiskaardi reljeefi LiDAR-i andmete põhjal saadava reljeefimudeliga ning leida vastus küsimusele, kas o-kaart võib olla kasulik kooste- või kontrollmaterjal mistahes reljeefimudelile

  19. Electron attenuation characteristics of LiF

    Energy Technology Data Exchange (ETDEWEB)

    Paliwal, B R [Wisconsin Univ., Madison (USA). Div. of Clinical Oncology; Almond, P R

    1976-08-01

    The results of a study, indicating the exponential nature of the attenuation of electrons in LiF, are reported. This conclusion holds good not only for the monoenergetic electrons obtained from several pure ..beta.. emitters but also for the high energy electron beams delivered by radiotherapy facilities.

  20. Review on Li-Fi Technology

    Science.gov (United States)

    Chaudhuri, Rajarshi Roy; Dutta, Kaustav; Saha, Archisman

    With advent of various communication technologies one can access the whole world at one go. The impact of internet on our day to day life has been so extensive that it is impossible to think of a day without it. It has become a fundamental requirement in our daily lives. Survey reports show that nearly 46 % of homes throughout the world have access to the internet. And the percentage is growing each day. With such a high demand there has been a looming Radio Frequency spectrum crisis, which paved the way of the invention of a new technology:-LI-FI. LI-FI, acronym of light fidelity, is a new wireless technology which has the ability to provide high speed internet connection within localized environment. Till today we are familiar with WI-FI which uses radio spectrum for communication. Even though it gives a speed of nearly 150 Mbps (as per IEEE802.11n), it isn't sufficient to satisfy all users. On the other hand LI-FI uses spectrum which comprises a wide range of frequencies, from the infrared through visible, down to the ultraviolet spectrum for communication which has the ability to produce a theoretical speed of 10 Gbps. It is not only confined to light-emitting diode (LED) or laser technology or to any specific receiving technique, LI-FI is a framework for all those technologies which provides new ways to all present as well as future services or applications.

  1. Pick-up ion energization at the termination shock

    Energy Technology Data Exchange (ETDEWEB)

    Gary, S Peter [Los Alamos National Laboratory; Winske, Dan [Los Alamos National Laboratory; Wu, Pin [BOSTON UNIV.; Schwadron, N A [BOSTON UNIV.

    2009-01-01

    One-dimensional hybrid simulations are used to investigate how pickup ions are energized at the perpendicular termination shock. Contrary to previous models based on pickup ion energy gain by repeated crossings of the shock front (shock surfing) or due to a reforming shock front, the present simulations show that pickup ion energy gain involves a gyro-phasedependent interaction with the inhomogeneous motional electric field at the shock. The process operates at all relative concentrations of pickup ion density.

  2. Kahel teemal lahkuva üliõpilasesindusega / Merle Erits

    Index Scriptorium Estoniae

    Erits, Merle

    2000-01-01

    Tallinna Pedagoogikaülikooli peagi ametist lahkuv üliõpilasesindus korraldab 16. okt. koostöös Tartu Ülikooli ja Tallinna Tehnikaülikooliga üliõpilaste ja õppejõudude konverentsi "Kvaliteet kõrghariduses". Asutus Elamu nõukogus, mis tegeleb ühiselemuprobleemidega, esindavad üliõpilaskonda kolm liiget

  3. Protons scattering on Li isotopes at intermediate energies

    International Nuclear Information System (INIS)

    Zhusupov, M.A.; Imambekov, O.; Sanfirova, A.V.; Ibraeva, E.T.

    2003-01-01

    The protons scattering differential cross section on the 6,7,8 Li nuclei are calculated within the framework the Glauber-Sitenko multiple scattering theory at intermediate energies (from 100 to 1000 MeV). In the calculations the multi-cluster wave functions (αt for 7 Li, αnp for 6 Li, and αtn for 8 Li) considering within potential cluster model have been used. Differential cross sections for 6 Li, 7 Li, 8 Li and 9 Li nuclei are similar: absolute cross sections are almost the same, diffraction minimum for large A shifting to the field of the least scattering angles that reflecting increase of the material radius. For the 11 Li the differential cross section absolute value is smaller about in two time than for the rest isotopes. At present it is reliably established, that the 11 Li nucleus has an exotic structure - the nine-nucleon core ( 9 Li) around which the two-neutron halo is rotating. The principal characteristics of the Li nuclei are presented in tabular form

  4. LiDAR utility for natural resource managers

    Science.gov (United States)

    Andrew Thomas Hudak; Jeffrey Scott Evans; Alistair Mattthew Stuart. Smith

    2009-01-01

    Applications of LiDAR remote sensing are exploding, while moving from the research to the operational realm. Increasingly, natural resource managers are recognizing the tremendous utility of LiDAR-derived information to make improved decisions. This review provides a cross-section of studies, many recent, that demonstrate the relevance of LiDAR across a suite of...

