Kim, Yoon Jung; Moon, Myung Hee; Lee, Jae Sun; Hong, Soon-Kwang; Chang, Yong Keun
2011-09-01
Culture pH change has some important roles in signal transduction and secondary metabolism. We have already reported that acidic pH shock enhanced actinorhodin production in Streptomyces coelicolor. Among many potential governing factors on pH variation, the putative Na(+)/H(+) antiporter (sha) genes in S. coelicolor have been investigated in this study to elucidate the association of the sha on pH variation and secondary metabolism. Through the transcriptional analysis and overexpression experiments on 8 sha genes, we observed that most of the sha expressions were promoted by pH shock, and in the opposite way the pH changes and actinorhodin production were enhanced by the overexpression of each sha. We also confirmed that sha8 especially has a main role in maintaining cell viability and pH homeostasis through Na(+) extrusion, in salt effect experiment under the alkaline medium condition by deleting sha8. Moreover, this gene was observed to have a function of pH recovery after pH variation such as the pH shock, being able to cause the sporulation. However, actinorhodin production was not induced by the only pH recovery. The sha8 gene could confer on the host cell the ability to recover pH to the neutral level after pH variation like a pH drop. Sporulation was closely associated with this pH recovery caused by the action of sha8, whereas actinorhodin production was not due to such pH variation patterns alone.
Preimages for Step-Reduced SHA-2
DEFF Research Database (Denmark)
Aoki, Kazumaro; Guo, Jian; Matusiewicz, Krystian
2009-01-01
In this paper, we present preimage attacks on up to 43-step SHA-256 (around 67% of the total 64 steps) and 46-step SHA-512 (around 57.5% of the total 80 steps), which significantly increases the number of attacked steps compared to the best previously published preimage attack working for 24 steps....... The time complexities are 2^251.9, 2^509 for finding pseudo-preimages and 2^254.9, 2^511.5 compression function operations for full preimages. The memory requirements are modest, around 2^6 words for 43-step SHA-256 and 46-step SHA-512. The pseudo-preimage attack also applies to 43-step SHA-224 and SHA-384...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT
Shock equation of state of 6LiH to 1.1 TPa
Lazicki, A.; London, R. A.; Coppari, F.; Erskine, D.; Whitley, H. D.; Caspersen, K. J.; Fratanduono, D. E.; Morales, M. A.; Celliers, P. M.; Eggert, J. H.; Millot, M.; Swift, D. C.; Collins, G. W.; Kucheyev, S. O.; Castor, J. I.; Nilsen, J.
2017-10-01
Using laser-generated shock waves, we have measured pressure, density, and temperature of LiH on the principal Hugoniot between 260 and 1100 GPa (2.6-11 Mbar) and on a second-shock Hugoniot up to 1400 GPa to near fivefold compression, extending the maximum pressure reached in non-nuclear experiments by a factor of two. We observe the onset of metal-like reflectivity consistent with temperature-induced ionization of the Li 2s electron, and no sign of additional changes in ionization up to the maximum pressure. Our measurements are in good agreement with gas gun, Z-machine, and underground test data and are accurately described by quantum molecular dynamics simulations. The results confirm the validity of equation of state models built on an average-atom description of the electron-thermal contribution to the free energy and a density-dependent Grüneisen parameter to describe shock response of LiH over this pressure range.
The first collision for full SHA-1
M.M.J. Stevens (Marc); E. Bursztein (Elie); P. Karpman (Pierre); A. Albertini (Ange); Y. Markov (Yarik)
2017-01-01
textabstractSHA-1 is a widely used 1995 NIST cryptographic hash function standard that was officially deprecated by NIST in 2011 due to fundamental security weaknesses demonstrated in various analyses and theoretical attacks. Despite its deprecation, SHA-1 remains widely used in 2017 for document
76 FR 11433 - Federal Transition To Secure Hash Algorithm (SHA)-256
2011-03-02
... ADMINISTRATION [FAR-N-2011-01; Docket No. 2011-0083; Sequence 1] Federal Transition To Secure Hash Algorithm (SHA... acquisition community to transition to Secure Hash Algorithm SHA-256. SHA-256 is a cryptographic hash function... persons attending. Please cite ``Federal Transition to Secure Hash Algorithm SHA-256'' in all...
International Nuclear Information System (INIS)
Rogers, F.J.
1975-01-01
It is proposed to send a high pressure shock wave through a layer of LiH and then into a sample of high Z-material, resulting in a reflected shock wave back into the LiH. If the Hugoniot and some reflected Hugoniots for LiH are known the EOS of the sample can be obtained from the ''impedance matching method.'' The theory and its range of validity are described
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict
[Diagnosis and treatment characteristics of head-wind sha in She medicine].
Zou, Guangyi; Xu, Xiangdong; Zheng, Songming; Yan, Lianhe; Lei, Houxing; Zhang, Qiao-ling; Xiang, Yingmei; Ye, Yiping; Song, Liwei
2015-03-01
The diagnosis and treatment characteristics of head-wind sha in She medicine were analyzed and summarized. By visiting She-nationality villages and towns in Zhejiang province and Fujian province and interviewing hundreds of doctors of She medicine, the sha diagnosis, sha differentiation, experience and theory of treatment were arranged, and a comprehensive summary on theory and application of head-wind sha in She medicine such as pathogeny, name of disease, mechanism, diagnosis, differential diagnosis and treatment was made. It is believed that the methods of diagnosis and treatment in She medicine for head-wind sha could effectively enhance curative effect, safety and patients' quality of life, and the further research should be carried out.
LDPC and SHA based iris recognition for image authentication
Directory of Open Access Journals (Sweden)
K. Seetharaman
2012-11-01
Full Text Available We introduce a novel way to authenticate an image using Low Density Parity Check (LDPC and Secure Hash Algorithm (SHA based iris recognition method with reversible watermarking scheme, which is based on Integer Wavelet Transform (IWT and threshold embedding technique. The parity checks and parity matrix of LDPC encoding and cancellable biometrics i.e., hash string of unique iris code from SHA-512 are embedded into an image for authentication purpose using reversible watermarking scheme based on IWT and threshold embedding technique. Simply by reversing the embedding process, the original image, parity checks, parity matrix and SHA-512 hash are extracted back from watermarked-image. For authentication, the new hash string produced by employing SHA-512 on error corrected iris code from live person is compared with hash string extracted from watermarked-image. The LDPC code reduces the hamming distance for genuine comparisons by a larger amount than for the impostor comparisons. This results in better separation between genuine and impostor users which improves the authentication performance. Security of this scheme is very high due to the security complexity of SHA-512, which is 2256 under birthday attack. Experimental results show that this approach can assure more accurate authentication with a low false rejection or false acceptance rate and outperforms the prior arts in terms of PSNR.
CSIR Research Space (South Africa)
Motara, YM
2017-09-01
Full Text Available the intersection between the SHA-1 preimage problem, the encoding of that problem for SAT-solving, and SAT-solving. The results demonstrate that SAT-solving is not yet a viable approach to take to solve the preimage problem, and also indicate that some...
International Nuclear Information System (INIS)
Rigg, P.A.; Gupta, Y.M.
2000-01-01
Experimental methods using both single and multiple x-ray diffraction were developed to determine real time, lattice deformation in directions parallel and perpendicular to shock wave propagation in single crystals subjected to plate impact loading. Initial experiments used single diffraction to monitor the interplanar spacing change, parallel to the shock propagation direction, in LiF crystals shocked along the [111] and [100] directions. These measurements, in combination with the macroscopic volume compression, were used to determine the state of compression of the unit cell. Subsequent development of a multiple diffraction technique permitted simultaneous determination of both the longitudinal and transverse lattice deformations. The present results showed that shock compression, below 4 GPa, along the [111] orientation--which results in macroscopic elastic deformation - produced one-dimensional unit cell compression. In contrast, shock compression along the [100] orientation - which results in macroscopic elastic-plastic deformation--produced isotropic unit cell compression. The implications of the present results and the ability to make quantitative x-ray diffraction measurements under shock loading are discussed
Second-Preimage Analysis of Reduced SHA-1
DEFF Research Database (Denmark)
Rechberger, Christian
2010-01-01
Many applications using cryptographic hash functions do not require collision resistance, but some kind of preimage resistance. That's also the reason why the widely used SHA-1 continues to be recommended in all applications except digital signatures after 2010. Recent work on preimage and second...
Directory of Open Access Journals (Sweden)
Zahid Raja
Full Text Available Antimicrobial peptides (AMPs are promising drugs to kill resistant pathogens. In contrast to bacteria, protozoan parasites, such as Leishmania, were little studied. Therefore, the antiparasitic mechanism of AMPs is still unclear. In this study, we sought to get further insight into this mechanism by focusing our attention on temporin-SHa (SHa, a small broad-spectrum AMP previously shown to be active against Leishmania infantum. To improve activity, we designed analogs of SHa and compared the antibacterial and antiparasitic mechanisms. [K3]SHa emerged as a highly potent compound active against a wide range of bacteria, yeasts/fungi, and trypanosomatids (Leishmania and Trypanosoma, with leishmanicidal intramacrophagic activity and efficiency toward antibiotic-resistant strains of S. aureus and antimony-resistant L. infantum. Multipassage resistance selection demonstrated that temporins-SH, particularly [K3]SHa, are not prone to induce resistance in Escherichia coli. Analysis of the mode of action revealed that bacterial and parasite killing occur through a similar membranolytic mechanism involving rapid membrane permeabilization and depolarization. This was confirmed by high-resolution imaging (atomic force microscopy and field emission gun-scanning electron microscopy. Multiple combined techniques (nuclear magnetic resonance, surface plasmon resonance, differential scanning calorimetry allowed us to detail peptide-membrane interactions. [K3]SHa was shown to interact selectively with anionic model membranes with a 4-fold higher affinity (KD = 3 x 10-8 M than SHa. The amphipathic α-helical peptide inserts in-plane in the hydrophobic lipid bilayer and disrupts the acyl chain packing via a detergent-like effect. Interestingly, cellular events, such as mitochondrial membrane depolarization or DNA fragmentation, were observed in L. infantum promastigotes after exposure to SHa and [K3]SHa at concentrations above IC50. Our results indicate that these
Mapping PetaSHA Applications to TeraGrid Architectures
Cui, Y.; Moore, R.; Olsen, K.; Zhu, J.; Dalguer, L. A.; Day, S.; Cruz-Atienza, V.; Maechling, P.; Jordan, T.
2007-12-01
The Southern California Earthquake Center (SCEC) has a science program in developing an integrated cyberfacility - PetaSHA - for executing physics-based seismic hazard analysis (SHA) computations. The NSF has awarded PetaSHA 15 million allocation service units this year on the fastest supercomputers available within the NSF TeraGrid. However, one size does not fit all, a range of systems are needed to support this effort at different stages of the simulations. Enabling PetaSHA simulations on those TeraGrid architectures to solve both dynamic rupture and seismic wave propagation have been a challenge from both hardware and software levels. This is an adaptation procedure to meet specific requirements of each architecture. It is important to determine how fundamental system attributes affect application performance. We present an adaptive approach in our PetaSHA application that enables the simultaneous optimization of both computation and communication at run-time using flexible settings. These techniques optimize initialization, source/media partition and MPI-IO output in different ways to achieve optimal performance on the target machines. The resulting code is a factor of four faster than the orignial version. New MPI-I/O capabilities have been added for the accurate Staggered-Grid Split-Node (SGSN) method for dynamic rupture propagation in the velocity-stress staggered-grid finite difference scheme (Dalguer and Day, JGR, 2007), We use execution workflow across TeraGrid sites for managing the resulting data volumes. Our lessons learned indicate that minimizing time to solution is most critical, in particular when scheduling large scale simulations across supercomputer sites. The TeraShake platform has been ported to multiple architectures including TACC Dell lonestar and Abe, Cray XT3 Bigben and Blue Gene/L. Parallel efficiency of 96% with the PetaSHA application Olsen-AWM has been demonstrated on 40,960 Blue Gene/L processors at IBM TJ Watson Center. Notable
Effects of Gua-Sha therapy on breast engorgement: a randomized controlled trial.
Chiu, Jin-Yu; Gau, Meei-Ling; Kuo, Shu-Yu; Chang, Yung-Hsien; Kuo, Su-Chen; Tu, Hui-Chuan
2010-03-01
Breast engorgement is a common problem that affects the initiation and duration of breastfeeding. Limited solutions are available to relieve the discomfort associated with breast engorgement. Thus, further investigation of methods to achieve effective relief of symptoms is critical to promote breastfeeding success. : The purpose of this study was to determine the effects of two breast care methods, that is, scraping (Gua-Sha) therapy (administered to the experimental group) and traditional breast care (i.e., massage and heating; administered to the control group). A randomized controlled trial was conducted on 54 postpartum women at a Level III medical teaching hospital. Participant inclusion criteria included postpartum breastfeeding women (a) who had an uncomplicated delivery and (b) who were experiencing breast engorgement problems. The Gua-Sha protocol selected appropriate acupoint positions, which included ST16, ST18, SP17, and CV17. Each position was lightly scraped seven times in two cycles. For the control group, we used hot packs and massage for 20 min in accordance with recommendations given in an obstetrical technique textbook. Results showed no statistical differences between the two groups at baseline. Body temperature, breast temperature, breast engorgement, pain levels, and discomforting levels were statistically different between the two groups at 5 and 30 min after intervention (p account. Our findings provided empirical evidence supporting that Gua-Sha therapy may be used as an effective technique in the management of breast engorgement. By using Gua-Sha therapy, nurses can handle breast engorgement problems more effectively in primary care and hence help patients both physically and psychologically.
O'Brien, E C; Farkas, E; Gil, M J; Fitzgerald, D; Castineras, A; Nolan, K B
2000-04-01
Stability constants of iron(III), copper(II), nickel(II) and zinc(II) complexes of salicylhydroxamic acid (H2Sha), anthranilic hydroxamic acid (HAha) and benzohydroxamic acid (HBha) have been determined at 25.0 degrees C, I=0.2 mol dm(-3) KCl in aqueous solution. The complex stability order, iron(III) > copper(II) > nickel(II) approximately = zinc(II) was observed whilst complexes of H2Sha were found to be more stable than those of the other two ligands. In the preparation of ternary metal ion complexes of these ligands and 1,10-phenanthroline (phen) the crystalline complex [Cu(phen)2(Cl)]Cl x H2Sha was obtained and its crystal structure determined. This complex is a model for hydroxamate-peroxidase inhibitor interactions.
Laser shock peening of titanium 6-4 alloy
International Nuclear Information System (INIS)
Brar, N.S.; Hopkins, A.; Laber, M.W.
2000-01-01
Laser shock peening of titanium 6-4 has been shown to improve its high cycle fatigue life. Residual compressive stresses generated on the surface of titanium 6-4, as a result of laser shocking, have shown dramatic improvement in the performance of aircraft turbine blades. Laser shocking of titanium was carried out with a 20 ns pulse width, 50 joule pulsed laser, operated by LSP Technologies, Columbus, OH. Titanium disks, 20-mm in diameter, and ranging in thicknesses from zero (bare LiF) to 3-mm were subjected to laser shock to monitor amplitude and temporal stress profiles of the pulsed laser. Laser shock stress amplitudes on the back of titanium disks were monitored with VISAR using LiF as the window material. The peak shock stress produced in LiF (titanium thickness zero) was measured to be 16±1 GPa. The laser shock amplitude decays to about 2.7 GPa while propagating through 3-mm thick disk of titanium 6-4
D.SYM.4 SHA-3 Design and Cryptanalysis Report
DEFF Research Database (Denmark)
Gauravaram, Praveen; Thomsen, Søren Steffen
2011-01-01
The competition to select a new secure hash function standard SHA-3 was initiated in response to surprising progress in the cryptanalysis of existing hash function constructions that started in 2004. In this report we survey design and cryptanalytic results of those 14 candidates that remain in t...
On security arguments of the second round SHA-3 candidates
DEFF Research Database (Denmark)
Andreeva, Elena; Bogdanov, Andrey; Mennink, Bart
2012-01-01
of which got accepted to the first round. 14 candidates were left in the second round, out of which five candidates have been recently chosen for the final round. An important criterion in the selection process is the SHA-3 hash function security. We identify two important classes of security arguments...... for the new designs: (1) the possible reductions of the hash function security to the security of its underlying building blocks and (2) arguments against differential attack on building blocks. In this paper, we compare the state of the art provable security reductions for the second round candidates...... and review arguments and bounds against classes of differential attacks.We discuss all the SHA-3 candidates at a high functional level, analyze, and summarize the security reduction results and bounds against differential attacks. Additionally, we generalize the well-known proof of collision resistance...
Raineki, Charlis; Shionoya, Kiseko; Sander, Kristin; Sullivan, Regina M.
2009-01-01
Both odor-preference and odor-aversion learning occur in perinatal pups before the maturation of brain structures that support this learning in adults. To characterize the development of odor learning, we compared three learning paradigms: (1) odor-LiCl (0.3M; 1% body weight, ip) and (2) odor-1.2-mA shock (hindlimb, 1sec)--both of which…
A one-time pad color image cryptosystem based on SHA-3 and multiple chaotic systems
Wang, Xingyuan; Wang, Siwei; Zhang, Yingqian; Luo, Chao
2018-04-01
A novel image encryption algorithm is proposed that combines the SHA-3 hash function and two chaotic systems: the hyper-chaotic Lorenz and Chen systems. First, 384 bit keystream hash values are obtained by applying SHA-3 to plaintext. The sensitivity of the SHA-3 algorithm and chaotic systems ensures the effect of a one-time pad. Second, the color image is expanded into three-dimensional space. During permutation, it undergoes plane-plane displacements in the x, y and z dimensions. During diffusion, we use the adjacent pixel dataset and corresponding chaotic value to encrypt each pixel. Finally, the structure of alternating between permutation and diffusion is applied to enhance the level of security. Furthermore, we design techniques to improve the algorithm's encryption speed. Our experimental simulations show that the proposed cryptosystem achieves excellent encryption performance and can resist brute-force, statistical, and chosen-plaintext attacks.