  5. Revision of the Li13Si4 structure.

    Science.gov (United States)

    Zeilinger, Michael; Fässler, Thomas F

    2013-11-06

    Besides Li17Si4, Li16.42Si4, and Li15Si4, another lithium-rich representative in the Li-Si system is the phase Li13Si4 (trideca-lithium tetra-silicide), the structure of which has been determined previously [Frank et al. (1975 ▶). Z. Naturforsch. Teil B, 30, 10-13]. A careful analysis of X-ray diffraction patterns of Li13Si4 revealed discrepancies between experimentally observed and calculated Bragg positions. Therefore, we redetermined the structure of Li13Si4 on the basis of single-crystal X-ray diffraction data. Compared to the previous structure report, decisive differences are (i) the introduction of a split position for one Li site [occupancy ratio 0.838 (7):0.162 (7)], (ii) the anisotropic refinement of atomic displacement parameters for all atoms, and (iii) a high accuracy of atom positions and unit-cell parameters. The asymmetric unit of Li13Si4 contains two Si and seven Li atoms. Except for one Li atom situated on a site with symmetry 2/m, all other atoms are on mirror planes. The structure consists of isolated Si atoms as well as Si-Si dumbbells surrounded by Li atoms. Each Si atom is either 12- or 13-coordinated. The isolated Si atoms are situated in the ab plane at z = 0 and are strictly separated from the Si-Si dumbbells at z = 0.5.

  6. 2012 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Quinault River Watershed, Washington (Delivery 1)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Watershed Sciences, Inc. (WSI) collected Light Detection and Ranging (LiDAR) data on the Quinault watershed survey area for the Puget Sound LiDAR Consortium. This...

  7. Direct Rehydrogenation of LiBH4 from H-Deficient Li2B12H12−x

    Directory of Open Access Journals (Sweden)

    Yigang Yan

    2018-03-01

    Full Text Available Li2B12H12 is commonly considered as a boron sink hindering the reversible hydrogen sorption of LiBH4. Recently, in the dehydrogenation process of LiBH4 an amorphous H-deficient Li2B12H12−x phase was observed. In the present study, we investigate the rehydrogenation properties of Li2B12H12−x to form LiBH4. With addition of nanostructured cobalt boride in a 1:1 mass ratio, the rehydrogenation properties of Li2B12H12−x are improved, where LiBH4 forms under milder conditions (e.g., 400 °C, 100 bar H2 with a yield of 68%. The active catalytic species in the reversible sorption reaction is suggested to be nonmetallic CoxB (x = 1 based on 11B MAS NMR experiments and its role has been discussed.

  8. 2014 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Cedar River Watershed (Delivery 2)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In September 2013, WSI, a Quantum Spatial company (QSI), was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...

  9. 2014 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Cedar River Watershed (Delivery 1)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In September 2013, WSI, a Quantum Spatial company (QSI), was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...

  10. Modulation of solid electrolyte interphase of lithium-ion batteries by LiDFOB and LiBOB electrolyte additives

    Science.gov (United States)

    Huang, Shiqiang; Wang, Shuwei; Hu, Guohong; Cheong, Ling-Zhi; Shen, Cai

    2018-05-01

    Solid-electrolyte interphase (SEI) layer is an organic-inorganic composite layer that allows Li+ transport across but blocks electron flow across and prevents solvent diffusing to electrode surface. Morphology, thickness, mechanical and chemical properties of SEI are important for safety and cycling performance of lithium-ion batteries. Herein, we employ a combination of in-situ AFM and XPS to investigate the effects of two electrolyte additives namely lithium difluoro(oxalate)borate (LiDFOB) and lithium bis(oxalato)borate (LiBOB) on SEI layer. LiDFOB is found to result in a thin but hard SEI layer containing more inorganic species (LiF and LiCO3); meanwhile LiBOB promotes formation of a thick but soft SEI layer containing more organic species such as ROCO2Li. Findings from present study will help development of electrolyte additives that promote formation of good SEI layer.

  11. Probing the failure mechanism of nanoscale LiFePO₄ for Li-ion batteries

    Energy Technology Data Exchange (ETDEWEB)

    Gu, Meng [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Shi, Wei [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Energy and Environmental Directorate; Beijing Jiaotong University (China). School of Electrical Engineering, National Active Distribution Network Technology Research Center; Zheng, Jianming [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Energy and Environmental Directorate; Yan, Pengfei [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Zhang, Ji-guang [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Energy and Environmental Directorate; Wang, Chongmin [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL)

    2015-05-18

    LiFePO4 is a high power rate cathode material for lithium ion battery and shows remarkable capacity retention, featuring a 91% capacity retention after 3300 cycles. In this work, we use high-resolution transmission electron microscopy (HRTEM), energy dispersive x-ray spectroscopy (EDS), and electron energy loss spectroscopy (EELS) to study the gradual capacity fading mechanism of LiFePO4 materials. We found that upon prolonged electrochemical cycling of the battery, the LiFePO4 cathode shows surface amorphization and loss of oxygen species, which directly contribute to the gradual capacity fading of the battery. The finding is of great importance for the design and improvement of new LiFePO4 cathode for high-energy and high-power rechargeable battery for electric transportation.