Li, Mingyang; Zheng, Ang; Duan, Wenjuan; Mu, Xin; Liu, Chunli; Yang, Yang; Wang, Xin
2018-06-01
System of Health Accounts 2011 (SHA 2011) is a new health care accounts system, revised from SHA 1.0 by the Organisation for Economic Co-operation and Development (OECD), the World Health Organization (WHO) and Eurostat. It keeps the former tri-axial relationship and develops three analytical interfaces, in order to fix the existing shortcomings and make it more convenient for analysis and comparison across countries. SHA 2011 was introduced in China in 2014, and little about its application in China has been reported. This study takes children as an example to study how to apply SHA 2011 at the subnational level in the practical situation of China's health system. Multistage random sampling method was applied and 3 532 517 samples from 252 institutions were included in the study. Official yearbooks and account reports helped the estimation of provincial data. The formula to calculate Current Health Expenditure (CHE) was introduced step-by-step. STATA 10.0 was used for statistics. Under the frame of SHA 2011, the CHE for children in Liaoning was calculated as US$ 0.74 billion in 2014; 98.56% of the expenditure was spent in hospital and the allocation to primary health care institutions was insufficient. Infection, maternal and prenatal diseases cost the most in terms of Global Burden of Disease (GBD), and respiratory system diseases took the leading place in terms of International Classification of Disease Tenth Revision (ICD-10). In addition, medical income contributed most to the health financing. The method to apply SHA 2011 at the subnational level is feasible in China. It makes health accounts more adaptable to rapidly developing health systems and makes the financing data more readily available for analytical use. SHA 2011 is a better health expenditure accounts system to reveal the actual burden on residents and deserves further promotion in China as well as around the world.
A comparative study of Message Digest 5(MD5) and SHA256 algorithm
Rachmawati, D.; Tarigan, J. T.; Ginting, A. B. C.
2018-03-01
The document is a collection of written or printed data containing information. The more rapid advancement of technology, the integrity of a document should be kept. Because of the nature of an open document means the document contents can be read and modified by many parties so that the integrity of the information as a content of the document is not preserved. To maintain the integrity of the data, it needs to create a mechanism which is called a digital signature. A digital signature is a specific code which is generated from the function of producing a digital signature. One of the algorithms that used to create the digital signature is a hash function. There are many hash functions. Two of them are message digest 5 (MD5) and SHA256. Those both algorithms certainly have its advantages and disadvantages of each. The purpose of this research is to determine the algorithm which is better. The parameters which used to compare that two algorithms are the running time and complexity. The research results obtained from the complexity of the Algorithms MD5 and SHA256 is the same, i.e., ⊖ (N), but regarding the speed is obtained that MD5 is better compared to SHA256.
Temperature measurement of tin under shock compression
International Nuclear Information System (INIS)
Hereil, Pierre-Louis; Mabire, Catherine
2002-01-01
The results of pyrometric measurements performed at the interface of a tin target with a LiF window material are presented for stresses ranging from 38 to 55 GPa. The purpose of the study is to analyze the part of the interface in the temperature measurement by a multi-channel pyrometric device. The results show that the glue used at target/window interface remains transparent under shock. The values of temperature measured at the tin/LiF interface are consistent with the behavior of tin under shock
BioShaDock: a community driven bioinformatics shared Docker-based tools registry.
Moreews, François; Sallou, Olivier; Ménager, Hervé; Le Bras, Yvan; Monjeaud, Cyril; Blanchet, Christophe; Collin, Olivier
2015-01-01
Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.
Data harmonization and federated analysis of population-based studies : the BioSHaRE project
Doiron, Dany; Burton, Paul; Marcon, Yannick; Gaye, Amadou; Wolffenbuttel, Bruce H R; Perola, Markus; Stolk, Ronald P; Foco, Luisa; Minelli, Cosetta; Waldenberger, Melanie; Holle, Rolf; Kvaløy, Kirsti; Hillege, Hans L; Tassé, Anne-Marie; Ferretti, Vincent; Fortier, Isabel
2013-01-01
ABSTRACTS BACKGROUND: Individual-level data pooling of large population-based studies across research centres in international research projects faces many hurdles. The BioSHaRE (Biobank Standardisation and Harmonisation for Research Excellence in the European Union) project aims to address these
Side channel analysis of some hash based MACs: A response to SHA-3 requirements
DEFF Research Database (Denmark)
Gauravaram, Praveen; Okeya, Katsuyuki
2008-01-01
The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...
Triyono, Joko; Rizha, Yushak; Triyono, Teguh
2018-04-01
The use of biomaterials in orthopedics is increasing. This led to the growth of innovations in the field of medicine, one of them is the development of biomaterials. Study of Sheep Hydroxyapatite (SHA)/shellac/sugar biocomposite characterization was to determine the phase of the material, porosity, hardness and compressive strength of them. This research was conducted to develop new types of biomaterials that can be used as bone filler material. The analysis that used in this research was dry methods. The results showed that observation of XRD (X-Ray Diffraction) shows the pattern of diffraction 2θ: 31.6472°, 32.7753°, 32.0723°, The highest hardness of SHA/shellac/sugar ratio was 70:30% (7.38±0.1395 VHN) and the lowest at 50:50% (4.91±0.37 VHN). The highest Diametral Tensile Strength (DTS) test was 70:30% (5.43±1.395 MPa) and the lowest at 50:50% (3.10±0.26 MPa). SEM observations are performed to see the material porosity.
Shock induced melting of lead (experimental study)
International Nuclear Information System (INIS)
Mabire, Catherine; Hereil, Pierre L.
2002-01-01
To investigate melting on release of lead, two shock compression measurements have been carried out at 51 GPa. In the first one, a pyrometric measurement has been performed at the Pb/LiF interface. In the second one, the Pb/LiF interface velocity has been recorded using VISAR measurement technique. VISAR and radiance profile are in good agreement and seem to show melting on release of lead
Shock compression experiments on Lithium Deuteride (LiD) single crystals
Knudson, M. D.; Desjarlais, M. P.; Lemke, R. W.
2016-12-01
Shock compression experiments in the few hundred GPa (multi-Mbar) regime were performed on Lithium Deuteride single crystals. This study utilized the high velocity flyer plate capability of the Sandia Z Machine to perform impact experiments at flyer plate velocities in the range of 17-32 km/s. Measurements included pressure, density, and temperature between ˜190 and 570 GPa along the Principal Hugoniot—the locus of end states achievable through compression by large amplitude shock waves—as well as pressure and density of reshock states up to ˜920 GPa. The experimental measurements are compared with density functional theory calculations, tabular equation of state models, and legacy nuclear driven results that have been reanalyzed using modern equations of state for the shock wave standards used in the experiments.
Directory of Open Access Journals (Sweden)
François Moreews
2015-12-01
Full Text Available Linux container technologies, as represented by Docker, provide an alternative to complex and time-consuming installation processes needed for scientific software. The ease of deployment and the process isolation they enable, as well as the reproducibility they permit across environments and versions, are among the qualities that make them interesting candidates for the construction of bioinformatic infrastructures, at any scale from single workstations to high throughput computing architectures. The Docker Hub is a public registry which can be used to distribute bioinformatic software as Docker images. However, its lack of curation and its genericity make it difficult for a bioinformatics user to find the most appropriate images needed. BioShaDock is a bioinformatics-focused Docker registry, which provides a local and fully controlled environment to build and publish bioinformatic software as portable Docker images. It provides a number of improvements over the base Docker registry on authentication and permissions management, that enable its integration in existing bioinformatic infrastructures such as computing platforms. The metadata associated with the registered images are domain-centric, including for instance concepts defined in the EDAM ontology, a shared and structured vocabulary of commonly used terms in bioinformatics. The registry also includes user defined tags to facilitate its discovery, as well as a link to the tool description in the ELIXIR registry if it already exists. If it does not, the BioShaDock registry will synchronize with the registry to create a new description in the Elixir registry, based on the BioShaDock entry metadata. This link will help users get more information on the tool such as its EDAM operations, input and output types. This allows integration with the ELIXIR Tools and Data Services Registry, thus providing the appropriate visibility of such images to the bioinformatics community.
Dávila Molina, Antonio Jesús
2007-01-01
En aquest projecte, s'ha dissenyat, construït i programat un robot autònom, dotat de sistema de locomoció i sensors que li permeten navegar sense impactar en un entorn controlat. Per assolir aquests objectius s'ha dissenyat i programat una unitat de control que gestiona el hardware de baix volum de dades amb diferents modes d'operació, abstraient-lo en una única interfície. Posteriorment s'ha integrat aquest sistema en l'entorn de robòtica Pyro. Aquest entorn permet usar i adaptar, segons es ...
Valensise, Gianluca; Barba, Salvatore; Basili, Roberto; Bonini, Lorenzo; Burrato, Pierfrancesco; Carafa, Michele; Kastelic, Vanja; Fracassi, Umberto; Maesano, Francesco Emanuele; Tarabusi, Gabriele; Tiberti, Mara Monica; Vannoli, Paola
2016-04-01
The vast majority of active faulting studies are performed at the scale of individual, presumably seismogenic faults or fault strands. Most SHA approaches and models, however, require homogeneus information on potential earthquake sources over the entire tectonic domain encompassing the site(s) of interest. Although it is out of question that accurate SHA must rely on robust investigations of individual potential earthquake sources, it is only by gathering this information in regionally extensive databases that one can address some of the most outstanding issues in the use of #Fault2SHA. We will briefly recall three issues that are particularly relevant in the investigation of seismogenic faulting in southern Europe. A fundamental challenge is the completeness of the geologic record of active faulting. In most tectonic environments many potential seismogenic faults are blind or hidden, or deform the lower crust without leaving a discernible signal at the surface, or occur offshore, or slip so slowly that nontectonic erosional-depositional processes easily outpace their surface effects. Investigating only well-expressed faults is scientifically rewarding but also potentially misleading as it draws attention on the least insidious faults, leading to a potential underestimation of the regional earthquake potential. A further issue concerns the hierarchy of fault systems. Most active faults do not comprise seismogenic sources per se but are part of larger systems, and slip only in conjunction with the master fault of each system. In the most insidious cases, only secondary faults are expressed at the surface while the master fault lies hidden beneath them. This may result in an overestimation of the true number of seismogenic sources that occur in each region and in a biased identification of the characteristics of the main player in each system. Recent investigations of geologic and geodetic vs earthquake release budgets have shown that the "seismic coupling", which
Thermophysical properties of multi-shock compressed dense argon.
Chen, Q F; Zheng, J; Gu, Y J; Chen, Y L; Cai, L C; Shen, Z J
2014-02-21
In contrast to the single shock compression state that can be obtained directly via experimental measurements, the multi-shock compression states, however, have to be calculated with the aid of theoretical models. In order to determine experimentally the multiple shock states, a diagnostic approach with the Doppler pins system (DPS) and the pyrometer was used to probe multiple shocks in dense argon plasmas. Plasma was generated by a shock reverberation technique. The shock was produced using the flyer plate impact accelerated up to ∼6.1 km/s by a two-stage light gas gun and introduced into the plenum argon gas sample, which was pre-compressed from the environmental pressure to about 20 MPa. The time-resolved optical radiation histories were determined using a multi-wavelength channel optical transience radiance pyrometer. Simultaneously, the particle velocity profiles of the LiF window was measured with multi-DPS. The states of multi-shock compression argon plasma were determined from the measured shock velocities combining the particle velocity profiles. We performed the experiments on dense argon plasmas to determine the principal Hugonoit up to 21 GPa, the re-shock pressure up to 73 GPa, and the maximum measure pressure of the fourth shock up to 158 GPa. The results are used to validate the existing self-consistent variational theory model in the partial ionization region and create new theoretical models.
Effective Shear Viscosity of Iron under Shock-Loading Condition
International Nuclear Information System (INIS)
Ma Xiao-Juan; Liu Fu-Sheng; Sun Yan-Yun; Zhang Ming-Jian; Peng Xiao-Juan; Li Yong-Hong
2011-01-01
We combine the flyer-impact experiment and improve the finite difference method to solve whether the shear viscosity coefficient of shock iron is more reliable. We find that the numerical simulated profile agrees well with the measured one, from which the determined effective shear viscosity coefficients of shocked iron are 3000 ± 100 Pa·s and 4000 ± 100 Pa·s, respectively, at 103 GPa and 159 GPa. These values are more than 2000 ± 300 Pa·s of Li Y L et al.[Chin. Phys. Lett. 26 (2009) 038301] Our values are more reasonable because they are obtained from a comprehensive simulation for the full-shocked perturbation evolving process. (fundamental areas of phenomenology(including applications))
van Heugten, L.
2013-01-01
In 2001, a music theatre production exploring Islam’s early history from a female perspective was shut down before it reached the stage. The cancellation of Aïsha and the Women of Madina by Rotterdam’s Independent Theatre (O.T.) generated a media storm as speculations about censorship mounted. To
A Clinical Study on the cases of The Pain Shock Patients after Korean Bee-Venom Therapy
Directory of Open Access Journals (Sweden)
Lee Jin-seon
2001-12-01
Full Text Available Objective:There has been no known report on the pain shock after administering Korean bee-venom therapy. Three accounts of pain shock were observed at the Sangji university affiliated Oriental medicine clinic from July 2001 through September 2001. This thesis will inform clinical progression and cautions on administering Korean bee-venom therapy. Method:We were able to witness different patterns of pain shock during the treatment of degenerative knee joint, progressive oral paralysis, and A.L.S. In order to reduce heat toxicity of the bee venom, needling points were first massaged with the ice for 10 minutes before injecting 0.1~0.2cc of the bee venom. Points of injection were ST36, LI11, LI4 and others. Pain shock occurred after injecting on inner xi-an, outer xi-an and LI4. The phenomena associated with pain shock was recorded in chronological order and local changes were examined. Result Through examining 3 patients with the pain shock, we managed to observe clinical progression, duration, and time linked changes on specific regions. We also managed to determine sensitive needling points for the pain shock. Conclusion:Following results were obtained from 3 patients with the pain shock caused by Korean bee-venom therapy from July 2001 to September 2001. 1. Either positive or negative responses were shown after the pain shock. For case 1, extreme pain was accompanied with muscular convulsion and tremble, ocular hyperemia, delirium, stiffening of extremities, and hyper ventilation which all suggest positive responses. For case 2 and 3, extreme pain was accompanied with facial sweating, asthenia of extremities, pallor face, dizziness, weak voice, and sleepiness which are the signs of negative responses. 2. The time required to recover to stable state took nearly an hour (including sleeping time and there was no side effect. 3. Precautions required to prevent the pain shock includes full concentration from the practitioner, accurate point
Triton and alpha-particle contribution from LiF converter for neutron dosimeter
Camacho, M E; Balcazar, M
1999-01-01
A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.
Evolution of elastic x-ray scattering in laser-shocked warm dense lithium.
Kugland, N L; Gregori, G; Bandyopadhyay, S; Brenner, C M; Brown, C R D; Constantin, C; Glenzer, S H; Khattak, F Y; Kritcher, A L; Niemann, C; Otten, A; Pasley, J; Pelka, A; Roth, M; Spindloe, C; Riley, D
2009-12-01
We have studied the dynamics of warm dense Li with near-elastic x-ray scattering. Li foils were heated and compressed using shock waves driven by 4-ns-long laser pulses. Separate 1-ns-long laser pulses were used to generate a bright source of 2.96 keV Cl Ly- alpha photons for x-ray scattering, and the spectrum of scattered photons was recorded at a scattering angle of 120 degrees using a highly oriented pyrolytic graphite crystal operated in the von Hamos geometry. A variable delay between the heater and backlighter laser beams measured the scattering time evolution. Comparison with radiation-hydrodynamics simulations shows that the plasma is highly coupled during the first several nanoseconds, then relaxes to a moderate coupling state at later times. Near-elastic scattering amplitudes have been successfully simulated using the screened one-component plasma model. Our main finding is that the near-elastic scattering amplitudes are quite sensitive to the mean ionization state Z[over ] and by extension to the choice of ionization model in the radiation-hydrodynamics simulations used to predict plasma properties within the shocked Li.
Evolution of elastic x-ray scattering in laser-shocked warm dense lithium
International Nuclear Information System (INIS)
Kugland, N. L.; Niemann, C.; Gregori, G.; Bandyopadhyay, S.; Spindloe, C.; Brenner, C. M.; Brown, C. R. D.; Constantin, C.; Glenzer, S. H.; Khattak, F. Y.; Kritcher, A. L.; Otten, A.; Pelka, A.; Roth, M.; Pasley, J.; Riley, D.
2009-01-01
We have studied the dynamics of warm dense Li with near-elastic x-ray scattering. Li foils were heated and compressed using shock waves driven by 4-ns-long laser pulses. Separate 1-ns-long laser pulses were used to generate a bright source of 2.96 keV Cl Ly-α photons for x-ray scattering, and the spectrum of scattered photons was recorded at a scattering angle of 120 deg. using a highly oriented pyrolytic graphite crystal operated in the von Hamos geometry. A variable delay between the heater and backlighter laser beams measured the scattering time evolution. Comparison with radiation-hydrodynamics simulations shows that the plasma is highly coupled during the first several nanoseconds, then relaxes to a moderate coupling state at later times. Near-elastic scattering amplitudes have been successfully simulated using the screened one-component plasma model. Our main finding is that the near-elastic scattering amplitudes are quite sensitive to the mean ionization state Z and by extension to the choice of ionization model in the radiation-hydrodynamics simulations used to predict plasma properties within the shocked Li.
Directory of Open Access Journals (Sweden)
Godefroit J.-L.
2012-08-01
Full Text Available Conventional shock wave experiments need interferometric windows in order to determine the equation of state of a large variety of metals. Lithium fluoride (LiF and sapphire are extensively used for that purpose because their optical transparencies enable the optical diagnostics at interfaces under a given range of shock pressure. In order to simulate and analyse the experiments it is necessary to gather a correct knowledge of the optical and mechanical properties of these windows. Therefore, our window supplies are systematically characterized and an experimental campaign under shock loading is conducted. Our preliminary work on LiF windows at 532 nm is in good agreement with literature data at room temperature and the new characterization at 450 K enables a better interpretation of our preheated target experiments. It confirms the predominant effect of density on optical properties under pressure and temperature. The present work demonstrates that the initial density determination is a key point and that the uncertainties need to be improved. For that purpose, complementary experiments are conducted on LiF windows with simplified target designs and enriched diagnostics, coupling VISAR (532 nm and PdV (1550 nm diagnostics. Furthermore, a similar campaign is conducted on sapphire windows with symmetric impact configuration.
Dynamic strength behavior of a Zr-based bulk metallic glass under shock loading
International Nuclear Information System (INIS)
Yu Yu-Ying; Xi Feng; Dai Cheng-Da; Cai Ling-Cang; Tan Ye; Li Xue-Mei; Wu Qiang; Tan Hua
2015-01-01
Dynamic strength behavior of Zr 51 Ti 5 Ni 10 Cu 25 Al 9 bulk metallic glass (BMG) up to 66 GPa was investigated in a series of plate impact shock-release and shock-reload experiments. Particle velocity profiles measured at the sample/LiF window interface were used to estimate the shear stress, shear modulus, and yield stress in shocked BMG. Beyond confirming the previously reported strain-softening of shear stress during the shock loading process for BMGs, it is also shown that the softened Zr-BMG still has a high shear modulus and can support large yield stress when released or reloaded from the shocked state, and both the shear modulus and the yield stress appear as strain-hardening behaviors. The work provides a much clearer picture of the strength behavior of BMGs under shock loading, which is useful to comprehensively understand the plastic deformation mechanisms of BMGs. (paper)
Lu, Zhihua; Lin, Guiting; Reed-Maldonado, Amanda; Wang, Chunxi; Lee, Yung-Chin; Lue, Tom F
2017-02-01
As a novel therapeutic method for erectile dysfunction (ED), low-intensity extracorporeal shock wave treatment (LI-ESWT) has been applied recently in the clinical setting. We feel that a summary of the current literature and a systematic review to evaluate the therapeutic efficacy of LI-ESWT for ED would be helpful for physicians who are interested in using this modality to treat patients with ED. A systematic review of the evidence regarding LI-ESWT for patients with ED was undertaken with a meta-analysis to identify the efficacy of the treatment modality. A comprehensive search of the PubMed and Embase databases to November 2015 was performed. Studies reporting on patients with ED treated with LI-ESWT were included. The International Index of Erectile Function (IIEF) and the Erection Hardness Score (EHS) were the most commonly used tools to evaluate the therapeutic efficacy of LI-ESWT. There were 14 studies including 833 patients from 2005 to 2015. Seven studies were randomized controlled trials (RCTs); however, in these studies, the setup parameters of LI-ESWT and the protocols of treatment were variable. The meta-analysis revealed that LI-ESWT could significantly improve IIEF (mean difference: 2.00; 95% confidence interval [CI], 0.99-3.00; pwaves per treatment, and duration of LI-ESWT treatment were closely related to clinical outcome, especially regarding IIEF improvement. The number of studies of LI-ESWT for ED have increased dramatically in recent years. Most of these studies presented encouraging results, regardless of variation in LI-ESWT setup parameters or treatment protocols. These studies suggest that LI-ESWT could significantly improve the IIEF and EHS of ED patients. The publication of robust evidence from additional RCTs and longer-term follow-up would provide more confidence regarding use of LI-ESWT for ED patients. We reviewed 14 studies of men who received low-intensity extracorporeal shock wave treatment (LI-ESWT) for erectile dysfunction (ED
Determining the refractive index of shocked [100] lithium fluoride to the limit of transmissibility
International Nuclear Information System (INIS)
Rigg, P. A.; Scharff, R. J.; Hixson, R. S.; Knudson, M. D.
2014-01-01
Lithium fluoride (LiF) is a common window material used in shock- and ramp-compression experiments because it displays a host of positive attributes in these applications. Most commonly, it is used to maintain stress at an interface and velocimetry techniques are used to record the particle velocity at that interface. In this application, LiF remains transparent to stresses up to 200 GPa. In this stress range, LiF has an elastic-plastic response with a very low (<0.5 GPa) elastic precursor and exhibits no known solid-solid phase transformations. However, because the density dependence of the refractive index of LiF does not follow the Gladstone-Dale relation, the measured particle velocity at this interface is not the true particle velocity and must be corrected. For that reason, the measured velocity is often referred to as the apparent velocity in these types of experiments. In this article, we describe a series of shock-compression experiments that have been performed to determine the refractive index of LiF at the two most commonly used wavelengths (532 nm and 1550 nm) between 35 and 200 GPa to high precision. A modified form of the Gladstone-Dale relation was found to work best to fit the determined values of refractive index. In addition, we provide a direct relationship between the apparent and true particle velocity to correct experimentally obtained wave profiles by others using these velocimetry techniques.
Quaternary system LiF-LiCl-LiVO3-Li2MoO4
International Nuclear Information System (INIS)
Anipchenko, B.V.; Garkushin, I.K.
2000-01-01
Interactions in the LiF-LiCl-LiVO 3 -Li 2 MoO 4 system are studied by differential thermal analysis. Rate of heating/cooling of the samples comprised 15 Grad/min, mass of sample composed 0.2 g. The system was investigated in the 300-650 Deg C range. X-ray diffraction method was used for determination of purity of the reagents. Composition and temperature of quaternary component eutectics are determined: 16.5 mol. % of LiF, 47.0 mol. % of LiCl, 28.8 mol. % of LiVO 3 , 7.6 mol. % of Li 2 MoO 4 ; 387 Deg C. Mean value of melting enthalpy of quaternary eutectics mixture in the LiF-LiCl-LiVO 3 -Li 2 MoO 4 system on the results of the tests was in the range of 222 kJ/kg [ru
Directory of Open Access Journals (Sweden)
I. M. Robinson
2005-07-01
Full Text Available We examine the solar energetic particle event following solar activity from 14, 15 April 2001 which includes a "bump-on-the-tail" in the proton energy spectra at 0.99 AU from the Sun. We find this population was generated by a CME-driven shock which arrived at 0.99 AU around midnight 18 April. As such this population represents an excellent opportunity to study in isolation, the effects of proton acceleration by the shock. The peak energy of the bump-on-the-tail evolves to progressively lower energies as the shock approaches the observing spacecraft at the inner Lagrange point. Focusing on the evolution of this peak energy we demonstrate a technique which transforms these in-situ spectral observations into a frame of reference co-moving with the shock whilst making allowance for the effects of pitch angle scattering and focusing. The results of this transform suggest the bump-on-the-tail population was not driven by the 15 April activity but was generated or at least modulated by a CME-driven shock which left the Sun on 14 April. The existence of a bump-on-the-tail population is predicted by models in Rice et al. (2003 and Li et al. (2003 which we compare with observations and the results of our analysis in the context of both the 14 April and 15 April CMEs. We find an origin of the bump-on-the-tail at the 14 April CME-driven shock provides better agreement with these modelled predictions although some discrepancy exists as to the shock's ability to accelerate 100 MeV protons.
Keywords. Solar physics, astrophysics and astronomy (Energetic particles; Flares and mass ejections – Space plasma physics (Transport processes
Shock compression experiments on Lithium Deuteride single crystals.
Energy Technology Data Exchange (ETDEWEB)
Knudson, Marcus D.; Desjarlais, Michael Paul; Lemke, Raymond W.
2014-10-01
S hock compression exper iments in the few hundred GPa (multi - Mabr) regime were performed on Lithium Deuteride (LiD) single crystals . This study utilized the high velocity flyer plate capability of the Sandia Z Machine to perform impact experiments at flyer plate velocities in the range of 17 - 32 km/s. Measurements included pressure, density, and temperature between %7E200 - 600 GPa along the Principal Hugoniot - the locus of end states achievable through compression by large amplitude shock waves - as well as pressure and density of re - shock states up to %7E900 GPa . The experimental measurements are compared with recent density functional theory calculations as well as a new tabular equation of state developed at Los Alamos National Labs.
Allcott, Glenn H.
1970-01-01
The mineralized zone at the remotely located Ash Sha'ib ancient mine contains only a small tonnage of moderately low grade sulfide- bearing rock. Based on present data the gross value of the deposit, with a value of $25.00 or more per ton, is $20,000,000. A belt of metasedimentary rocks, intruded by gabbro to the south and granite to the north, was the host for fissure vein-replacement type mineralization. Most of the mineralization is in a siliceous dolomite transected by fissures. The main sulfide mineral is sphalerite, but minor amounts of chalcopyrlte and argentlferous galena contribute to the value of the mineralized sections.
Energy Technology Data Exchange (ETDEWEB)
George, Sony [ISP, Cochin University of Science and Tech., Cochin 682 022 (India); Singh, R.K., E-mail: rajesh@ipr.res.in [Institute for Plasma Research, Gandhinagar 382 428 (India); Nampoori, V.P.N. [ISP, Cochin University of Science and Tech., Cochin 682 022 (India); Kumar, Ajai [Institute for Plasma Research, Gandhinagar 382 428 (India)
2013-01-17
A systemic investigation of expansion dynamics of plasma plume, produced by laser-blow-off of LiF–C thin film has been done with emphasis on the formation of shock wave and their dependence on the pressure and nature of the ambient gas. The present results demonstrate that highly directional plume produces a strong shock wave in comparison to shock produced by the diverging plume. Shock-velocity, strength and its structure are strongly dependent on ambient environment; maximum shock velocity is observed in helium whereas shock strength is highest in argon environment. The role of chemically reactive processes was not observed in the present case as the plume structure is almost similar in argon and oxygen.
Electrochemical Behavior of LiBr, LiI, and Li2Se in LiCl Molten Salt
International Nuclear Information System (INIS)
Choi, In Kyu; Do, Jae Bum; Hong, Sun Seok; Seo, Chung Seok
2006-03-01
The effect of fission products on the electrolytic reduction of uranium oxide has been studied. It has been reported that volatile fission products, such as Br, I, and Se, react with Li metal which is a reductant in the process to give LiBr, LiI, and Li 2 Se. These compounds are dissociated as corresponding anions and cations in the LiCl molten salt at 650 .deg. C. In this experiment, oxidation and reduction reaction of 3wt% of each compound in LiCl molten salt were investigated by cyclic voltammetry. For LiBr, redox reactions of cation and anion were reversible, while redox reactions of Li + and I - were irreversible. For Li 2 Se, about half of the produced Li metal was disappeared at the cathode and two anodic current curves were appeared. After the cyclic voltammetric measurements for each compound, chronopotentiometric experiment was carried out for one hour with 100 - 400 mA. After the electrolysis, no compounds gave Li metal in the porous MgO filter in which Li metal was produced at the cathode. However, LiCl salt was covered with Br 2 for LiBr electrolysis. Dark red color of Br 2 was easily removed by water. For LiI electrolysis, salt gave black color and I 2 was deposited on the Pt anode. For Li 2 Se electrolysis, black fine powders were precipitated in the salt. After the separation and dryness of the precipitates, it was analyzed with XRD and it turned out PtSe 2 . From the electrochemical experimental results, it was concluded that these compounds may affect the electrolytic reduction process of uranium oxide in the spent fuel
International Nuclear Information System (INIS)
Egorov, L.A.; Barenboim, A.I.; Mokhova, V.V.; Dorohin, V.V.; Samoilov, A.I.
1997-01-01
Currently, the only direct method to study behaviour of solid crystal substance structures under dynamic compression is method to record X-rays diffraction pictures of crystal structures under shock compression. Thepaper presents results of X-rays diffraction measurements concerning structural parameters of shock compressed substances at pressures higher than Hugoniot elastic limit (Be, Al, LiF, Fe+3%Si), lower than Hugoniot elastic limit (Si, SiO 2 , LiF) and in the area of pressures of phase transformation beginning (KCl, Si). Recorded states of shock-compressed substance structures demonstrate identity of structural deformations at pressures higher and lower than Hugoniot elastic limit as well as at pressures above the phase transformation point, which can be characterized as single-axial deformations. (orig.)
Comparing Shock geometry from MHD simulation to that from the Q/A-scaling analysis
Li, G.; Zhao, L.; Jin, M.
2017-12-01
In large SEP events, ions can be accelerated at CME-driven shocks to very high energies. Spectra of heavy ions in many large SEP events show features such as roll-overs or spectral breaks. In some events when the spectra are plotted in energy/nucleon they can be shifted relatively to each other so that the spectra align. The amount of shift is charge-to-mass ratio (Q/A) dependent and varies from event to event. In the work of Li et al. (2009), the Q/A dependences of the scaling is related to shock geometry when the CME-driven shock is close to the Sun. For events where multiple in-situ spacecraft observations exist, one may expect that different spacecraft are connected to different portions of the CME-driven shock that have different shock geometries, therefore yielding different Q/A dependence. At the same time, shock geometry can be also obtained from MHD simulations. This means we can compare shock geometry from two completely different approaches: one from MHD simulation and the other from in-situ spectral fitting. In this work, we examine this comparison for selected events.
Improved Reactive Flow Modeling of the LX-17 Double Shock Experiments
Rehagen, Thomas J.; Vitello, Peter
2017-06-01
Over driven double shock experiments provide a measurement of the properties of the reaction product states of the insensitive high explosive LX-17 (92.5% TATB and 7.5% Kel-F by weight). These experiments used two flyer materials mounted on the end of a projectile to send an initial shock through the LX-17, followed by a second shock of a higher magnitude into the detonation products. In the experiments, the explosive was initially driven by the flyer plate to pressures above the Chapman-Jouguet state. The particle velocity history was recorded by Photonic Doppler Velocimetry (PDV) probes pointing at an aluminum foil coated LiF window. The PDV data shows a sharp initial shock and decay, followed by a rounded second shock. Here, the experimental results are compared to 2D and 3D Cheetah reactive flow modeling. Our default Cheetah reactive flow model fails to accurately reproduce the decay of the first shock or the curvature or strength of the second shock. A new model is proposed in which the carbon condensate produced in the reaction zone is controlled by a kinetic rate. This allows the carbon condensate to be initially out of chemical equilibrium with the product gas. This new model reproduces the initial detonation peak and decay, and matches the curvature of the second shock, however, it still over-predicts the strength of the second shock. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract No. DE-AC52-07NA27344.
A high speed low power low offset dynamic comparator used in SHA-less pipelined ADC
Shubin, Liu; Zhangming, Zhu; Yintang, Yang; Lianxi, Liu
2014-05-01
A novel fully differential high speed high resolution low offset CMOS dynamic comparator has been implemented in the SMIC 0.18 μm process used for a sample-and-hold amplifier (SHA)-less pipelined analog-to-digital converters (ADC). Based on the analysis and optimization between delay time and offset, an enhanced reset architecture with transmission gate was introduced to speed up the comparison and reset procedure. Four inputs with two cross coupled differential pairs, reconstituted bias circuit for tail current transistor and common centroid layouts make the comparator more robust against mismatch and process variations. The simulation results demonstrate that the proposed design achieves 1 mV sensitivity at 2.2 GHz sampling rate with a power consumption of 510 μW, while the mean offset voltage is equal to 10.244 mV.
Side channel analysis of some hash based MACs:A response to SHA-3 requirements
DEFF Research Database (Denmark)
The forthcoming NIST's Advanced Hash Standard (AHS) competition to select SHA-3 hash function requires that each candidate hash function submission must have at least one construction to support FIPS 198 HMAC application. As part of its evaluation, NIST is aiming to select either a candidate hash...... function which is more resistant to known side channel attacks (SCA) when plugged into HMAC, or that has an alternative MAC mode which is more resistant to known SCA than the other submitted alternatives. In response to this, we perform differential power analysis (DPA) on the possible smart card...... implementations of some of the recently proposed MAC alternatives to NMAC (a fully analyzed variant of HMAC) and HMAC algorithms and NMAC/HMAC versions of some recently proposed hash and compression function modes. We show that the recently proposed BNMAC and KMDP MAC schemes are even weaker than NMAC...
Directory of Open Access Journals (Sweden)
I Gusti Made Panji Indrawinatha
2016-12-01
Full Text Available Virus komputer merupakan perangkat lunak berbahaya yang dapat merusak data dan menggandakan diri pada sistem komputer. Untuk mendeteksi dan membersihkan virus dari sistem komputer, maka dibuatlah aplikasi antivirus. Dalam mendeteksi berbagai jenis virus sebuah aplikasi antivirus biasanya menggunakan beberapa metode. Pada penelitian ini akan membahas perancangan sebuah aplikasi antivirus menggunakan metode Secure Hash Algorithm 1 (SHA1 dan heuristic string sebagai metode pendeteksian virus. Dari pengujian yang dilakukan diperoleh hasil dimana saat tidak menggunakan heuristic, antivirus hanya mendeteksi 12 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 35%. sedangkan saat menggunakan heuristic, antivirus berhasil mendeteksi 31 file dari 34 file sample virus atau memiliki tingkat akurasi pendeteksian sebesar 91%.
Fuel-coolant interactions in a shock-tube geometry
International Nuclear Information System (INIS)
Segev, A.; Henry, R.E.; Bankoff, S.G.
1978-01-01
Thermal interactions were studied in a shock tube configuration using different pairs of liquids. Large pressures were obtained for systems of water-Wood's metal and butanol-Wood's metal. Different types of interactions were observed, depending on the hot liquid temperature. It was found that thehydrodynamic component alone may account for the measured pressure in the lower temperature range. A combination of thermal and hydrodynamic interactions accounts for the pressures at high temperatures. Experiments with water and molten salt (LiCl + KCl) produced small scale explosions. All interactions were suppressed when driving pressure increased. (author)
Electronic Properties of LiFePO4 and Li doped LiFePO4
International Nuclear Information System (INIS)
Zhuang, G.V.; Allen, J.L.; Ross, P.N.; Guo, J.-H.; Jow, T.R.
2005-01-01
The potential use of different iron phosphates as cathode materials in lithium-ion batteries has recently been investigated.1 One of the promising candidates is LiFePO4. This compound has several advantages in comparison to the state-of-the-art cathode material in commercial rechargeable lithium batteries. Firstly, it has a high theoretical capacity (170 mAh/g). Secondly, it occurs as mineral triphylite in nature and is inexpensive, thermally stable, non-toxic and non-hygroscopic. However, its low electronic conductivity (∼10-9 S/cm) results in low power capability. There has been intense worldwide research activity to find methods to increase the electronic conductivity of LiFePO4, including supervalent ion doping,2 introducing non-carbonaceous network conduction3 and carbon coating, and the optimization of the carbon coating on LiFePO4 particle surfaces.4 Recently, the Li doped LiFePO4 (Li1+xFe1-xPO4) synthesized at ARL has yield electronic conductivity increase up to 106.5 We studied electronic structure of LiFePO4 and Li doped LiFePO4 by synchrotron based soft X-ray emission (XES) and X-ray absorption (XAS) spectroscopies. XAS probes the unoccupied partial density of states, while XES the occupied partial density of states. By combining XAS and XES measurements, we obtained information on band gap and orbital character of both LiFePO4 and Li doped LiFePO4. The occupied and unoccupied oxygen partial density of states (DOS) of LiFePO4 and 5 percent Li doped LiFePO4 are presented in Fig. 1. Our experimental results clearly indicate that LiFePO4 has wideband gap (∼ 4 eV). This value is much larger than what is predicted by DFT calculation. For 5 percent Li doped LiFePO4, a new doping state was created closer to the Fermi level, imparting p-type conductivity, consistent with thermopower measurement. Such observation substantiates the suggestion that high electronic conductivity in Li1.05Fe0.95 PO4 is due to available number of charge carriers in the material
Influence of defects on the thermal conductivity of compressed LiF
Jones, R. E.; Ward, D. K.