  12. 2000 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Kitsap Peninsula, Washington

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — TerraPoint surveyed and created this data for the Puget Sound LiDAR Consortium under contract. The area surveyed is approximately 1,146 square miles and covers part...

  13. 2003 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Snohomish County, Washington

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — TerraPoint surveyed and created this data for the Puget Sound LiDAR Consortium under contract. The area surveyed is approximately 167 square miles and covers a...

  14. 2011 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Rattlesnake

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Watershed Sciences, Inc. (WSI) collected Light Detection and Ranging (LiDAR) data on six days between September 15th and November 5th, and from November 6th - 13th,...

  15. 2005 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: North Puget Sound Lowlands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected Light Detection and Ranging (LiDAR) data contributing to the Puget Sound Lowlands project of 2005. Arlington, City of Snohomish, Snohomish...

  16. 2003 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Lewis County, Washington

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — TerraPoint surveyed and created this data for the Puget Sound LiDAR Consortium under contract. The area surveyed is approximately 100 square miles and covers part of...

  17. Probing the failure mechanism of nanoscale LiFePO4 for Li-ion batteries

    International Nuclear Information System (INIS)

    Gu, Meng; Yan, Pengfei; Wang, Chongmin; Shi, Wei; Zheng, Jianming; Zhang, Ji-guang

    2015-01-01

    LiFePO 4 is a high power rate cathode material for lithium ion battery and shows remarkable capacity retention, featuring a 91% capacity retention after 3300 cycles. In this work, we use high-resolution transmission electron microscopy and electron energy loss spectroscopy to study the gradual capacity fading mechanism of LiFePO 4 materials. We found that upon prolonged electrochemical cycling of the battery, the LiFePO 4 cathode shows surface amorphization and loss of oxygen species, which directly contribute to the gradual capacity fading of the battery. The finding can guide the design and improvement of LiFePO 4 cathode for high-energy and high-power rechargeable battery for electric transportation

  18. 2005 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Lewis County

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected Light Detection and Ranging (LiDAR) data for the Lewis County project of 2005. The project site covered approximately 223 square miles, divided...

  19. 2005 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Olympic Peninsula

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected Light Detection and Ranging (LiDAR) data for the Olympic Peninsula project of 2005, totaling approximately 114.59 sq mi: 24.5 for Clallam...

  20. 2012 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Upper Naches River, Washington

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Watershed Sciences, Inc. (WSI) collected Light Detection and Ranging (LiDAR) data of the Upper Naches River Valley and Nile Slide area of interest on September 30th,...

  1. Complex Diffusion Mechanisms for Li in Feldspar: Re-thinking Li-in-Plag Geospeedometry

    Science.gov (United States)

    Holycross, M.; Watson, E. B.

    2017-12-01

    In recent years, the lithium isotope system has been applied to model processes in a wide variety of terrestrial environments. In igneous settings, Li diffusion gradients have been frequently used to time heating episodes. Lithium partitioning behavior during decompression or cooling events drives Li transfer between phases, but the extent of Li exchange may be limited by its diffusion rate in geologic materials. Lithium is an exceptionally fast diffuser in silicate media, making it uniquely suited to record short-lived volcanic phenomena. The Li-in-plagioclase geospeedometer is often used to time explosive eruptions by applying laboratory-calibrated Li diffusion coefficients to model concentration profiles in magmatic feldspar samples. To quantify Li transport in natural scenarios, experimental measurements are needed that account for changing temperature and oxygen fugacity as well as different feldspar compositions and crystallographic orientation. Ambient pressure experiments were run at RPI to diffuse Li from a powdered spodumene source into polished sanidine, albite, oligoclase or anorthite crystals over the temperature range 500-950 ºC. The resulting 7Li concentration gradients developed in the mineral specimens were evaluated using laser ablation ICP-MS. The new data show that Li diffusion in all feldspar compositions simultaneously operates by both a "fast" and "slow" diffusion mechanism. Fast path diffusivities are similar to those found by Giletti and Shanahan [1997] for Li diffusion in plagioclase and are typically 10 to 20 times greater than slow path diffusivities. Lithium concentration gradients in the feldspar experiments plot in the shape of two superimposed error function curves with the slow diffusion regime in the near-surface of the crystal. Lithium diffusion is most sluggish in sanidine and is significantly faster in the plagioclase feldspars. It is still unclear what diffusion mechanism operates in nature, but the new measurements may impact

  2. Electrochemical Investigations of the Interface at Li/Li+ Ion Conducting Channel

    Science.gov (United States)

    2006-10-04

    range of applications.1 Presently, these molecules are of particular interest in non-linear optics, as liquid crystals, as Langmuir - Blodgett films, for...cathode material in non-aqueous liquid electrolyte medium Since Li2Pc is a mixed ionic and electronic conductor, and some metal phthalocyanines are...14. ABSTRACT Dilithium phthalocyanine (Li2Pc) possesses mixed electronic- ionic conductivity due to overlap of - orbitals (electronic