2018-02-01
Defect formation in LiF, which is used as an observation window in ramp and shock experiments, has significant effects on its transmission properties. Given the extreme conditions of the experiments it is hard to measure the change in transmission directly. Using molecular dynamics, we estimate the change in conductivity as a function of the concentration of likely point and extended defects using a Green-Kubo technique with careful treatment of size effects. With this data, we form a model of the mean behavior and its estimated error; then, we use this model to predict the conductivity of a large sample of defective LiF resulting from a direct simulation of ramp compression as a demonstration of the accuracy of its predictions. Given estimates of defect densities in a LiF window used in an experiment, the model can be used to correct the observations of thermal energy through the window. In addition, the methodology we develop is extensible to modeling, with quantified uncertainty, the effects of a variety of defects on the thermal conductivity of solid materials.
Corrosion of type 316 stainless steel in molten LiF-LiCl-LiBr
International Nuclear Information System (INIS)
Tortorelli, P.F.; DeVan, J.H.; Keiser, J.R.
1981-01-01
The properties of LiF-LiCl-LiBr salt make it attractive as a solvent for extracting tritium from a fusion reactor lithium blanket. Consequently, the corrosion of type 316 stainless steel by flowing (about 15 mm/s) LiF-LiCl-LiBr at a maximum temperature of 535 0 C was studied to determine whether compatibility with the structural material would be limiting in such a system. The corrosion rate was found to be low ( 0 C (approximately that of type 316 stainless steel exposed to lithium flowing at a similar velocity). At the proposed operating temperature (less than or equal to approx. 535 0 C), however, it appears that type 316 stainless steel has acceptable compatibility with the tritium-processing salt LiF-LiCl-LiBr for use with a lithium blanket
Hydrogen retention in Li and Li-C-O films
Buzi, Luxherta; Nelson, Andrew O.; Yang, Yuxin; Kaita, Robert; Koel, Bruce E.
2017-10-01
The efficiency of Li in binding H isotopes has led to reduced recycling in magnetic fusion devices and improved plasma performance. Since elemental Li surfaces are challenging to maintain in fusion devices due to the presence of impurities, parameterizing and understanding the mechanisms for H retention in various Li compounds (Li-C-O), in addition to pure Li, is crucial for Li plasma-facing material applications. To determine H retention in Li and Li-C-O films, measurements were done under ultrahigh vacuum conditions using temperature programmed desorption (TPD). Thin Li films (20 monolayers) were deposited on a nickel single crystal substrate and irradiated with 500 eV H2+ions at surface temperatures from 90K to 520K. Initial measurements on Li and Li-O films showed that the retention was comparable and dropped exponentially with surface temperature, from 95% at 90 K to 35% at 520 K. Auger electron spectroscopy and TPD showed that H was retained as lithium hydride (LiH) in pure Li and as lithium hydroxide (LiOH) in Li2O, which decomposed to H2O and Li2O at temperatures higher than 470K. H retention in Li-C and Li-C-O films will be determined over a similar temperature range, and the sputtering rate of these layers with H ions will also be reported. This material is based upon work supported by the U.S. Department of Energy, Office of Science/Fusion Energy Sciences under Award Number DE-SC0012890.
Hyperenhanced Li - Li Chemonuclear Fusion
International Nuclear Information System (INIS)
Ikegami, Hidetsugu
2006-01-01
A new fusion scheme, the Li - Li chemonuclear fusion is presented, where nuclear fusion reactions are linked to atomic fusion reactions. Lithium ions are implanted on a surface of metallic Li liquid at an energy of nuclear stopping (several keV/amu). The ions collide slowly with liquid Li atoms without electronic excitation and lead to the Li - Li chemonuclear fusion through the formation of united atoms or quasi-C atoms at their turning points. Inside the quasi-atoms twin nuclei are confined within respective sub-pm scale spheres of zero-point oscillation and form themselves into ultradense intermediate nuclear complexes. Their density is million times as large as the solar interior density and close to densities of white dwarfs or white-dwarf progenitors of supernovae. This confinement of nuclear complexes is enormously prolonged towards the pycno-nuclear reactions induced by the zero-point oscillation under the presence of thermodynamic force specified by the Gibbs energy change in the quasi-atom formation in the liquid. Resulted rate enhancement of nuclear fusion by a factor of 10 48 has been anticipated. The enhancement is also argued in connection with the Bose-Einstein condensation
Enhanced electrochemical performance of LiMnPO4 by Li+-conductive Li3VO4 surface coatings
International Nuclear Information System (INIS)
Dong, Youzhong; Zhao, Yanming; Duan, He; Liang, Zhiyong
2014-01-01
By a simple wet ball-milling method, Li 3 VO 4 -coated LiMnPO 4 samples were prepared successfully for the first time. The thin Li 3 VO 4 coating layer with a three-dimensional Li + -ion transport path and high mobility of Li + -ion strongly adhered to the LiMnPO 4 material reduces Mn dissolution and increases the Li + flux through the surface of the LiMnPO 4 itself by preventing formation of phases on the surface that would normally block Li + as well as Li + -ion permeation into the surface of the LiMnPO 4 electrode and therefore improve the rate capability as well as the cycling stability of LiMnPO 4 materials. The electrochemical testing shows that the 5% Li 3 VO 4 -coated LiMnPO 4 sample shows a clear voltage plateau in the charge curves and a much higher reversible capacity at different discharge rates compared with the pristine LiMnPO 4 . EIS results also show that the surface charge transfer resistance and Warburg impedance of the Li 3 VO 4 -coated LiMnPO 4 samples significantly decreased. The surface charge transfer resistance and Warburg impedance for the pristine LiMnPO 4 are 955.1 Ω and 400.3 Ω, respectively. While, for the 5% Li 3 VO 4 -coated LiMnPO 4 , the value are only 400.2 Ω and 283.6 Ω, respectively. The surface charge transfer resistance decreases more than half. All of the improved performance will be favorable for application of the LiMnPO 4 in high-power lithium ion batteries
Ternary nitrides for hydrogen storage: Li-B-N, Li-Al-N and Li-Ga-N systems
International Nuclear Information System (INIS)
Langmi, Henrietta W.; McGrady, G. Sean
2008-01-01
This paper reports an investigation of hydrogen storage performance of ternary nitrides based on lithium and the Group 13 elements boron, aluminum and gallium. These were prepared by ball milling Li 3 N together with the appropriate Group 13 nitride-BN, AlN or GaN. Powder X-ray diffraction of the products revealed that the ternary nitrides obtained are not the known Li 3 BN 2 , Li 3 AlN 2 and Li 3 GaN 2 phases. At 260 deg. C and 30 bar hydrogen pressure, the Li-Al-N ternary system initially absorbed 3.7 wt.% hydrogen, although this is not fully reversible. We observed, for the first time, hydrogen uptake by a pristine ternary nitride of Li and Al synthesized from the binary nitrides of the metals. While the Li-Ga-N ternary system also stored a significant amount of hydrogen, the storage capacity for the Li-B-N system was near zero. The hydrogenation reaction is believed to be similar to that of Li 3 N, and the enthalpies of hydrogen absorption for Li-Al-N and Li-Ga-N provide evidence that AlN and GaN, as well as the ball milling process, play a significant role in altering the thermodynamics of Li 3 N
Geometrical shock dynamics for magnetohydrodynamic fast shocks
Mostert, W.; Pullin, D. I.; Samtaney, Ravi; Wheatley, V.
2016-01-01
We describe a formulation of two-dimensional geometrical shock dynamics (GSD) suitable for ideal magnetohydrodynamic (MHD) fast shocks under magnetic fields of general strength and orientation. The resulting area–Mach-number–shock-angle relation is then incorporated into a numerical method using pseudospectral differentiation. The MHD-GSD model is verified by comparison with results from nonlinear finite-volume solution of the complete ideal MHD equations applied to a shock implosion flow in the presence of an oblique and spatially varying magnetic field ahead of the shock. Results from application of the MHD-GSD equations to the stability of fast MHD shocks in two dimensions are presented. It is shown that the time to formation of triple points for both perturbed MHD and gas-dynamic shocks increases as (Formula presented.), where (Formula presented.) is a measure of the initial Mach-number perturbation. Symmetry breaking in the MHD case is demonstrated. In cylindrical converging geometry, in the presence of an azimuthal field produced by a line current, the MHD shock behaves in the mean as in Pullin et al. (Phys. Fluids, vol. 26, 2014, 097103), but suffers a greater relative pressure fluctuation along the shock than the gas-dynamic shock. © 2016 Cambridge University Press
Geometrical shock dynamics for magnetohydrodynamic fast shocks
Mostert, W.
2016-12-12
We describe a formulation of two-dimensional geometrical shock dynamics (GSD) suitable for ideal magnetohydrodynamic (MHD) fast shocks under magnetic fields of general strength and orientation. The resulting area–Mach-number–shock-angle relation is then incorporated into a numerical method using pseudospectral differentiation. The MHD-GSD model is verified by comparison with results from nonlinear finite-volume solution of the complete ideal MHD equations applied to a shock implosion flow in the presence of an oblique and spatially varying magnetic field ahead of the shock. Results from application of the MHD-GSD equations to the stability of fast MHD shocks in two dimensions are presented. It is shown that the time to formation of triple points for both perturbed MHD and gas-dynamic shocks increases as (Formula presented.), where (Formula presented.) is a measure of the initial Mach-number perturbation. Symmetry breaking in the MHD case is demonstrated. In cylindrical converging geometry, in the presence of an azimuthal field produced by a line current, the MHD shock behaves in the mean as in Pullin et al. (Phys. Fluids, vol. 26, 2014, 097103), but suffers a greater relative pressure fluctuation along the shock than the gas-dynamic shock. © 2016 Cambridge University Press
Zhang, Yuli; Han, Jun; Weng, Xinqian; He, Zhongzhu; Zeng, Xiaoyang
This paper presents an Application Specific Instruction-set Processor (ASIP) for the SHA-3 BLAKE algorithm family by instruction set extensions (ISE) from an RISC (reduced instruction set computer) processor. With a design space exploration for this ASIP to increase the performance and reduce the area cost, we accomplish an efficient hardware and software implementation of BLAKE algorithm. The special instructions and their well-matched hardware function unit improve the calculation of the key section of the algorithm, namely G-functions. Also, relaxing the time constraint of the special function unit can decrease its hardware cost, while keeping the high data throughput of the processor. Evaluation results reveal the ASIP achieves 335Mbps and 176Mbps for BLAKE-256 and BLAKE-512. The extra area cost is only 8.06k equivalent gates. The proposed ASIP outperforms several software approaches on various platforms in cycle per byte. In fact, both high throughput and low hardware cost achieved by this programmable processor are comparable to that of ASIC implementations.
Role of dopants in LiF:Mg,Cu, LiF:Mg,P and LiF:Mg,Cu,P detectors
International Nuclear Information System (INIS)
Mohammadi, Kh.; Moussavi Zarandi, A.; Afarideh, H.; Shahmaleki, S.
2013-01-01
In this study, electronic structure of LiF crystal doped with Mg,Cu,P impurities was studied with WIEN2k code on the basis of FPLAPW+lo method. Results show that in Mg-doped LiF composition, an electronic trap was created with impurity concentration of 1.56% and 3.125%. In this condition, the electronic trap with increasing the percentage of the impurities up to 4.687% is annihilated. It was found, that by doping of Mg and Cu or P simultaneously, a hole-trap is created in valence band. It was realized that in LiF:Mg,Cu, LiF:Mg,P and LiF:Mg,Cu,P, Cu impurity and Li atom, have a key role in creation of levels which lead to create electronic and hole traps. Mg impurity and F atom, only have a role in creation of electronic traps. In addition, P impurity has a main role in creation of the electronic and hole traps in LiF:Mg,Cu,P. The activation energy of electronic and hole trap in LiF:Mg,Cu, LiF:Mg,P and LiF:Mg,Cu,P crystalline lattice were obtained as 0.3 and 5.5 eV, 0.92 and 3.4 eV and 0.75 and 3.1 eV, respectively. - Graphical abstract: Figure (a) and (b) shows changes in electronic structure and band gap energy of LiF crystal due to presence of Mg and Cu, Mg and P ions respectively. - Highlights: • Electronic structure of LiF, LiF:Mg,Cu, LiF:Mg,P and LiF:Mg,Cu,P materials were studied with WIEN2K code. • In LiF:Mg,Cu and LiF:Mg,Cu,P, Li atom and Cu impurity have a key role in creation of levels. • F atom and Mg impurity only have a role in creation of electronic traps. • In LiF:Mg,Cu,P, P impurity has a main role in creation of electronic and hole traps
Mass of 11Li from the 1H(11Li,9Li)3H reaction
International Nuclear Information System (INIS)
Roger, T.; Savajols, H.; Mittig, W.; Caamano, M.; Roussel-Chomaz, P.; Tanihata, I.; Alcorta, M.; Bandyopadhyay, D.; Bieri, R.; Buchmann, L.; Davids, B.; Galinski, N.; Howell, D.; Mills, W.; Mythili, S.; Openshaw, R.; Padilla-Rodal, E.; Ruprecht, G.; Sheffer, G.; Shotter, A. C.
2009-01-01
The mass of 11 Li has been determined from Q-value measurements of the 1 H( 11 Li, 9 Li) 3 H reaction. The experiment was performed at TRIUMF laboratory with the GANIL active target MAYA. Energy-energy and angle-angle kinematics reconstruction give a Q value of 8.119(22) MeV for the reaction. The derived 11 Li two-neutron separation energy is S 2n =363(22) keV
Thermal Stability of LiPF6 Salt and Li-ion Battery Electrolytes Containing LiPF6
Yang, Hui; Zhuang, Guorong V.; Ross Jr., Philip N.
2006-01-01
The thermal stability of the neat LiPF6 salt and of 1 molal solutions of LiPF6 in prototypical Li-ion battery solvents was studied with thermogravimetric analysis (TGA) and on-line FTIR. Pure LiPF6 salt is thermally stable up to 380 oK in a dry inert atmosphere, and its decomposition path is a simple dissociation producing LiF as solid and PF5 as gaseous products. In the presence of water (300 ppm) in the carrier gas, its decomposition onset temperature is lowered as a result of direct t...
Pre-main-sequence depletion of Li-6 and Li-7
International Nuclear Information System (INIS)
Proffitt, C.R.; Michaud, G.
1989-01-01
Depletion of Li-6 and Li-7 during premain-sequence contraction has been calculated for several evolutionary sequences. Slightly greater Li-7 depletion was found than by other recent workers. On the premain sequence, Li-6 is depleted by a factor of at least 10 in the present models for stars with T(eff) lower than 6800 K on the main sequence. Because of the shorter destruction time scale for Li-6 as compared to Li-7, the determination of the abundances of these two isotopes would place strict constraints on the structure of premain-sequence stars. 39 refs
International Nuclear Information System (INIS)
Tsuchiya, Kunihiko; Kawamura, Hiroshi
2006-10-01
Lithium titanate (Li 2 TiO 3 ) pebbles are considered to be a candidate material of tritium breeders for fusion reactor from viewpoints of easy tritium release at low temperatures (about 300degC) and chemical stability. In the present study, trial fabrication tests of 6 Li-enriched Li 2 TiO 3 pebbles of 1mm in diameter were carried out by a wet process with a dehydration reaction, and characteristics of the 6 Li-enriched Li 2 TiO 3 pebbles were evaluated for preparation of a high Li-burnup test in a testing reactor. Powder of 96at% 6 Li-enriched Li 2 TiO 3 was prepared by a solid state reaction, and two kinds of 6 Li-enriched Li 2 TiO 3 pebbles, namely un-doped and TiO 2 -doped Li 2 TiO 3 pebbles, were fabricated by the wet process. Based on results of the pebble fabrication tests, two kinds of 6 Li-enriched Li 2 TiO 3 pebbles were successfully fabricated with target values (density: 80-85%T.D., grain size: 2 TiO 3 pebbles was a satisfying value of about 1.05. Contact strength of these pebbles was about 6300MPa, which was almost the same as that of the Li 2 TiO 3 pebbles with natural Li. (author)
Physics of Collisionless Shocks Space Plasma Shock Waves
Balogh, André
2013-01-01
The present book provides a contemporary systematic treatment of shock waves in high-temperature collisionless plasmas as are encountered in near Earth space and in Astrophysics. It consists of two parts. Part I develops the complete theory of shocks in dilute hot plasmas under the assumption of absence of collisions among the charged particles when the interaction is mediated solely by the self-consistent electromagnetic fields. Such shocks are naturally magnetised implying that the magnetic field plays an important role in their evolution and dynamics. This part treats both subcritical shocks, which dissipate flow energy by generating anomalous resistance or viscosity, and supercritical shocks. The main emphasis is, however, on super-critical shocks where the anomalous dissipation is insufficient to retard the upstream flow. These shocks, depending on the direction of the upstream magnetic field, are distinguished as quasi-perpendicular and quasi-parallel shocks which exhibit different behaviours, reflecti...
Kinetic Monte Carlo Study of Li Intercalation in LiFePO4.
Xiao, Penghao; Henkelman, Graeme
2018-01-23
Even as a commercial cathode material, LiFePO 4 remains of tremendous research interest for understanding Li intercalation dynamics. The partially lithiated material spontaneously separates into Li-poor and Li-rich phases at equilibrium. Phase segregation is a surprising property of LiFePO 4 given its high measured rate capability. Previous theoretical studies, aiming to describe Li intercalation in LiFePO 4 , include both atomic-scale density functional theory (DFT) calculations of static Li distributions and entire-particle-scale phase field models, based upon empirical parameters, studying the dynamics of the phase separation. Little effort has been made to bridge the gap between these two scales. In this work, DFT calculations are used to fit a cluster expansion for the basis of kinetic Monte Carlo calculations, which enables long time scale simulations with accurate atomic interactions. This atomistic model shows how the phases evolve in Li x FePO 4 without parameters from experiments. Our simulations reveal that an ordered Li 0.5 FePO4 phase with alternating Li-rich and Li-poor planes along the ac direction forms between the LiFePO 4 and FePO 4 phases, which is consistent with recent X-ray diffraction experiments showing peaks associated with an intermediate-Li phase. The calculations also help to explain a recent puzzling experiment showing that LiFePO 4 particles with high aspect ratios that are narrower along the [100] direction, perpendicular to the [010] Li diffusion channels, actually have better rate capabilities. Our calculations show that lateral surfaces parallel to the Li diffusion channels, as well as other preexisting sites that bind Li weakly, are important for phase nucleation and rapid cycling performance.