  3. Residual salt separation from simulated spent nuclear fuel reduced in a LiCl-Li2O salt

    International Nuclear Information System (INIS)

    Hur, Jin-Mok; Hong, Sun-Seok; Seo, Chung-Seok

    2006-01-01

    The electrochemical reduction of spent nuclear fuel in LiCl-Li 2 O molten salt for the conditioning of spent nuclear fuel requires the separation of the residual salts from a reduced metal product after the reduction process. Considering the behavior of spent nuclear fuel during the electrochemical reduction process, a surrogate material matrix was constructed and inactive tests on a salt separation were carried out to produce the data required for active tests. Fresh uranium metal prepared from the electrochemical reduction of U 3 O 8 powder was used as the surrogates of the spent nuclear fuel Atomic Energy Society of Japan, Tokyo, Japan, All rights reservedopyriprocess. LiCl, Li 2 O, Y 2 O 3 and SrCl 2 were selected as the components of the residual salts. Interactions between the salts and their influence on the separation of the residual salts were analyzed by differential scanning calorimetry (DSC) and thermogravimetry (TG). Eutectic melting of LiCl-Li 2 O and LiCl-SrCl 2 led to a melting point which was lower than that of the LiCl molten salt was observed. Residual salts were separated by a vaporization method. Co-vaporization of LiCl-Li 2 O and LiCl-SrCl 2 was achieved below the temperatures which could make the uranium metal oxidation by Li 2 O possible. The salt vaporization rates at 950degC were measured as follows: LiCl-8 wt% Li 2 O>LiCl>LiCl-8 wt% SrCl 2 >SrCl 2 . (author)

  4. Residual Salt Separation from the Metal Products Reduced in a LiCl-Li2O Molten Salt

    International Nuclear Information System (INIS)

    Hur, Jin Mok; Hong, Sun Seok; Kang, Dae Seung; Jeong, Meong Soo; Seo, Chung Seok

    2006-02-01

    The electrochemical reduction of spent nuclear fuel in a LiCl-Li 2 O molten salt for the conditioning of spent nuclear fuel requires the separation of the residual salts from a reduced metal product after the reduction process. Considering the behavior of spent nuclear fuel during the electrochemical reduction process, a surrogate material matrix was constructed and inactive tests on a salt separation were carried out to produce the data required for the active tests. Fresh uranium metal prepared from the electrochemical reduction of U 3 O 8 powder was used as the surrogates of the spent nuclear fuel components which might be metallized by the electrochemical reduction process. LiCl, Li 2 O, Y 2 O 3 and SrCl 2 were selected as the components of the residual salts. Interactions between the salts and their influence on the separation of the residual salts were analyzed by differential scanning calorimetry (DSC) and thermogravimetry (TG). Eutectic melting of LiCl-Li 2 O and LiCl-SrCl 2 led to a melting point which was lower than that of a LiCl molten salt was observed. Residual salts were separated by a vaporization method. Co-vaporization of LiCl-Li 2 O and LiCl-SrCl 2 was achieved below temperatures which could make the uranium metal oxidation by Li 2 O possible. The salt vaporization rates at 950 .deg. C were measured as follows: LiCl-8 wt% Li 2 O > LiCl > LiCl-8 wt% SrCl 2 > SrCl 2

  5. Residual Salt Separation from the Metal Products Reduced in a LiCl-Li{sub 2}O Molten Salt

    Energy Technology Data Exchange (ETDEWEB)

    Hur, Jin Mok; Hong, Sun Seok; Kang, Dae Seung; Jeong, Meong Soo; Seo, Chung Seok

    2006-02-15

    The electrochemical reduction of spent nuclear fuel in a LiCl-Li{sub 2}O molten salt for the conditioning of spent nuclear fuel requires the separation of the residual salts from a reduced metal product after the reduction process. Considering the behavior of spent nuclear fuel during the electrochemical reduction process, a surrogate material matrix was constructed and inactive tests on a salt separation were carried out to produce the data required for the active tests. Fresh uranium metal prepared from the electrochemical reduction of U{sub 3}O{sub 8} powder was used as the surrogates of the spent nuclear fuel components which might be metallized by the electrochemical reduction process. LiCl, Li{sub 2}O, Y{sub 2}O{sub 3} and SrCl{sub 2} were selected as the components of the residual salts. Interactions between the salts and their influence on the separation of the residual salts were analyzed by differential scanning calorimetry (DSC) and thermogravimetry (TG). Eutectic melting of LiCl-Li{sub 2}O and LiCl-SrCl{sub 2} led to a melting point which was lower than that of a LiCl molten salt was observed. Residual salts were separated by a vaporization method. Co-vaporization of LiCl-Li{sub 2}O and LiCl-SrCl{sub 2} was achieved below temperatures which could make the uranium metal oxidation by Li{sub 2}O possible. The salt vaporization rates at 950 .deg. C were measured as follows: LiCl-8 wt% Li{sub 2}O > LiCl > LiCl-8 wt% SrCl{sub 2} > SrCl{sub 2}.