Thermal stability of LiPF 6 salt and Li-ion battery electrolytes containing LiPF 6
Yang, Hui; Zhuang, Guorong V.; Ross, Philip N.
The thermal stability of the neat lithium hexafluorophosphate (LiPF 6) salt and of 1 molal (m) solutions of LiPF 6 in prototypical Li-ion battery solvents was studied with thermogravimetric analysis (TGA) and on-line Fourier transform infrared (FTIR). Pure LiPF 6 salt is thermally stable up to 107 °C in a dry inert atmosphere, and its decomposition path is a simple dissociation producing lithium fluoride (LiF) as solid and PF 5 as gaseous products. In the presence of water (300 ppm) in the carrier gas, its decomposition onset temperature is lowered as a result of direct thermal reaction between LiPF 6 and water vapor to form phosphorous oxyfluoride (POF 3) and hydrofluoric acid (HF). No new products were observed in 1 m solutions of LiPF 6 in ethylene carbonate (EC), dimethyl carbonate (DMC) and ethyl methyl carbonate (EMC) by on-line TGA-FTIR analysis. The storage of the same solutions in sealed containers at 85 °C for 300-420 h did not produce any significant quantity of new products as well. In particular, no alkylflurophosphates were found in the solutions after storage at elevated temperature. In the absence of either an impurity like alcohol or cathode active material that may (or may not) act as a catalyst, there is no evidence of thermally induced reaction between LiPF 6 and the prototypical Li-ion battery solvents EC, PC, DMC or EMC.
Energy Technology Data Exchange (ETDEWEB)
Shimozori, Motoki [Interdisciplinary Graduate School of Engineering Science, Kyushu University, 6-1, Kasugakoen, Kasuga, Fukuoka 816-8580 (Japan); Katayama, Kazunari, E-mail: kadzu@nucl.kyushu-u.ac.jp [Interdisciplinary Graduate School of Engineering Science, Kyushu University, 6-1, Kasugakoen, Kasuga, Fukuoka 816-8580 (Japan); Hoshino, Tsuyoshi [Breeding Functional Materials Development Group, Department of Blanket Systems Research, Rokkasho Fusion Institute, Sector of Fusion Research and Development, Japan Atomic Energy Agency, 2-166 Obuch, Omotedate, Rokkasho-mura, Kamikita-gun, Aomori 039-3212 (Japan); Ushida, Hiroki; Yamamoto, Ryotaro; Fukada, Satoshi [Interdisciplinary Graduate School of Engineering Science, Kyushu University, 6-1, Kasugakoen, Kasuga, Fukuoka 816-8580 (Japan)
2015-10-15
Highlights: • Li mass loss from Li{sub 2.11}TiO{sub 3} increased proportionally to water vapor pressure. • Li mass loss from Li{sub 2.11}TiO{sub 3} at 600 °C was significantly smaller than expected. • Differences of Li mass loss behavior from Li{sub 2.11}TiO{sub 3} and Li{sub 4}SiO{sub 4} were shown. - Abstract: In this study, weight reduction of Li{sub 2}TiO{sub 3} with excess Li and Li{sub 4}SiO{sub 4} at elevated temperatures under hydrogen atmosphere or water vapor atmosphere was investigated. The Li mass loss for the Li{sub 2}TiO{sub 3} at 900 °C was 0.4 wt% under 1000 Pa H{sub 2} atmosphere and 1.5 wt% under 50 Pa H{sub 2}O atmosphere. The Li mass loss for the Li{sub 2}TiO{sub 3} increased proportionally to the water vapor pressure in the range from 50 to 200 Pa at 900 °C and increased with increasing temperature from 700 to 900 °C although Li mass loss at 600 °C was significantly smaller than expected. It was found that water vapor concentration dependence and temperature dependence of Li mass loss for the Li{sub 2}TiO{sub 3} and the Li{sub 4}SiO{sub 4} used in this work were quite different. Water vapor is released from the ceramic breeder materials into the purge gas due to desorption of adsorbed water and water formation reaction. The released water vapor possibly promotes Li mass loss with the formation of LiOH on the surface.
Recovery of Li from alloys of Al- Li and Li- Al using engineered scavenger compounds
Riley, W. D.; Jong, B. W.; Collins, W. K.; Gerdemann, S. J.
1994-01-01
A method of producing lithium of high purity from lithium aluminum alloys using an engineered scavenger compound, comprising: I) preparing an engineered scavenger compound by: a) mixing and heating compounds of TiO2 and Li2CO3 at a temperature sufficient to dry the compounds and convert Li.sub.2 CO.sub.3 to Li.sub.2 O; and b) mixing and heating the compounds at a temperature sufficient to produce a scavenger Li.sub.2 O.3TiO.sub.2 compound; II) loading the scavenger into one of two electrode baskets in a three electrode cell reactor and placing an Al-Li alloy in a second electrode basket of the three electrode cell reactor; III) heating the cell to a temperature sufficient to enable a mixture of KCl-LiCl contained in a crucible in the cell to reach its melting point and become a molten bath; IV) immersing the baskets in the bath until an electrical connection is made between the baskets to charge the scavenger compound with Li until there is an initial current and voltage followed by a fall off ending current and voltage; and V) making a connection between the basket electrode containing engineered scavenger compound and a steel rod electrode disposed between the basket electrodes and applying a current to cause Li to leave the scavenger compound and become electrodeposited on the steel rod electrode.
EPR experiments in LiTbF4, LiHoF4, and LiErF4 at submillimeter frequencies
DEFF Research Database (Denmark)
Magariño, J.; Tuchendler, J.; Beauvillain, P.
1980-01-01
Electron-paramagnetic-resonance experiments in LiTbF4, LiHoF4, and LiErF4 have been performed at frequencies between 70 and 600 GHz, in magnetic fields up to 60 kG and in the temperature range 1.4......Electron-paramagnetic-resonance experiments in LiTbF4, LiHoF4, and LiErF4 have been performed at frequencies between 70 and 600 GHz, in magnetic fields up to 60 kG and in the temperature range 1.4...
Energy Technology Data Exchange (ETDEWEB)
Bourouis, Mahmoud; Valles, Manel; Medrano, Marc; Coronas, Alberto [Centro de Innovacion Tecnologica en Revalorizacion Energetica y Refrigeracion, CREVER, Universitat Rovira i Virgili, Autovia de Salou, s/n, 43006, Tarragona (Spain)
2005-05-01
In air-cooled water-LiBr absorption chillers the working conditions in the absorber and condenser are shifted to higher temperatures and concentrations, thereby increasing the risk of crystallisation. To develop this technology, two main problems are to be addressed: the availability of new salt mixtures with wider range of solubility than water-LiBr, and advanced absorber configurations that enable to carry out simultaneously an appropriate absorption process and an effective air-cooling. One way of improving the solubility of LiBr aqueous solutions is to add other salts to create multicomponent salt solutions. The aqueous solution of the quaternary salt system (LiBr + LiI + LiNO{sub 3} + LiCl) presents favourable properties required for air-cooled absorption systems: less corrosive and crystallisation temperature about 35 K lower than that of water-LiBr.This paper presents an experimental study on the absorption of water vapour over a wavy laminar falling film of an aqueous solution of (LiBr + LiI + LiNO{sub 3} + LiCl) on the inner wall of a water-cooled smooth vertical tube. Cooling water temperatures in the range 30-45 C were selected to simulate air-cooling thermal conditions. The results are compared with those obtained in the same experimental set-up with water-LiBr solutions.The control variables for the experimental study were: absorber pressure, solution Reynolds number, solution concentration and cooling water temperature. The parameters considered to assess the absorber performance were: absorber thermal load, mass absorption flux, degree of subcooling of the solution leaving the absorber, and the falling film heat transfer coefficient.The higher solubility of the multicomponent salt solution makes possible the operation of the absorber at higher salt concentration than with the conventional working fluid water-LiBr. The absorption fluxes achieved with water-(LiBr + LiI + LiNO{sub 3} + LiCl) at a concentration of 64.2 wt% are around 60 % higher than
Simulations of Converging Shock Collisions for Shock Ignition
Sauppe, Joshua; Dodd, Evan; Loomis, Eric
2016-10-01
Shock ignition (SI) has been proposed as an alternative to achieving high gain in inertial confinement fusion (ICF) targets. A central hot spot below the ignition threshold is created by an initial compression pulse, and a second laser pulse drives a strong converging shock into the fuel. The collision between the rebounding shock from the compression pulse and the converging shock results in amplification of the converging shock and increases the hot spot pressure above the ignition threshold. We investigate shock collision in SI drive schemes for cylindrical targets with a polystyrene foam interior using radiation-hydrodynamics simulations with the RAGE code. The configuration is similar to previous targets fielded on the Omega laser. The CH interior results in a lower convergence ratio and the cylindrical geometry facilitates visualization of the shock transit using an axial X-ray backlighter, both of which are important for comparison to potential experimental measurements. One-dimensional simulations are used to determine shock timing, and the effects of low mode asymmetries in 2D computations are also quantified. LA-UR-16-24773.
Directory of Open Access Journals (Sweden)
Bohan Wang
2017-02-01
Full Text Available Low-intensity extracorporeal shock wave therapy (Li-ESWT is used in the treatment of erectile dysfunction, but its mechanisms are not well understood. Previously, we found that Li-ESWT increased the expression of brain-derived neurotrophic factor (BDNF. Here we assessed the underlying signaling pathways in Schwann cells in vitro and in penis tissue in vivo after nerve injury. The result indicated that BDNF were significantly increased by the Li-ESWT after nerve injury, as well as the expression of BDNF in Schwann cells (SCs, RT4-D6P2T in vitro. Li-ESWT activated the protein kinase RNA-like endoplasmic reticulum (ER kinase (PERK pathway by increasing the phosphorylation levels of PERK and eukaryotic initiation factor 2a (eIF2α, and enhanced activating transcription factor 4 (ATF4 in an energy-dependent manner. In addition, GSK2656157—an inhibitor of PERK—effectively inhibited the effect of Li-ESWT on the phosphorylation of PERK, eIF2α, and the expression of ATF4. Furthermore, silencing ATF4 dramatically attenuated the effect of Li-ESWT on the expression of BDNF, but had no effect on hypoxia-inducible factor (HIF1α or glial cell-derived neurotrophic factor (GDNF in Schwann cells. In conclusion, our findings shed new light on the underlying mechanisms by which Li-ESWT may stimulate the expression of BDNF through activation of PERK/ATF4 signaling pathway. This information may help to refine the use of Li-ESWT to further improve its clinical efficacy.
Ultralong Lifespan and Ultrafast Li Storage: Single-Crystal LiFePO4 Nanomeshes.
Zhang, Yan; Zhang, Hui Juan; Feng, Yang Yang; Fang, Ling; Wang, Yu
2016-01-27
A novel LiFePO4 material, in the shape of a nanomesh, has been rationally designed and synthesized based on the low crystal-mismatch strategy. The LiFePO4 nanomesh possesses several advantages in morphology and crystal structure, including a mesoporous structure, its crystal orientation that is along the [010] direction, and a shortened Li-ion diffusion path. These properties are favorable for their application as cathode in Li-ion batteries, as these will accelerate the Li-ion diffusion rate, improve the Li-ion exchange between the LiFePO4 nanomesh and the electrolyte, and reduce the Li-ion capacitive behavior during Li intercalation. So the LiFePO4 nanomesh exhibits a high specific capacity, enhanced rate capability, and strengthened cyclability. The method developed here can also be extended to other similar systems, for instance, LiMnPO4 , LiCoPO4 , and LiNiPO4 , and may find more applications in the designed synthesis of functional materials. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Vandersall, Kevin S; Garcia, Frank; Fried, Laurence E; Tarver, Craig M
2014-01-01
Experimental data from measurements of the reacted state of an energetic material are desired to incorporate reacted states in modeling by computer codes. In a case such as LX-17 (92.5% TATB and 7.5% Kel-F by weight), where the time dependent kinetics of reaction is still not fully understood and the reacted state may evolve over time, this information becomes even more vital. Experiments were performed to measure the reacted state of LX-17 using a double shock method involving the use of two flyer materials (with known properties) mounted on the projectile that send an initial shock through the material close to or above the Chapman-Jouguet (CJ) state followed by a second shock at a higher magnitude into the detonated material. By measuring the parameters of the first and second shock waves, information on the reacted state can be obtained. The LX-17 detonation reaction zone profiles plus the arrival times and amplitudes of reflected shocks in LX-17 detonation reaction products were measured using Photonic Doppler Velocimetry (PDV) probes and an aluminum foil coated LiF window. A discussion of this work will include the experimental parameters, velocimetry profiles, data interpretation, reactive CHEETAH and Ignition and Growth modeling, as well as detail on possible future experiments.
Shock Dynamics in Stellar Outbursts. I. Shock Formation
Energy Technology Data Exchange (ETDEWEB)
Ro, Stephen; Matzner, Christopher D., E-mail: ro@astro.utoronto.ca [Department of Astronomy and Astrophysics, University of Toronto, 50 St. George Street, Toronto, ON M5S 3H4 (Canada)
2017-05-20
Wave-driven outflows and non-disruptive explosions have been implicated in pre-supernova outbursts, supernova impostors, luminous blue variable eruptions, and some narrow-line and superluminous supernovae. To model these events, we investigate the dynamics of stars set in motion by strong acoustic pulses and wave trains, focusing on nonlinear wave propagation, shock formation, and an early phase of the development of a weak shock. We identify the shock formation radius, showing that a heuristic estimate based on crossing characteristics matches an exact expansion around the wave front and verifying both with numerical experiments. Our general analytical condition for shock formation applies to one-dimensional motions within any static environment, including both eruptions and implosions. We also consider the early phase of shock energy dissipation. We find that waves of super-Eddington acoustic luminosity always create shocks, rather than damping by radiative diffusion. Therefore, shock formation is integral to super-Eddington outbursts.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Lianqi; Noguchi, Hideyuki; Li, Decheng; Muta, Takahisa; Wang, Xiaoqing; Yoshio, Masaki [Department of Applied Chemistry, Saga University, Saga 840-8052 (Japan); Taniguchi, Izumi [Department of Chemical Engineering, Tokyo Institute of Technology, 12-1, Ookayama-2, Meguro-ku, Tokyo 152-8552 (Japan)
2008-10-15
On the basis of extreme similarity between the triangle phase diagrams of LiNiO{sub 2}-LiTiO{sub 2}-Li[Li{sub 1/3}Ti{sub 2/3}]O{sub 2} and LiNiO{sub 2}-LiMnO{sub 2}-Li[Li{sub 1/3}Mn{sub 2/3}]O{sub 2}, new Li-Ni-Ti-O series with a nominal composition of Li{sub 1+z/3}Ni{sub 1/2-z/2}Ti{sub 1/2+z/6}O{sub 2} (0 {<=} z {<=} 0.5) was designed and attempted to prepare via a spray-drying method. XRD identified that new Li-Ni-Ti-O compounds had cubic rocksalt structure, in which Li, Ni and Ti were evenly distributed on the octahedral sites in cubic closely packed lattice of oxygen ions. They can be considered as the solid solution between cubic LiNi{sub 1/2}Ti{sub 1/2}O{sub 2} and Li[Li{sub 1/3}Ti{sub 2/3}]O{sub 2} (high temperature form). Charge-discharge tests showed that Li-Ni-Ti-O compounds with appropriate compositions could display a considerable capacity (more than 80 mAh g{sup -1} for 0.2 {<=} z {<=} 0.27) at room temperature in the voltage range of 4.5-2.5 V and good electrochemical properties within respect to capacity (more than 150 mAh g{sup -1} for 0 {<=} z {<=} 0.27), cycleability and rate capability at an elevated temperature of 50 C. These suggest that the disordered cubic structure in some cases may function as a good host structure for intercalation/deintercalation of Li{sup +}. A preliminary electrochemical comparison between Li{sub 1+z/3}Ni{sub 1/2-z/2}Ti{sub 1/2+z/6}O{sub 2} (0 {<=} z {<=} 0.5) and Li{sub 6/5}Ni{sub 2/5}Ti{sub 2/5}O{sub 2} indicated that charge-discharge mechanism based on Ni redox at the voltage of >3.0 V behaved somewhat differently, that is, Ni could be reduced to +2 in Li{sub 1+z/3}Ni{sub 1/2-z/2}Ti{sub 1/2+z/6}O{sub 2} while +3 in Li{sub 6/5}Ni{sub 2/5}Ti{sub 2/5}O{sub 2}. Reduction of Ti{sup 4+} at a plateau of around 2.3 V could be clearly detected in Li{sub 1+z/3}Ni{sub 1/2-z/2}Ti{sub 1/2+z/6}O{sub 2} with 0.27 {<=} z {<=} 0.5 at 50 C after a deep charge associated with charge compensation from oxygen ion during initial cycle
Spallation reactions in shock waves at supernova explosions and related problems
Energy Technology Data Exchange (ETDEWEB)
Ustinova, G. K., E-mail: ustinova@dubna.net.ru [RAS, V.I. Vernadsky Institute of Geochemistry and Analytical Chemistry (Russian Federation)
2013-05-15
The isotopic anomalies of some extinct radionuclides testify to the outburst of a nearby supernova just before the collapse of the protosolar nebula, and to the fact that the supernova was Sn Ia, i.e. the carbon-detonation supernova. A key role of spallation reactions in the formation of isotopic anomalies in the primordial matter of the Solar System is revealed. It is conditioned by the diffusive acceleration of particles in the explosive shock waves, which leads to the amplification of rigidity of the energy spectrum of particles and its enrichment with heavier ions. The quantitative calculations of such isotopic anomalies of many elements are presented. It is well-grounded that the anomalous Xe-HL in meteoritic nanodiamonds was formed simultaneously with nanodiamonds themselves during the shock wave propagation at the Sn Ia explosion. The possible effects of shock wave fractionation of noble gases in the atmosphere of planets are considered. The origin of light elements Li, Be and B in spallation reactions, predicted by Fowler in the middle of the last century, is argued. All the investigated isotopic anomalies give the evidence for the extremely high magnetohydrodynamics (MHD) conditions at the initial stage of free expansion of the explosive shock wave from Sn Ia, which can be essential in solution of the problem of origin of cosmic rays. The specific iron-enriched matter of Sn Ia and its MHD-separation in turbulent processes must be taking into account in the models of origin of the Solar System.
Slow shocks and their transition to fast shocks in the inner solar wind
International Nuclear Information System (INIS)
Wang, Y.C.
1987-01-01
The jump conditions of MHD shocks may be directly calculated as functions of three upstream conditions: the shock Alfven number based on the normal component of the relative shock speed, the shock angle, and the plasma β value. The shock Alfven number is less than 1 for a slow shock and greater than 1 for a fast shock. A traveling, forward shock can be a slow shock in coronal space, where the Alfven speed is of the order of 1000 km/s. The surface of a forward slow shock has a bow-shaped geometry with its nose facing toward the sun. The decrease in the Alfven speed at increasing heliocentric distance causes the shock Alfven number of a forward slow shock to become greater than 1, and the shock eventually evolves from a slow shock into a fast shock. During the transition the shock system consists of a slow shock, a fast shock, and a rotational discontinuity. They intersect along a closed transition line. As the system moves outward from the sun, the area enclosed by the transition line expands, the fast shock grows stronger, and the slow shock becomes weaker. Eventually, the slow shock diminishes, and the entire shock system evolves into a forward fast shock. copyrightAmerican Geophysical Union 1987
Uniform second Li ion intercalation in solid state ϵ-LiVOPO4
International Nuclear Information System (INIS)
Wangoh, Linda W.; Quackenbush, Nicholas F.; Sallis, Shawn; Wiaderek, Kamila M.; Ma, Lu; Wu, Tianpin; Chapman, Karena W.; Lin, Yuh-Chieh; Ong, Shyue Ping; Wen, Bohua; Chernova, Natasha A.; Whittingham, M. Stanley; Guo, Jinghua; Lee, Tien-Lin; Schlueter, Christoph; Piper, Louis F. J.
2016-01-01
Full, reversible intercalation of two Li + has not yet been achieved in promising VOPO 4 electrodes. A pronounced Li + gradient has been reported in the low voltage window (i.e., second lithium reaction) that is thought to originate from disrupted kinetics in the high voltage regime (i.e., first lithium reaction). Here, we employ a combination of hard and soft x–ray photoelectron and absorption spectroscopy techniques to depth profile solid state synthesized LiVOPO 4 cycled within the low voltage window only. Analysis of the vanadium environment revealed no evidence of a Li + gradient, which combined with almost full theoretical capacity confirms that disrupted kinetics in the high voltage window are responsible for hindering full two lithium insertion. Furthermore, we argue that the uniform Li + intercalation is a prerequisite for the formation of intermediate phases Li 1.50 VOPO 4 and Li 1.75 VOPO 4 . The evolution from LiVOPO 4 to Li 2 VOPO 4 via the intermediate phases is confirmed by direct comparison between O K–edge absorption spectroscopy and density functional theory.
Electrochemical behavior of Li/LiV3O8 secondary cells
Bak, Hyo Rim; Lee, Jae Ha; Kim, Bok Ki; Yoon, Woo Young
2013-03-01
Li/LiV3O8 secondary cells with Li-foil and Li-powder anodes were fabricated, and their electrical properties were compared. Using the powder anode, a cell with an initial discharge capacity of 260 mAh g-1 that could be operated for over 100 cycles was obtained. The porous Li-powder electrode was safely synthesized by pressing an emulsion droplet onto an SUS mesh. A threefold increase in the electrical conductivity of the LiV3O8 cathode was achieved by the addition of carbon using a vibration pot mill. Using the powder anode resulted in 80% capacity retention at the 100th cycle, while that using the foil electrode was 46%; the 1.0 Crate/ 0.1 C-rate capacity ratio also increased from 44% to 60%. A cell employing the LiV3O8-carbon composite cathode showed better electrical performance, a capacity retention of 90% after 50 cycles, and an increase in rate capacity ratio. The crystal structure and morphology of the LiV3O8-C composite were investigated by x-ray diffraction and scanning electron microscopy.
International Nuclear Information System (INIS)
Lin, Wen-Yang; Lin, Feng-Huei; Sadhasivam, S.; Savitha, S.
2010-01-01
The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.
Energy Technology Data Exchange (ETDEWEB)
Lin, Wen-Yang; Lin, Feng-Huei [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Sadhasivam, S., E-mail: rahulsbio@yahoo.co.in [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China); Savitha, S. [Institute of Biomedical Engineering, National Taiwan University, Taipei, Taiwan (China)
2010-05-10
The antioxidant effects of betulin on porcine chondrocytes cultured in gelatin/C6S/C4S/HA modified tricopolymer scaffold for a period of 4 weeks was investigated. The porous structure of the scaffold and cell attachment was observed by scanning electron microscopy (SEM). Biochemical measures of necrosis, cell proliferation, sulfated glycosaminoglycans (sGAG) content and extracellular matrix related gene expressions were quantitatively evaluated. The cell proliferation data showed good cellular viability in tricopolymer scaffold and increased optical density for total DNA demonstrated that the cells continued to proliferate inside the scaffold. The sGAG production indicated chondrogenic differentiation. Chondrocytes treated with betulin expressed transcripts encoding type II collagen, aggrecan, and decorin. To conclude, the substantiated results supported cell proliferation, production of extracellular matrix proteins and down-regulation of matrix metalloproteases and cytokine, in betulin treated scaffolds.
Staphylococcal toxic shock syndrome; Toxic shock-like syndrome; TSLS ... Toxic shock syndrome is caused by a toxin produced by some types of staphylococcus bacteria. A similar problem, called toxic shock- ...
Characteristics of new LiF preparations and sensitised LiF
Energy Technology Data Exchange (ETDEWEB)
Driscoll, C M.H.; O' Hagan, J B; Mundy, S J; Todd, C D; McWhan, A F; Dodson, J
1986-01-01
The patent governing the preparation and production of lithium fluoride (LiF) awarded to the Harshaw Chemical Co. has expired. Other companies have become interested in developing additional preparations of this material. Two of these preparations include LiF:Mg,Ti manufactured by Vinten Instruments plc and high sensitivity LiF:Mg, Cu,P distributed by them. The properties of these materials, including sensitivity, dose threshold, photon energy response, reusability and storage characteristics, are presented in this paper and compared with those of Harshaw TLD-100 and with those of sensitised LiF.
International Nuclear Information System (INIS)
Sakuta, S.B.; Novatskij, B.G.; Stepanov, D.N.; Aleksandrov, D.V.; Glukhov, Yu.A.; Nikol'skij, E.Yu.
2002-01-01
( 6 Li, 7 Be) and ( 6 Li, 7 Li) reactions on the 6 Li, 7 Li nuclei have been investigated in the angular range of 0-20 deg in laboratory system at the 93-MeV 6 Li energy. Besides low-lying states of 5,6 He and 5,6 Li nuclei, broad structures have been observed in the measured spectra close to the t( 3 He) + d and t( 3 He) + t threshold at excitation energies of 16.75 (3/2 + ) and ∼ 20 MeV ( 5 He), 16.66 (3/2 + ) and ∼ 20 MeV ( 5 Li), 14.0 and 25 MeV ( 6 He), and ∼ 20 MeV ( 6 Li). Angular distributions, which have been measured for transitions to the ground (0 + ) and exited states at E x =1.8 MeV (2 + ) and 14.0 MeV of the 6 He nucleus in the 7 Li( 6 Li, 7 Be) 6 He reaction, have been analyzed in the framework of the finite-range distorted-waves method assuming the 1p- and 1s-proton pick-up mechanism. It has been shown that ( 6 Li, 7 Be) and ( 6 Li, 7 Li) reactions predominately proceed by one-step pick-up mechanism and broad structures which are observed at high excitation energies should be considered as quasimolecular states of the t( 3 He) + d and t( 3 He) + t type [ru
The Interstellar 7Li/6Li Ratio in the Diffuse Gas Near IC 443
Ritchey, A. M.; Taylor, C. J.; Federman, S. R.; Lambert, D. L.
2010-11-01
Supernova remnants are believed to be the primary acceleration sites of Galactic cosmic rays (GCR), which are essential to gas-phase interstellar chemistry since they are a major source of ionization in both diffuse and dense environments. The interaction of accelerated particles with interstellar gas will also synthesize isotopes of the light elements Li, Be, and B through the spallation of CNO nuclei (producing all stable LiBeB isotopes) and through α+α fusion (yielding 6Li and 7Li, only). Type II supernovae may provide an additional source of 7Li and 11B during core collapse through neutrino-induced spallation in the He and C shells of the progenitor star (the ν-process). However, direct observational evidence for light element synthesis resulting from cosmic-ray or neutrino-induced spallation is rare. Here, we examine 7Li/6Li isotope ratios along four lines of sight through the supernova remnant IC 443 using observations of the Li I λ6707 doublet made with the Hobby-Eberly Telescope (HET) at McDonald Observatory. The 7Li/6Li ratio in the general interstellar medium is expected to be similar to the ratio of ~12 that characterizes solar system material. A local enhancement in the cosmic-ray flux will act to lower 7Li/6Li, yielding a ratio of ~2 when cosmic rays dominate Li synthesis. Gamma-ray emission from IC 443 provides strong evidence for the interaction of cosmic rays accelerated by the remnant with the ambient atomic and molecular gas. Yet this material has also been contaminated by the ejecta of a Type II supernova, which should be enriched in 7Li. We are seeking 7Li/6Li ratios that are either higher than the solar system ratio as a result of the ν-process or lower due to cosmic-ray spallation. Since the fine structure separation of the Li I doublet is comparable to the isotope shift (~7 km s-1) and each fine structure line is further split into hyperfine components, the velocity structure along the line of sight must be carefully constrained if
Understanding LiOH chemistry in a ruthenium-catalyzed Li-O{sub 2} battery
Energy Technology Data Exchange (ETDEWEB)
Liu, Tao; Liu, Zigeng; Kim, Gunwoo; Grey, Clare P. [Department of Chemistry, University of Cambridge (United Kingdom); Frith, James T.; Garcia-Araez, Nuria [Department of Chemistry, University of Southampton (United Kingdom)
2017-12-11
Non-aqueous Li-O{sub 2} batteries are promising for next-generation energy storage. New battery chemistries based on LiOH, rather than Li{sub 2}O{sub 2}, have been recently reported in systems with added water, one using a soluble additive LiI and the other using solid Ru catalysts. Here, the focus is on the mechanism of Ru-catalyzed LiOH chemistry. Using nuclear magnetic resonance, operando electrochemical pressure measurements, and mass spectrometry, it is shown that on discharging LiOH forms via a 4 e{sup -} oxygen reduction reaction, the H in LiOH coming solely from added H{sub 2}O and the O from both O{sub 2} and H{sub 2}O. On charging, quantitative LiOH oxidation occurs at 3.1 V, with O being trapped in a form of dimethyl sulfone in the electrolyte. Compared to Li{sub 2}O{sub 2}, LiOH formation over Ru incurs few side reactions, a critical advantage for developing a long-lived battery. An optimized metal-catalyst-electrolyte couple needs to be sought that aids LiOH oxidation and is stable towards attack by hydroxyl radicals. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Modeling Li-ion conductivity in LiLa(PO3)4 powder
International Nuclear Information System (INIS)
Mounir, Ferhi; Karima, Horchani-Naifer; Khaled, Ben Saad; Mokhtar, Férid
2012-01-01
Polycrystalline powder and single-crystal of LiLa(PO 3 ) 4 are synthesized by solid state reaction and flux technique, respectively. A morphological description of the obtained product was made based on scanning electron microscopy micrographs. The obtained powder was characterized by X-ray powder diffraction, FTIR and Raman spectroscopies. Ionic conductivity of the LiLa(PO 3 ) 4 powder was measured and evaluated over a temperature range from 553 to 913 K. Single crystals of LiLa(PO 3 ) 4 are characterized by single-crystal X-ray diffraction. The LiLa(PO 3 ) 4 structure was found to be isotypic with LiNd(PO 3 ) 4 . It crystallizes in the monoclinic system with space group C2/c and cell parameters: a=16.635(6) Å, b=7.130(3) Å, c=9.913(3) Å, β=126.37(4)°, V=946.72(6) Å 3 and Z=4. The LiLa(PO 3 ) 4 structure was described as an alternation between spiraling chains (PO 3 ) n and (La 3+ , Li + ) cations along the b direction. The small Li + ions, coordinated to four oxygen atoms, were located in the large connected cavities created between the LaO 8 polyhedra and the polyphosphate chains. The jumping of Li + through tunnels of the crystalline network was investigated using complex impedance spectroscopy. The close value of the activation energies calculated through the analysis of conductivity data and loss spectra indicate that the transport in the investigated system is through hopping mechanism. The correlation between ionic conductivity of LiLa(PO 3 ) 4 and its crystallographic structure was investigated and the most probably transport pathway model was determined.
DEFF Research Database (Denmark)
Myrdal, Jon Steinar Gardarsson; Blanchard, Didier; Sveinbjörnsson, Dadi Þorsteinn
2013-01-01
The hexagonal high-temperature polymorph of LiBH4 is stabilized by solid solution with LiI to exhibit superionic Li+ ionic conductivity at room temperature. Herein, the mechanisms for the Li+ diffusion are investigated for the first time by density functional theory (DFT) calculations coupled...
Coronal mass ejection shock fronts containing the two types of intermediate shocks
International Nuclear Information System (INIS)
Steinolfson, R.S.; Hundhausen, A.J.
1990-01-01
Numerical solutions of the time-dependent, magnetohydrodynamic (MHD) equations in two dimensions are used to demonstrate the formation of both types of intermediate shocks in a single shock front for physical conditions that are an idealization of those expected to occur in some observed coronal mass ejections. The key to producing such a shock configuration in the simulations is the use of an initial atmosphere containing a magnetic field representative of that in a coronal streamer with open field lines overlying a region of closed field lines. Previous attempts using just open field lines (perpendicular to the surface) produced shock configurations containing just one of the two intermediate shock types. A schematic of such a shock front containing both intermediate shock types has been constructed previously based solely on the known properties of MHD shocks from the Rankine-Hugoniot equations and specific requirements placed on the shock solution at points along the front where the shock normal and upstream magnetic field are aligned. The shock front also contains, at various locations along the front, a hydrodynamic (nonmagnetic) shock, a switch-on shock, and a fast shock in addition to the intermediate shocks. This particular configuration occurs when the shock front speed exceeds the upstream (preshock) intermediate wave speed but is less than a critical speed defined in the paper (equation 1) along at least some portion of the shock front. A distinctive feature of the front is that it is concave upward (away from the surface) near the region where the field in the preshock plasma is normal to the front of near the central portion of the shock front
Li, Faqiang; Gong, Yan; Jia, Guofeng; Wang, Qinglei; Peng, Zhengjun; Fan, Wei; Bai, Bing
2015-11-01
The strong corrosion behavior at the Al current collector restricts the application range of lithium bis (trifluoromethanesulfonylimide) (LiTFSI), despite its high stability against water and thermal. SEM, LSV and Tafel curves proved that adding LiODFB into LiTFSI-based electrolytes could suppress aluminum corrosion caused by LiTFSI-based electrolytes. The cycling stability and rate capability of LiFePO4-based batteries using LiTFSI0.6-LiODFB0.4-based electrolytes is excellent as compared to LiFePO4-based batteries using LiPF6-based electrolytes.
G-LiHT: Goddard's LiDAR, Hyperspectral and Thermal Airborne Imager
Cook, Bruce; Corp, Lawrence; Nelson, Ross; Morton, Douglas; Ranson, Kenneth J.; Masek, Jeffrey; Middleton, Elizabeth
2012-01-01
Scientists at NASA's Goddard Space Flight Center have developed an ultra-portable, low-cost, multi-sensor remote sensing system for studying the form and function of terrestrial ecosystems. G-LiHT integrates two LIDARs, a 905 nanometer single beam profiler and 1550 nm scanner, with a narrowband (1.5 nanometers) VNIR imaging spectrometer and a broadband (8-14 micrometers) thermal imager. The small footprint (approximately 12 centimeters) LIDAR data and approximately 1 meter ground resolution imagery are advantageous for high resolution applications such as the delineation of canopy crowns, characterization of canopy gaps, and the identification of sparse, low-stature vegetation, which is difficult to detect from space-based instruments and large-footprint LiDAR. The hyperspectral and thermal imagery can be used to characterize species composition, variations in biophysical variables (e.g., photosynthetic pigments), surface temperature, and responses to environmental stressors (e.g., heat, moisture loss). Additionally, the combination of LIDAR optical, and thermal data from G-LiHT is being used to assess forest health by sensing differences in foliage density, photosynthetic pigments, and transpiration. Low operating costs (approximately $1 ha) have allowed us to evaluate seasonal differences in LiDAR, passive optical and thermal data, which provides insight into year-round observations from space. Canopy characteristics and tree allometry (e.g., crown height:width, canopy:ground reflectance) derived from G-LiHT data are being used to generate realistic scenes for radiative transfer models, which in turn are being used to improve instrument design and ensure continuity between LiDAR instruments. G-LiHT has been installed and tested in aircraft with fuselage viewports and in a custom wing-mounted pod that allows G-LiHT to be flown on any Cessna 206, a common aircraft in use throughout the world. G-LiHT is currently being used for forest biomass and growth estimation
demystifying the shock of shocking
African Journals Online (AJOL)
(with a pulse), atrial fibrillation and atrial flutter. The energy dose in cardioversion is less (0.5. - 2 J/kg) than in defibrillation (2 - 4 J/kg). In cardioversion the shock is discharged synchronously with the native R wave of the patient. Without synchronisation,. VF can be induced if a shock is delivered during the refractory period ...
International Nuclear Information System (INIS)
Kojima, Naoki; Matsushita, Kazuo.
1992-01-01
Small pieces of shock absorbers are filled in a space of a shock absorbing vessel which is divided into a plurality of sections by partitioning members. These sections function to prevent excess deformation or replacement of the fillers upon occurrence of falling accident. Since the shock absorbing small pieces in the shock absorbing vessel are filled irregularly, shock absorbing characteristics such as compression strength is not varied depending on the direction, but they exhibit excellent shock absorbing performance. They surely absorb shocks exerted on a transportation vessel upon falling or the like. If existing artificial fillers such as pole rings made of metal or ceramic and cut pieces such as alumium extrusion molding products are used as the shock absorbing pieces, they have excellent fire-proofness and cold resistance since the small pieces are inflammable and do not contain water. (T.M.)