  6. On the reduction of generalized polylogarithms to Li_n and Li_2_,_2 and on the evaluation thereof

    International Nuclear Information System (INIS)

    Frellesvig, Hjalte; Tommasini, Damiano; Wever, Christopher

    2016-01-01

    We give expressions for all generalized polylogarithms up to weight four in terms of the functions log, Li_n, and Li_2_,_2, valid for arbitrary complex variables. Furthermore we provide algorithms for manipulation and numerical evaluation of Li_n and Li_2_,_2, and add codes in Mathematica and C++ implementing the results. With these results we calculate a number of previously unknown integrals, which we add in appendix C.

  7. Macroeconomic impacts of oil price shocks in Asian economies

    International Nuclear Information System (INIS)

    Cunado, Juncal; Jo, Soojin; Perez de Gracia, Fernando

    2015-01-01

    This paper analyzes the macroeconomic impact of structural oil shocks in four of the top oil-consuming Asian economies, using a VAR model. We identify three different structural oil shocks via sign restrictions: an oil supply shock, an oil demand shock driven by global economic activity and an oil-specific demand shock. The main results suggest that economic activity and prices respond very differently to oil price shocks depending on their types. In particular, an oil supply shock has a limited impact, while a demand shock driven by global economic activity has a significant positive effect in all four Asian countries examined. Our finding also includes that policy tools such as interest rates and exchange rates help mitigating the effects of supply shocks in Japan and Korea; however, they can be more actively used in response to demands shocks. - Highlights: • We analyze the effects of three structural oil price shocks on Asian economies. • Supply shocks have limited impact on the economic activity of Asian economies examined. • Demand shocks due to economic activity boosts GDP of all economies. • CPIs in India and Indonesia were only marginally affected by oil price shocks. • Monetary and exchange rate tools help mitigating supply shocks in Korea and Japan.

  8. Thermal Stability of Li-Ion Cells

    International Nuclear Information System (INIS)

    ROTH, EMANUEL P.

    1999-01-01

    The thermal stability of Li-ion cells with intercalating carbon anodes and metal oxide cathodes was measured as a function of state of charge and temperature for two advanced cell chemistries. Cells of the 18650 design with Li(sub x)CoO(sub 2) cathodes (commercial SONY cells) and Li(sub x)Ni(sub 0.8)Co(sub 0.2)O(sub 2) cathodes were measured for thermal reactivity in the open circuit cell condition. Accelerating rate calorimetry (ARC) was used to measure cell thermal runaway as a function of state of charge (SOC). Microcalorimetry was used to measure the time dependence of heat generating side reactions also as a function of SOC. Components of cells were measured using differential scanning calorimetry (DSC) to study the thermal reactivity of the individual electrodes to determine the temperature regimes and conditions of the major thermal reactions. Thermal decomposition of the SEI layer at the anodes was identified as the initiating source for thermal runaway. The cells with Li(sub x)CoO(sub 2) cathodes showed greater sensitivity to SOC and higher accelerating heating rates than seen for the cells with Li(sub x)Ni(sub 0.8)Co(sub 0.2)O(sub 2)cathodes. Lower temperature reactions starting as low as 40 C were also observed that were SOC dependent but not accelerating. These reactions were also measured in the microcalorimeter and observed to decay over time with a power-law dependence and are believed to result in irreversible capacity loss in the cells

  9. Shock-wave induced mechanoluminescence: A new technique for studying effects of shock pressure on crystals

    Energy Technology Data Exchange (ETDEWEB)

    Chandra, B.P.; Parganiha, S.; Sonwane, V.D. [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, Chhattisgarh (India); Chandra, V.K. [Department of Electrical and Electronics Engineering, Chhatrapati Shivaji Institute of Technology, Shivaji Nagar, Kolihapuri, Durg 491001, Chhattisgarh (India); Jha, Piyush, E-mail: piyushjha22@rediffmail.com [Department of Applied Physics, Raipur Institute of Technology, Chhatauna, Mandir Hasuad, Raipur 492101, Chhattisgarh (India); Baghel, R.N. [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, Chhattisgarh (India)

    2016-10-15

    The impact of a projectile propelled to velocities in the range of 0.5–2.5 km/s on to a target (X-cut quartz crystal) produces shock waves travelling at velocity of nearly 10 km/s in target, in which intense mechanoluminescence (ML) pulses of microsecond duration are produced, both in compression and post-compression conditions. The piezoelectric field produced due to surface charges of fractured target, causes band bending and subsequently, the free charge carriers are generated in the respective bands and the emission of ML occurs. The ML appears after a delay time t{sub th} whose value decreases with increasing value of the shock pressure. Initially, the ML intensity increases with the shock pressure because of the creation of more surfaces; however, for higher values of the shock pressure, the ML intensity tends to attain a saturation value because of the hardening of the crystals due to the creation of small crystallites in which the creation of new surfaces becomes difficult. The ratio between peak ML intensity in the uncompressed region and the maximum ML intensity in the compressed region decreases with increasing shock pressure because more defects produced at high pressure generate higher barrier for the relaxation of blocked cracks under compression. The expressions derived for characteristics of shock-induced ML are able to explain satisfactorily the experimental results. Shock-wave velocity, shock pressure, transit time, lifetime of electrons in conduction band, etc. can be determined by the shock-induced ML.As such, the shock-induced ML provides a new optical technique for the studies of materials under shock pressure.

  10. Epitaxial thin film growth of LiH using a liquid-Li atomic template

    Energy Technology Data Exchange (ETDEWEB)

    Oguchi, Hiroyuki, E-mail: oguchi@nanosys.mech.tohoku.ac.jp [Department of Nanomechanics, Tohoku University, Sendai 980-8579 (Japan); Micro System Integration Center (muSIC), Tohoku University, Sendai 980-0845 (Japan); Ikeshoji, Tamio; Orimo, Shin-ichi [Institute for Materials Research, Tohoku University, Sendai 980-8577 (Japan); Advanced Institute for Materials Research (AIMR), Tohoku University, Sendai 980-8577 (Japan); Ohsawa, Takeo; Shiraki, Susumu; Hitosugi, Taro [Advanced Institute for Materials Research (AIMR), Tohoku University, Sendai 980-8577 (Japan); Kuwano, Hiroki [Department of Nanomechanics, Tohoku University, Sendai 980-8579 (Japan)

    2014-11-24

    We report on the synthesis of lithium hydride (LiH) epitaxial thin films through the hydrogenation of a Li melt, forming abrupt LiH/MgO interface. Experimental and first-principles molecular dynamics studies reveal a comprehensive microscopic picture of the crystallization processes, which sheds light on the fundamental atomistic growth processes that have remained unknown in the vapor-liquid-solid method. We found that the periodic structure that formed, because of the liquid-Li atoms at the film/MgO-substrate interface, serves as an atomic template for the epitaxial growth of LiH crystals. In contrast, films grown on the Al{sub 2}O{sub 3} substrates indicated polycrystalline films with a LiAlO{sub 2} secondary phase. These results and the proposed growth process provide insights into the preparation of other alkaline metal hydride thin films on oxides. Further, our investigations open the way to explore fundamental physics and chemistry of metal hydrides including possible phenomena that emerge at the heterointerfaces of metal hydrides.

  11. Li-rich layer-structured cathode materials for high energy Li-ion batteries

    Science.gov (United States)

    Li, Liu; Lee, Kim Seng; Lu, Li

    2014-08-01

    Li-rich layer-structured xLi2MnO3 ṡ (1 - x)LiMO2 (M = Mn, Ni, Co, etc.) materials have attracted much attention due to their extraordinarily high reversible capacity as the cathode material in Li-ion batteries. To better understand the nature of this type of materials, this paper reviews history of development of the Li-rich cathode materials, and provides in-depth study on complicated crystal structures and reaction mechanisms during electrochemical charge/discharge cycling. Despite the fabulous capability at low rate, several drawbacks still gap this type of high-capacity cathode materials from practical applications, for instance the large irreversible capacity loss at first cycle, poor rate capability, severe voltage decay and capacity fade during electrochemical charge/discharge cycling. This review will also address mechanisms for these inferior properties and propose various possible solutions to solve above issues for future utilization of these cathode materials in commercial Li-ion batteries.

  12. Capturing and Processing Soil GHG Fluxes Using the LI-COR LI-8100A

    Science.gov (United States)

    Xu, Liukang; McDermitt, Dayle; Hupp, Jason; Johnson, Mark; Madsen, Rod

    2015-04-01

    The LI-COR LI-8100A Automated Soil CO2 Flux System is designed to measure soil CO2 efflux using automated chambers and a non-steady state measurement protocol. While CO2 is an important gas in many contexts, it is not the only gas of interest for many research applications. With some simple plumbing modifications, many third party analyzers capable of measuring other trace gases, e.g. N2O, CH4, or 13CO2 etc., can be interfaced with the LI-8100A System, and LI-COR's data processing software (SoilFluxPro™) can be used to compute fluxes for these additional gases. In this paper we describe considerations for selecting an appropriate third party analyzer to interface with the system, how to integrate data into the system, and the procedure used to compute fluxes of additional gases in SoilFluxPro™. A case study is presented to demonstrate methane flux measurements using an Ultra-Portable Greenhouse Gas Analyzer (Ultra-Portable GGA, model 915-0011), manufactured by Los Gatos Research and integrated into the LI-8100A System. Laboratory and field test results show that the soil CO2 efflux based on the time series of CO2 data measured either with the LI-8100A System or with the Ultra-Portable GGA are essentially the same. This suggests that soil GHG fluxes measured with both systems are reliable.