Mattsson, Thomas R.; Jones, Reese; Ward, Donald; Spataru, Catalin; Shulenburger, Luke; Benedict, Lorin X.
2015-06-01
Window materials are ubiquitous in shock physics and with high energy density drivers capable of reaching multi-Mbar pressures the use of LiF is increasing. Velocimetry and temperature measurements of a sample through a window are both influenced by the assumed index of refraction and thermal conductivity, respectively. We report on calculations of index of refraction using the many-body theory GW and thermal ionic conductivity using linear response theory and model potentials. The results are expected to increase the accuracy of a broad range of high-pressure shock- and ramp compression experiments. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Company, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL85000.
Electrochemical performances of LiMnPO4 synthesized from non-stoichiometric Li/Mn ratio.
Xiao, Jie; Chernova, Natasha A; Upreti, Shailesh; Chen, Xilin; Li, Zheng; Deng, Zhiqun; Choi, Daiwon; Xu, Wu; Nie, Zimin; Graff, Gordon L; Liu, Jun; Whittingham, M Stanley; Zhang, Ji-Guang
2011-10-28
In this paper, the influences of the lithium content in the starting materials on the final performances of as-prepared Li(x)MnPO(4) (x hereafter represents the starting Li content in the synthesis step which does not necessarily mean that Li(x)MnPO(4) is a single phase solid solution in this work.) are systematically investigated. It has been revealed that Mn(2)P(2)O(7) is the main impurity when Li Li(3)PO(4) begins to form once x > 1.0. The interactions between Mn(2)P(2)O(7) or Li(3)PO(4) impurities and LiMnPO(4) are studied in terms of the structural, electrochemical, and magnetic properties. At a slow rate of C/50, the reversible capacity of both Li(0.5)MnPO(4) and Li(0.8)MnPO(4) increases with cycling. This indicates a gradual activation of more sites to accommodate a reversible diffusion of Li(+) ions that may be related to the interaction between Mn(2)P(2)O(7) and LiMnPO(4) nanoparticles. Among all of the different compositions, Li(1.1)MnPO(4) exhibits the most stable cycling ability probably because of the existence of a trace amount of Li(3)PO(4) impurity that functions as a solid-state electrolyte on the surface. The magnetic properties and X-ray absorption spectroscopy (XAS) of the MnPO(4)·H(2)O precursor, pure and carbon-coated Li(x)MnPO(4) are also investigated to identify the key steps involved in preparing a high-performance LiMnPO(4). This journal is © the Owner Societies 2011
Li-rich anti-perovskite Li3OCl films with enhanced ionic conductivity
Energy Technology Data Exchange (ETDEWEB)
Lu, XJ; Wu, G; Howard, JW; Chen, AP; Zhao, YS; Daemen, LL; Jia, QX
2014-08-13
Anti-perovskite solid electrolyte films were prepared by pulsed laser deposition, and their room-temperature ionic conductivity can be improved by more than an order of magnitude in comparison with its bulk counterpart. The cyclability of Li3OCl films in contact with lithium was evaluated using a Li/Li3OCl/Li symmetric cell, showing self-stabilization during cycling test.
Li plating as unwanted side reaction in commercial Li-ion cells - A review
Waldmann, Thomas; Hogg, Björn-Ingo; Wohlfahrt-Mehrens, Margret
2018-04-01
Deposition of Lithium metal on anodes contributes significantly to ageing of Li-ion cells. Lithium deposition is connected not only to a drastic limitation of life-time, but also to fast-charging capability and safety issues. Lithium deposition in commercial Li-ion cells is not limited to operation conditions at low temperatures. In recent publications various types of commercial cells were investigated using complimentary analysis methods. Five cell types studied in literature (18650, 26650, pouch) serve as a basis for comparison when and why Li deposition happens in commercial Li-ion cells. In the present paper, we reviewed literature on (i) causes, (ii) hints and evidences for Li deposition, (iii) macroscopic morphology of Li deposition/plating, (iv) ageing mechanisms and shapes of capacity fade curves involving Li deposition, and (v) influences of Li deposition on safety. Although often discussed, safety issues regarding Li deposition are not only limited to dendrite growth and internal short circuits, but also to exothermic reactions in the presence of Lithium metal. Furthermore, we tried to connect knowledge from different length scales including the macroscopic level (Li-ion cells, operating conditions, gradients in cells, electrochemical tests, safety tests), the microscopic level (electrodes, particles, microstructure), and the atomic level (atoms, ions, molecules, energy barriers).
Study on Reflected Shock Wave/Boundary Layer Interaction in a Shock Tube
Energy Technology Data Exchange (ETDEWEB)
Kim, Dong Wook; Kim, Tae Ho; Kim, Heuy Dong [Andong Nat’l Univ., Andong (Korea, Republic of)
2017-07-15
The interaction between a shock wave and a boundary layer causes boundary layer separation, shock train, and in some cases, strong unsteadiness in the flow field. Such a situation is also observed in a shock tube, where the reflected shock wave interacts with the unsteady boundary layer. However, only a few studies have been conducted to investigate the shock train phenomenon in a shock tube. In the present study, numerical studies were conducted using the two-dimensional axisymmetric domain of a shock tube, and compressible Navier-Stokes equations were solved to clarify the flow characteristics of shock train phenomenon inside a shock tube. A detailed wave diagram was developed based on the present computational results, which were validated with existing experimental data.
Dehaven, Martin R.; Vandersall, Kevin S.; Strickland, Shawn L.; Fried, Laurence E.; Tarver, Craig M.
2017-06-01
Experiments were performed at -55°C to measure the reacted state of LX-17 (92.5% TATB and 7.5% Kel-F by weight) using a double shock technique using two flyer materials (with known properties) mounted on a projectile that send an initial shock through the material close to the Chapman-Jouguet (CJ) state followed by a second shock at a higher magnitude into the detonated material. Information on the reacted state is obtained by measuring the relative timing and magnitude of the first and second shock waves. The LX-17 detonation reaction zone profiles plus the arrival times and amplitudes of reflected shocks in LX-17 detonation reaction products were measured using Photonic Doppler Velocimetry (PDV) probes and an aluminum foil coated LiF window. A discussion of this work will include a comparison to prior work at ambient temperature, the experimental parameters, velocimetry profiles, data interpretation, reactive CHEETAH and Ignition and Growth modeling, as well as detail on possible future experiments. This work performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.
Atomic simulations for configurations and solid-liquid interface of Li-Fe and Li-Cu icosahedra
Energy Technology Data Exchange (ETDEWEB)
Yang, Jianyu, E-mail: hnieyjy@aliyun.com [Hunan Institute of Engineering (China); Hu, Wangyu [Hunan University, College of Materials Science and Engineering (China); Dai, Xiongying [Hunan Institute of Engineering, College of Science (China)
2017-04-15
The melting point of Li is lower than that of Fe (or Cu); thus, solid-liquid interfaces can be easily formed on Li-Fe and Li-Cu nanoalloys. In this work, the configurations and solid-liquid interfaces of Li-Fe and Li-Cu icosahedra are studied using Monte Carlo and molecular dynamics methods. The atomic interactions are described by the analytic embedded-atom method. The dependence of composition, temperature, and nanoparticle size on the configurations and thermal stabilities of nanoalloys is discussed. The behavior of the Li-Fe and Li-Cu nanoalloys in segregation, configuration, and thermal stability is investigated. A different behavior of surface segregation of Li atoms is observed for the two types of nanoalloys. The interface between the Li and Fe atoms is clear. Mixing of Li with Cu at larger nanoparticle sizes is found because of low heat of formation in the system. The configurations of the Li-Fe and Li-Cu nanoalloys are related to the competition between surface segregation and alloying. The thermal stability of Li in the two types of nanoalloys is enhanced by the support of the Fe (or Cu) solid substrate.
Spectroscopic analysis of LiHoF4 and LiErF4
DEFF Research Database (Denmark)
Christensen, H.P.
1979-01-01
The polarized absorption spectra for Ho3+ and Er3+ in LiHoF4 and LiErF4, respectively, have been recorded in the spectral interval 4000-26 000 cm-1 at 2 K. Parts of the spectra were examined at higher temperatures. The experimental levels for Ho3+ and Er3+ in LiRF4 were close to those found in Li...
Mechanistic insights of Li+ diffusion within doped LiFePO4 from Muon Spectroscopy.
Johnson, Ian D; Ashton, Thomas E; Blagovidova, Ekaterina; Smales, Glen J; Lübke, Mechthild; Baker, Peter J; Corr, Serena A; Darr, Jawwad A
2018-03-07
The Li + ion diffusion characteristics of V- and Nb-doped LiFePO 4 were examined with respect to undoped LiFePO 4 using muon spectroscopy (µSR) as a local probe. As little difference in diffusion coefficient between the pure and doped samples was observed, offering D Li values in the range 1.8-2.3 × 10 -10 cm 2 s -1 , this implied the improvement in electrochemical performance observed within doped LiFePO 4 was not a result of increased local Li + diffusion. This unexpected observation was made possible with the µSR technique, which can measure Li + self-diffusion within LiFePO 4 , and therefore negated the effect of the LiFePO 4 two-phase delithiation mechanism, which has previously prevented accurate Li + diffusion comparison between the doped and undoped materials. Therefore, the authors suggest that µSR is an excellent technique for analysing materials on a local scale to elucidate the effects of dopants on solid-state diffusion behaviour.
Uniform second Li ion intercalation in solid state ϵ-LiVOPO{sub 4}
Energy Technology Data Exchange (ETDEWEB)
Wangoh, Linda W.; Quackenbush, Nicholas F. [Department of Physics, Applied Physics and Astronomy, Binghamton University, Binghamton, New York 13902 (United States); Sallis, Shawn [Materials Science and Engineering, Binghamton University, Binghamton, New York 13902 (United States); Wiaderek, Kamila M.; Ma, Lu; Wu, Tianpin; Chapman, Karena W. [X-ray Science Division, Advanced Photon Source, Argonne National Laboratory, Argonne, Illinois 60439 (United States); Lin, Yuh-Chieh; Ong, Shyue Ping [Department of NanoEngineering, University of California San Diego, 9500 Gilman Drive 0448, La Jolla, California 92093 (United States); Wen, Bohua; Chernova, Natasha A.; Whittingham, M. Stanley [NECCES, Binghamton University, Binghamton, New York 13902 (United States); Guo, Jinghua [Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States); Lee, Tien-Lin; Schlueter, Christoph [Diamond Light Source Ltd., Harwell Science and Innovation Campus, Didcot, Oxfordshire OX11 0DE (United Kingdom); Piper, Louis F. J., E-mail: lpiper@binghamton.edu [Department of Physics, Applied Physics and Astronomy, Binghamton University, Binghamton, New York 13902 (United States); Materials Science and Engineering, Binghamton University, Binghamton, New York 13902 (United States)
2016-08-01
Full, reversible intercalation of two Li{sup +} has not yet been achieved in promising VOPO{sub 4} electrodes. A pronounced Li{sup +} gradient has been reported in the low voltage window (i.e., second lithium reaction) that is thought to originate from disrupted kinetics in the high voltage regime (i.e., first lithium reaction). Here, we employ a combination of hard and soft x–ray photoelectron and absorption spectroscopy techniques to depth profile solid state synthesized LiVOPO{sub 4} cycled within the low voltage window only. Analysis of the vanadium environment revealed no evidence of a Li{sup +} gradient, which combined with almost full theoretical capacity confirms that disrupted kinetics in the high voltage window are responsible for hindering full two lithium insertion. Furthermore, we argue that the uniform Li{sup +} intercalation is a prerequisite for the formation of intermediate phases Li{sub 1.50}VOPO{sub 4} and Li{sub 1.75}VOPO{sub 4}. The evolution from LiVOPO{sub 4} to Li{sub 2}VOPO{sub 4} via the intermediate phases is confirmed by direct comparison between O K–edge absorption spectroscopy and density functional theory.
Ab initio identification of the Li-rich phase in LiFePO4.
Zeng, Hua; Gu, Yue; Teng, Gaofeng; Liu, Yimeng; Zheng, Jiaxin; Pan, Feng
2018-06-27
A recent discovery of anionic redox activity in Li-rich layered compounds opens a new direction for the design of high-capacity cathode materials for lithium-ion batteries. Here using extensive ab initio calculations, the thermodynamic existence of the Li-rich phase in LiFePO4 to form Li1+xFe1-xPO4 with x not exceeding 12.5% has been proved. Anionic redox activity and structural stability during delithiation are further investigated. Interestingly, it is found that Li1+xFe1-xPO4 cannot be delithiated completely and thus cannot achieve extra capacity by anionic redox activity, because the local oxygen-ion redox will cause the fracture of the rigid framework formed by phosphate tetrahedral polyanions. Although an extra capacity cannot be realized, the excess Li-ions at Fe sites can enhance the Li-ion diffusivity along the adjacent [010] channel and contribute to the shift from 1D to 2D/3D diffusion. This study provides a fresh perspective on olivine-type LiFePO4 and offers some important clues on designing Li-rich cathode materials with high energy density.
Collisionless electrostatic shocks
DEFF Research Database (Denmark)
Andersen, H.K.; Andersen, S.A.; Jensen, Vagn Orla
1970-01-01
An attempt was made in the laboratory to observe the standing collisionless electrostatic shocks in connection with the bow shock of the earth......An attempt was made in the laboratory to observe the standing collisionless electrostatic shocks in connection with the bow shock of the earth...
Sound velocity of tantalum under shock compression in the 18–142 GPa range
Energy Technology Data Exchange (ETDEWEB)
Xi, Feng, E-mail: xifeng@caep.cn; Jin, Ke; Cai, Lingcang, E-mail: cai-lingcang@aliyun.com; Geng, Huayun; Tan, Ye; Li, Jun [National Key Laboratory of Shock Waves and Detonation Physics, Institute of Fluid Physics, CAEP, P.O. Box 919-102 Mianyang, Sichuan 621999 (China)
2015-05-14
Dynamic compression experiments of tantalum (Ta) within a shock pressure range from 18–142 GPa were conducted driven by explosive, a two-stage light gas gun, and a powder gun, respectively. The time-resolved Ta/LiF (lithium fluoride) interface velocity profiles were recorded with a displacement interferometer system for any reflector. Sound velocities of Ta were obtained from the peak state time duration measurements with the step-sample technique and the direct-reverse impact technique. The uncertainty of measured sound velocities were analyzed carefully, which suggests that the symmetrical impact method with step-samples is more accurate for sound velocity measurement, and the most important parameter in this type experiment is the accurate sample/window particle velocity profile, especially the accurate peak state time duration. From these carefully analyzed sound velocity data, no evidence of a phase transition was found up to the shock melting pressure of Ta.
Energy Technology Data Exchange (ETDEWEB)
Ogawa, Seiya [Course of Mechanical Engineering, Graduate School of Engineering, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan); Masuko, Yuki; Kato, Hirokazu; Yuyama, Hayato; Sakai, Yutaro [Department of Prime Mover Engineering, School of Engineering, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan); Niwa, Eiki; Hashimoto, Takuya [Department of Physics, College of Humanities and Sciences, Nihon University, 3-8-1 Sakurajousui, Setagaya-ku, Tokyo 156-8550 (Japan); Mukai, Keisuke [Department of Nuclear Engineering and Management, School of Engineering, The University of Tokyo, 7-3-1 Bunkyo-ku, Tokyo 113-8656 (Japan); Hosino, Tsuyoshi [Breeding Functional Materials Development Group, Department of Blanket Systems Research, Rokkasho Fusion Institute, Sector of Fusion Research and Development, Japan Atomic Energy Agency, 2-166 Obuch, Omotedate, Rokkasho-mura, Kamikita-gun, Aomori 039-3212 (Japan); Sasaki, Kazuya, E-mail: k_sasaki@tokai-u.jp [Course of Mechanical Engineering, Graduate School of Engineering, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan); Department of Prime Mover Engineering, School of Engineering, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan); Course of Mechanical Engineering and Aeronautics and Astronautics, Graduate School of Science and Technology, Tokai University, 4-1-1 Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan)
2015-10-15
Highlights: • We synthesized two phase materials based on Li{sub 2}SiO{sub 3} and Li{sub 2}TiO{sub 3}. • We investigated the Li vaporization property of the two-phase materials. • Li vaporization occurs significantly from only Li{sub 2}SiO{sub 3} grains in the vicinity of the surface of the pellets. • The Li vaporization is remarkable only for an early short time for the vaporization from Li{sub 2}SiO{sub 3} grains at the vicinity of the surface. • The second stable phase added functions effectively for inhibition of the Li vaporization. - Abstract: Li vaporization property of two-phase materials of Li{sub 2}TiO{sub 3} and Li{sub 2}SiO{sub 3} in a working condition for the solid tritium breeder used in the demonstration power plant of fusion reactor was investigated, and the suppression mechanism of the vaporization was considered. The Li vaporization rate from the specimen pellet was measured by gravimetric method, and the change of Li concentration distribution in the pellet was analyzed by time-of-flight secondary ion mass spectrometer. Li was vaporized only from the Li{sub 2}SiO{sub 3} at the vicinity of the surface of the pellet. The remarkable vaporization of Li arose only in an early short time. The inhibition of the vaporization from the Li{sub 2}SiO{sub 3} was successful by adding the small amount of the stable secondary phase of Li{sub 2}TiO{sub 3}.
Al-Qawasmeh, Ahmad; Holzwarth, N. A. W.
2017-10-01
Two lithium oxonitridophosphate materials are computationally examined and found to be promising solid electrolytes for possible use in all solid-state batteries having metallic Li anodes - Li14P2O3N6 and Li7PN4. The first principles simulations are in good agreement with the structural analyses reported in the literature for these materials and the computed total energies indicate that both materials are stable with respect to decomposition into binary and ternary products. The computational results suggest that both materials are likely to form metastable interfaces with Li metal. The simulations also find both materials to have Li ion migration activation energies comparable or smaller than those of related Li ion electrolyte materials. Specifically, for Li7PN4, the experimentally measured activation energy can be explained by the migration of a Li ion vacancy stabilized by a small number of O2- ions substituting for N3- ions. For Li14P2O3N6, the activation energy for Li ion migration has not yet been experimentally measured, but simulations predict it to be smaller than that measured for Li7PN4.