  13. Epitaxial thin film growth of LiH using a liquid-Li atomic template

    International Nuclear Information System (INIS)

    Oguchi, Hiroyuki; Ikeshoji, Tamio; Orimo, Shin-ichi; Ohsawa, Takeo; Shiraki, Susumu; Hitosugi, Taro; Kuwano, Hiroki

    2014-01-01

    We report on the synthesis of lithium hydride (LiH) epitaxial thin films through the hydrogenation of a Li melt, forming abrupt LiH/MgO interface. Experimental and first-principles molecular dynamics studies reveal a comprehensive microscopic picture of the crystallization processes, which sheds light on the fundamental atomistic growth processes that have remained unknown in the vapor-liquid-solid method. We found that the periodic structure that formed, because of the liquid-Li atoms at the film/MgO-substrate interface, serves as an atomic template for the epitaxial growth of LiH crystals. In contrast, films grown on the Al 2 O 3 substrates indicated polycrystalline films with a LiAlO 2 secondary phase. These results and the proposed growth process provide insights into the preparation of other alkaline metal hydride thin films on oxides. Further, our investigations open the way to explore fundamental physics and chemistry of metal hydrides including possible phenomena that emerge at the heterointerfaces of metal hydrides

  14. A Reverse Shock in GRB 160509A

    Science.gov (United States)

    Laskar, Tanmoy; Alexander, Kate D.; Berger, Edo; Fong, Wen-fai; Margutti, Raffaella; Shivvers, Isaac; Williams, Peter K. G.; Kopač, Drejc; Kobayashi, Shiho; Mundell, Carole; Gomboc, Andreja; Zheng, WeiKang; Menten, Karl M.; Graham, Melissa L.; Filippenko, Alexei V.

    2016-12-01

    We present the second multi-frequency radio detection of a reverse shock in a γ-ray burst. By combining our extensive radio observations of the Fermi-Large Area Telescope γ-ray burst 160509A at z = 1.17 up to 20 days after the burst with Swift X-ray observations and ground-based optical and near-infrared data, we show that the afterglow emission comprises distinct reverse shock and forward shock contributions: the reverse shock emission dominates in the radio band at ≲10 days, while the forward shock emission dominates in the X-ray, optical, and near-infrared bands. Through multi-wavelength modeling, we determine a circumburst density of {n}0≈ {10}-3 {{cm}}-3, supporting our previous suggestion that a low-density circumburst environment is conducive to the production of long-lasting reverse shock radiation in the radio band. We infer the presence of a large excess X-ray absorption column, N H ≈ 1.5 × 1022 {{cm}}-2, and a high rest-frame optical extinction, A V ≈ 3.4 mag. We identify a jet break in the X-ray light curve at {t}{jet}≈ 6 {days}, and thus derive a jet opening angle of {θ }{jet}≈ 4^\\circ , yielding a beaming-corrected kinetic energy and radiated γ-ray energy of {E}{{K}}≈ 4× {10}50 erg and {E}γ ≈ 1.3× {10}51 erg (1-104 keV, rest frame), respectively. Consistency arguments connecting the forward shocks and reverse shocks suggest a deceleration time of {t}{dec} ≈ 460 s ≈ T 90, a Lorentz factor of {{Γ }}({t}{dec})≈ 330, and a reverse-shock-to-forward-shock fractional magnetic energy density ratio of {R}{{B}}\\equiv {ɛ }{{B},{RS}}/{ɛ }{{B},{FS}}≈ 8. Our study highlights the power of rapid-response radio observations in the study of the properties and dynamics of γ-ray burst ejecta.

  15. Al-Cu-Li and Al-Mg-Li alloys: Phase composition, texture, and anisotropy of mechanical properties (Review)

    Science.gov (United States)

    Betsofen, S. Ya.; Antipov, V. V.; Knyazev, M. I.

    2016-04-01

    The results of studying the phase transformations, the texture formation, and the anisotropy of the mechanical properties in Al-Cu-Li and Al-Mg-Li alloys are generalized. A technique and equations are developed to calculate the amounts of the S1 (Al2MgLi), T1 (Al2CuLi), and δ' (Al3Li) phases. The fraction of the δ' phase in Al-Cu-Li alloys is shown to be significantly higher than in Al-Mg-Li alloys. Therefore, the role of the T1 phase in the hardening of Al-Cu-Li alloys is thought to be overestimated, especially in alloys with more than 1.5% Li. A new model is proposed to describe the hardening of Al-Cu-Li alloys upon aging, and the results obtained with this model agree well with the experimental data. A texture, which is analogous to that in aluminum alloys, is shown to form in sheets semiproducts made of Al-Cu-Li and Al-Mg-Li alloys. The more pronounced anisotropy of the properties of lithium-containing aluminum alloys is caused by a significant fraction of the ordered coherent δ' phase, the deformation mechanism in which differs radically from that in the solid solution.

  16. Scintillation properties of LiF–SrF2 and LiF–CaF2 eutectic

    International Nuclear Information System (INIS)

    Yanagida, Takayuki; Kawaguchi, Noriaki; Fujimoto, Yutaka; Fukuda, Kentaro; Watanabe, Kenichi; Yamazaki, Atsushi; Uritani, Akira

    2013-01-01

    Dopant free eutectic scintillators 6 LiF–SrF 2 and 6 LiF–CaF 2 were developed by the vertical Bridgeman method for the purpose of thermal neutron detection. The molar ratio of LiF and Ca/SrF 2 was 4:1 on its eutectic composition. The α-ray induced radioluminescence spectra of the scintillators showed intense emission peak at 300 nm due to the emission from the self-trapped exciton in Ca/SrF 2 layers. When the samples were irradiated with 252 Cf neutrons, 6 LiF–SrF 2 and 6 LiF–CaF 2 exhibited the light yields of 4700 and 9400 ph/n, respectively. Scintillation decay times of 6 LiF–SrF 2 and 6 LiF–CaF 2 were accepted for scintillation detectors, 90 and 250 ns, respectively. -- Highlights: • Nondoped LiF–CaF 2 and LiF–SrF 2 eutectic scinitillators are reported for the first time. • Two sample showed self-trapped exciton emission. • LiF–SrF 2 sample exhibited the light yield of 9400 ph/n and this value was comparable to conventional materials doped with rare earth ions. • Scintillation decay times of LiF–CaF 2 and LiF–SrF 2 were 250 and 90 ns, respectively

  17. Pressurized-thermal-shock technology

    International Nuclear Information System (INIS)

    Dickson, T.L.

    1991-01-01

    It was recognized at the time the original Issues on Pressurized Thermal Shock (IPTS) studies were conducted that distinct vertical plumes of cooling water form beneath the cold leg inlet nozzles during those particular transients that exhibit fluid/thermal stratification. The formation of these plumes (referred to as thermal streaming) induces a time-dependent circumferential temperature variation on the inner surface of the Reactor Pressure Vessel (RPV) wall that creates an axial stress component. This axial stress component is in addition to the axial stress components induced by time-dependent radial temperature variation through the wall thickness and the time-dependent pressure transient. This additional axial stress component will result in a larger axial stress resultant that results in a larger stress-intensity factor acting on circumferential flaws, thus reducing the fracture margin for circumferential flaws. Although this was recognized at the time of the original IPTS study, the contribution appeared to be relatively small; therefore, it was neglected. The original IPTS studies were performed with OCA-P, a computer program developed at ORNL to analyze the cleavage fracture response of a nuclear RPV subjected to PTS loading. OCA-P is a one-dimensional (1-D) finite-element code that analyzes the stresses and stress-intensity factors (axial and tangential) resulting from the pressure and the radial temperature variation through the wall thickness only. The HSST Program is investigating the potential effects of thermal-streaming-induced stresses in circumferential welds on the reactor vessel PTS analyses. The initial phase of this investigation focused on an evaluation of the available thermal-hydraulic data and analyses results. The objective for the initial phase of the investigation is to evaluate thermal-streaming behavior under conditions relevant to the operation of U.S. PWRs and chracterize any predicted thermal-streaming plumes

  18. Effect of Heat Treatment on the Lithium Ion Conduction of the LiBH4–LiI Solid Solution

    DEFF Research Database (Denmark)

    Sveinbjörnsson, Dadi Þorsteinn; Mýrdal, Jón Steinar Garðarsson; Blanchard, Didier

    2013-01-01

    The LiBH4–LiI solid solution is a good Li+ conductor and a promising crystalline electrolyte for all-solid-state lithium based batteries. The focus of the present work is on the effect of heat treatment on the Li+ conduction. Solid solutions with a LiI content of 6.25–50% were synthesized by high...

  19. Effects of response-shock interval and shock intensity on free-operant avoidance responding in the pigeon1

    Science.gov (United States)

    Klein, Marty; Rilling, Mark

    1972-01-01

    Two experiments investigated free-operant avoidance responding with pigeons using a treadle-pressing response. In Experiment I, pigeons were initially trained on a free-operant avoidance schedule with a response-shock interval of 32 sec and a shock-shock interval of 10 sec, and were subsequently exposed to 10 values of the response-shock parameter ranging from 2.5 to 150 sec. The functions relating response rate to response-shock interval were similar to the ones reported by Sidman in his 1953 studies employing rats, and were independent of the order of presentation of the response-shock values. Shock rates decreased as response-shock duration increased. In Experiment II, a free-operant avoidance schedule with a response-shock interval of 20 sec and a shock-shock interval of 5 sec was used, and shock intensities were varied over five values ranging from 2 to 32 mA. Response rates increased markedly as shock intensity increased from 2 to 8 mA, but rates changed little with further increases in shock intensity. Shock rates decreased as intensity increased from 2 to 8 mA, and showed little change as intensity increased from 8 to 32 mA. PMID:4652617

  20. The Technology of LiFi: A Brief Introduction

    Science.gov (United States)

    Ramadhani, E.; Mahardika, G. P.

    2018-03-01

    Light Fidelity (LiFi) is a Visible Light Communication (VLC) based technology that making a light as a media of communication replacing the cable wire communication. LiFi is evolve to overcome the rate speed in WiFi, while using LiFi the rate speed can reach until 14 Gbps. This paper presents an introduction of the LiFi technology including the architecture, modulation, performance, and the challenges. The result of this paper can be used as a reference and knowledge to develop some of the LiFi technology.