Annihilation of antiferromagnetic order in LiCoO2 by excess Li
International Nuclear Information System (INIS)
Sugiyama, Jun; Ikedo, Yutaka; Nozaki, Hiroshi; Mukai, Kazuhiko; Andreica, Daniel; Amato, Alex; Menetrier, Michel; Carlier, Dany; Delmas, Claude
2009-01-01
In order to elucidate the origin of antiferromagnetic (AF) order below 30 K in LiCoO 2 , in which all the Co 3+ ions are in a low-spin state with S=0, the magnetic nature of the Li-excess sample Li 1.04 Co 0.96 O 1.96 was studied by muon-spin spectroscopy in the temperature range between 1.8 and 100 K. Although disordered localized moments appeared below 25 K, static AF order was not detected even at 1.8 K. Moreover, a small amount of excess Li ions (4%) and oxygen vacancies (2%) was found to change ∼50% of the sample into a magnetically disordered phase at 1.8 K. The stoichiometric LiCoO 2 , which was prepared from the same starting materials to those for the Li-excess sample, showed an AF transition at 30 K, while the volume fraction of the AF phase was 10% even at 1.8 K. This therefore excludes the possible role of the excess Li + on the formation of static AF order.
LiFePO4/polymer/natural graphite: low cost Li-ion batteries
International Nuclear Information System (INIS)
Zaghib, K.; Striebel, K.; Guerfi, A.; Shim, J.; Armand, M.; Gauthier, M
2004-01-01
The aging and performance of natural graphite/PEO-based gel electrolyte/LiFePO 4 cells are reported. The gel polymer electrolytes were produced by electron-beam irradiation and then soaked in a liquid electrolyte. The natural graphite anode in gel electrolyte containing LiBF4-EC/GBL exhibited high reversible capacity (345 mAh/g) and high coulombic efficiency (91%). The LiFePO 4 cathode in the same gel-polymer exhibited a reversible capacity of 160 mAh/g and 93% coulombic efficiency. Better performance was obtained at high-rate discharge with 6% carbon additive in the cathode, however the graphite anode performance suffers at high rate. The Li-ion gel polymer battery shows a capacity fade of 13% after 180 cycles and has poor performance at low temperature due to low diffusion of the lithium to the graphite in the GBL system. The LiFePO 4 /gel/Li system has an excellent rate capacity. LiFePO 4 cathode material is suitable for HEV application
Distillation of LiCl from the LiCl-Li2O molten salt of the electrolytic reduction process
International Nuclear Information System (INIS)
Kim, I.S.; Oh, S.C.; Im, H.S.; Hur, J.M.; Lee, H.S.
2013-01-01
Electrolytic reduction of the uranium oxide in LiCl-Li 2 O molten salt for the treatment of spent nuclear fuel requires the separation of the residual salt from the reduced metal product, which contains about 20 wt% salt. In order to separate the residual salt and reuse it in the electrolytic reduction, a vacuum distillation process was developed. Lab-scale distillation equipment was designed and installed in an argon atmosphere glove box. The equipment consisted of an evaporator in which the reduced metal product was contained and exposed to a high temperature and reduced pressure; a receiver; and a vertically oriented condenser that operated at a temperature below the melting point of lithium chloride. We performed experiments with LiCl-Li 2 O salt to evaluate the evaporation rate of LiCl salt and varied the operating temperature to discern its effect on the behavior of salt evaporation. Complete removal of the LiCl salt from the evaporator was accomplished by reducing the internal pressure to <100 mTorr and heating to 900 deg C. We achieved evaporation efficiency as high as 100 %. (author)
Elastic, dynamical, and electronic properties of LiHg and Li3Hg: First-principles study
Wang, Yan; Hao, Chun-Mei; Huang, Hong-Mei; Li, Yan-Ling
2018-04-01
The elastic, dynamical, and electronic properties of cubic LiHg and Li3Hg were investigated based on first-principles methods. The elastic constants and phonon spectral calculations confirmed the mechanical and dynamical stability of the materials at ambient conditions. The obtained elastic moduli of LiHg are slightly larger than those of Li3Hg. Both LiHg and Li3Hg are ductile materials with strong shear anisotropy as metals with mixed ionic, covalent, and metallic interactions. The calculated Debye temperatures are 223.5 K and 230.6 K for LiHg and Li3Hg, respectively. The calculated phonon frequency of the T2 g mode in Li3Hg is 326.8 cm-1. The p states from the Hg and Li atoms dominate the electronic structure near the Fermi level. These findings may inspire further experimental and theoretical study on the potential technical and engineering applications of similar alkali metal-based intermetallic compounds.
Effects of Atwood number on shock focusing in shock-cylinder interaction
Ou, Junfeng; Ding, Juchun; Luo, Xisheng; Zhai, Zhigang
2018-02-01
The evolution of shock-accelerated heavy-gas cylinder surrounded by the air with different Atwood numbers (A_t=0.28, 0.50, 0.63) is investigated, concentrating on shock focusing and jet formation. Experimentally, a soap film technique is used to generate an ideal two-dimensional discontinuous gas cylinder with a clear surface, which can guarantee the observation of shock wave movements inside the cylinder. Different Atwood numbers are realized by different mixing ratios of SF_6 and air inside the cylinder. A high-speed schlieren system is adopted to capture the shock motions and jet morphology. Numerical simulations are also performed to provide more information. The results indicate that an inward jet is formed for low Atwood numbers, while an outward jet is generated for high Atwood numbers. Different Atwood numbers will lead to the differences in the relative velocities between the incident shock and the refraction shock, which ultimately results in the differences in shock competition near the downstream pole. The morphology and feature of the jet are closely associated with the position and intensity of shock focusing. The pressure and vorticity contours indicate that the jet formation should be attributed to the pressure pulsation caused by shock focusing, and the jet development is ascribed to the vorticity induction. Finally, a time ratio proposed in the previous work for determining the shock-focusing type is verified by experiments.
Shock parameter calculations at weak interplanetary shock waves
Directory of Open Access Journals (Sweden)
J. M. Gloag
2005-02-01
Full Text Available A large set of interplanetary shock waves observed using the Ulysses spacecraft is analysed in order to determine their local parameters. For the first time a detailed analysis is extended to the thermodynamic properties of a large number of events. The intention is to relate the shock parameters to the requirements set by MHD shock theory. A uniform approach is adopted in the selection of up and downstream regions for this analysis and applied to all the shock waves. Initially, the general case of a 3 component adiabatic plasma is considered. However, the calculation of magnetosonic and Alfvénic Mach numbers and the ratio of downstream to upstream entropy produce some unexpected results. In some cases there is no clear increase in entropy across the shock and also the magnetosonic Mach number can be less than 1. It is found that a more discerning use of data along with an empirical value for the polytropic index can raise the distribution of downstream to upstream entropy ratios to a more acceptable level. However, it is also realised that many of these shocks are at the very weakest end of the spectrum and associated phenomena may also contribute to the explanation of these results.
A Novel Digital Background Calibration Technique for 16 bit SHA-less Multibit Pipelined ADC
Directory of Open Access Journals (Sweden)
Swina Narula
2016-01-01
Full Text Available In this paper, a high resolution of 16 bit and high speed of 125MS/s, multibit Pipelined ADC with digital background calibration is presented. In order to achieve low power, SHA-less front end is used with multibit stages. The first and second stages are used here as a 3.5 bit and the stages from third to seventh are of 2.5 bit and last stage is of 3-bit flash ADC. After bit alignment and truncation of total 19 bits, 16 bits are used as final digital output. To precise the remove linear gain error of the residue amplifier and capacitor mismatching error, a digital background calibration technique is used, which is a combination of signal dependent dithering (SDD and butterfly shuffler. To improve settling time of residue amplifier, a special circuit of voltage separation is used. With the proposed digital background calibration technique, the spurious-free dynamic range (SFDR has been improved to 97.74 dB @30 MHz and 88.9 dB @150 MHz, and the signal-to-noise and distortion ratio (SNDR has been improved to 79.77 dB @ 30 MHz, and 73.5 dB @ 150 MHz. The implementation of the Pipelined ADC has been completed with technology parameters of 0.18μm CMOS process with 1.8 V supply. Total power consumption is 300 mW by the proposed ADC.
NASA Goddards LiDAR, Hyperspectral and Thermal (G-LiHT) Airborne Imager
Cook, Bruce D.; Corp, Lawrence A.; Nelson, Ross F.; Middleton, Elizabeth M.; Morton, Douglas C.; McCorkel, Joel T.; Masek, Jeffrey G.; Ranson, Kenneth J.; Ly, Vuong; Montesano, Paul M.
2013-01-01
The combination of LiDAR and optical remotely sensed data provides unique information about ecosystem structure and function. Here, we describe the development, validation and application of a new airborne system that integrates commercial off the shelf LiDAR hyperspectral and thermal components in a compact, lightweight and portable system. Goddard's LiDAR, Hyperspectral and Thermal (G-LiHT) airborne imager is a unique system that permits simultaneous measurements of vegetation structure, foliar spectra and surface temperatures at very high spatial resolution (approximately 1 m) on a wide range of airborne platforms. The complementary nature of LiDAR, optical and thermal data provide an analytical framework for the development of new algorithms to map plant species composition, plant functional types, biodiversity, biomass and carbon stocks, and plant growth. In addition, G-LiHT data enhance our ability to validate data from existing satellite missions and support NASA Earth Science research. G-LiHT's data processing and distribution system is designed to give scientists open access to both low- and high-level data products (http://gliht.gsfc.nasa.gov), which will stimulate the community development of synergistic data fusion algorithms. G-LiHT has been used to collect more than 6,500 km2 of data for NASA-sponsored studies across a broad range of ecoregions in the USA and Mexico. In this paper, we document G-LiHT design considerations, physical specifications, instrument performance and calibration and acquisition parameters. In addition, we describe the data processing system and higher-level data products that are freely distributed under NASA's Data and Information policy.
Shock Mechanism Analysis and Simulation of High-Power Hydraulic Shock Wave Simulator
Directory of Open Access Journals (Sweden)
Xiaoqiu Xu
2017-01-01
Full Text Available The simulation of regular shock wave (e.g., half-sine can be achieved by the traditional rubber shock simulator, but the practical high-power shock wave characterized by steep prepeak and gentle postpeak is hard to be realized by the same. To tackle this disadvantage, a novel high-power hydraulic shock wave simulator based on the live firing muzzle shock principle was proposed in the current work. The influence of the typical shock characteristic parameters on the shock force wave was investigated via both theoretical deduction and software simulation. According to the obtained data compared with the results, in fact, it can be concluded that the developed hydraulic shock wave simulator can be applied to simulate the real condition of the shocking system. Further, the similarity evaluation of shock wave simulation was achieved based on the curvature distance, and the results stated that the simulation method was reasonable and the structural optimization based on software simulation is also beneficial to the increase of efficiency. Finally, the combination of theoretical analysis and simulation for the development of artillery recoil tester is a comprehensive approach in the design and structure optimization of the recoil system.
Li2SnO3 derived secondary Li-Sn alloy electrode for lithium-ion batteries
International Nuclear Information System (INIS)
Zhang, D.W.; Zhang, S.Q.; Jin, Y.; Yi, T.H.; Xie, S.; Chen, C.H.
2006-01-01
As a possible high-capacity Li-ion battery anode material, Li 2 SnO 3 was prepared via a solid-state reaction route and a sol-gel route, separately. Its electrochemical performance was tested in coin-type cells with metallic Li as the counter electrode. The results show that the sol-gel derived Li 2 SnO 3 has uniform nano-sized particles (200-300 nm) and can deliver a better reversible capacity (380 mAh/g after 50 cycles in the voltage window of 0-1 V) than that from the solid-state reaction route. The characterizations by means of galvanostatic cycling, cyclic voltammetry and ex situ X-ray diffraction indicate that the electrochemical process of the Li 2 SnO 3 lithiation proceeds with an initial structural reduction of the composite oxide into Sn-metal and Li 2 O followed by a reversible Li-Sn alloy formation in the Li 2 O matrix. Due to the buffer role of the Li 2 O matrix, the reversibility of the secondary Li-Sn alloy electrode is largely secured
Li-rich layer-structured cathode materials for high energy Li-ion batteries
Li, Liu; Lee, Kim Seng; Lu, Li
2014-08-01
Li-rich layer-structured xLi2MnO3 ṡ (1 - x)LiMO2 (M = Mn, Ni, Co, etc.) materials have attracted much attention due to their extraordinarily high reversible capacity as the cathode material in Li-ion batteries. To better understand the nature of this type of materials, this paper reviews history of development of the Li-rich cathode materials, and provides in-depth study on complicated crystal structures and reaction mechanisms during electrochemical charge/discharge cycling. Despite the fabulous capability at low rate, several drawbacks still gap this type of high-capacity cathode materials from practical applications, for instance the large irreversible capacity loss at first cycle, poor rate capability, severe voltage decay and capacity fade during electrochemical charge/discharge cycling. This review will also address mechanisms for these inferior properties and propose various possible solutions to solve above issues for future utilization of these cathode materials in commercial Li-ion batteries.
International Nuclear Information System (INIS)
Malkov, M.A.; Kennel, C.F.; Wu, C.C.; Pellat, R.; Shapiro, V.D.
1991-01-01
The Cohen--Kulsrud--Burgers equation (CKB) is used to consider the nonlinear evolution of resistive, quasiparallel Alfven waves subject to a long-wavelength, plane-polarized, monochromatic instability. The instability saturates by nonlinear steepening, which proceeds until the periodic waveform develops an interior scale length comparable to the dissipation length; a fast or an intermediate shock then forms. The result is a periodic train of Alfven shocks of one or the other type. For propagation strictly parallel to the magnetic field, there will be two shocks per instability wavelength. Numerical integration of the time-dependent CKB equation shows that an initial, small-amplitude growing wave asymptotes to a stable, periodic stationary wave whose analytic solution specifies how the type of shock embedded in the shock train, and the amplitude and speed of the shock train, depend on the strength and phase of the instability. Waveforms observed upstream of the Earth's bowshock and cometary shocks resemble those calculated here
Scintillation properties of LiF–SrF2 and LiF–CaF2 eutectic
International Nuclear Information System (INIS)
Yanagida, Takayuki; Kawaguchi, Noriaki; Fujimoto, Yutaka; Fukuda, Kentaro; Watanabe, Kenichi; Yamazaki, Atsushi; Uritani, Akira
2013-01-01
Dopant free eutectic scintillators 6 LiF–SrF 2 and 6 LiF–CaF 2 were developed by the vertical Bridgeman method for the purpose of thermal neutron detection. The molar ratio of LiF and Ca/SrF 2 was 4:1 on its eutectic composition. The α-ray induced radioluminescence spectra of the scintillators showed intense emission peak at 300 nm due to the emission from the self-trapped exciton in Ca/SrF 2 layers. When the samples were irradiated with 252 Cf neutrons, 6 LiF–SrF 2 and 6 LiF–CaF 2 exhibited the light yields of 4700 and 9400 ph/n, respectively. Scintillation decay times of 6 LiF–SrF 2 and 6 LiF–CaF 2 were accepted for scintillation detectors, 90 and 250 ns, respectively. -- Highlights: • Nondoped LiF–CaF 2 and LiF–SrF 2 eutectic scinitillators are reported for the first time. • Two sample showed self-trapped exciton emission. • LiF–SrF 2 sample exhibited the light yield of 9400 ph/n and this value was comparable to conventional materials doped with rare earth ions. • Scintillation decay times of LiF–CaF 2 and LiF–SrF 2 were 250 and 90 ns, respectively
Dielectric properties of Li doped Li-Nb-O thin films
Energy Technology Data Exchange (ETDEWEB)
Perentzis, G.; Horopanitis, E.E.; Papadimitriou, L. [Aristotle University of Thessaloniki, Department of Physics, 54124 Thessaloniki (Greece); Durman, V.; Saly, V.; Packa, J. [Faculty of Electrical Engineering and Information Technology, Slovak University of Technology, Ilkovicova 3, 81219 Bratislava (Slovakia)
2007-03-15
Lithium niobate LiNbO{sub 3} was prepared as a thin film layered structure deposited on stainless steel substrate using e-gun evaporation. The Li doping was provided for by the formation of Li-Nb-O/Li/LiNb-O sandwich structure and annealing at about 250 C. AC impedance spectroscopy measurements were performed on the samples at temperatures from the interval between 28 and 165 C and in a frequency range of 10{sup -3} to 10{sup 6} Hz. Using the values Z' and Z'' at different frequencies, the dielectric parameters - parts of the complex permittivity {epsilon}' and {epsilon}'' and loss tangent tan {delta} were calculated. The results prove validity of the proposed equivalent circuit containing parallel RC elements connected in series where the first RC element represents the bulk of material and the second RC element belongs to the double layer at the metal interface. (copyright 2007 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Spherical strong-shock generation for shock-ignition inertial fusion
Energy Technology Data Exchange (ETDEWEB)
Theobald, W.; Seka, W.; Lafon, M.; Anderson, K. S.; Hohenberger, M.; Marshall, F. J.; Michel, D. T.; Solodov, A. A.; Stoeckl, C.; Edgell, D. H.; Yaakobi, B.; Shvydky, A. [Laboratory for Laser Energetics and Fusion Science Center, University of Rochester, Rochester, New York 14623 (United States); Nora, R.; Betti, R. [Laboratory for Laser Energetics and Fusion Science Center, University of Rochester, Rochester, New York 14623 (United States); Department of Mechanical Engineering and Department of Physics, University of Rochester, Rochester, New York 14623 (United States); Casner, A.; Reverdin, C. [CEA, DAM, DIF, F-91297 Arpajon (France); Ribeyre, X.; Vallet, A. [Université de Bordeaux-CNRS-CEA, CELIA (Centre Lasers Intenses et Applications) UMR 5107 F-33400 Talence (France); Peebles, J.; Beg, F. N. [University of California, San Diego, La Jolla, California 92093 (United States); and others
2015-05-15
Recent experiments on the Laboratory for Laser Energetics' OMEGA laser have been carried out to produce strong shocks in solid spherical targets with direct laser illumination. The shocks are launched at pressures of several hundred Mbars and reach Gbar upon convergence. The results are relevant to the validation of the shock-ignition scheme and to the development of an OMEGA experimental platform to study material properties at Gbar pressures. The experiments investigate the strength of the ablation pressure and the hot-electron production at incident laser intensities of ∼2 to 6 × 10{sup 15 }W/cm{sup 2} and demonstrate ablation pressures exceeding 300 Mbar, which is crucial to developing a shock-ignition target design for the National Ignition Facility. The timing of the x-ray flash from shock convergence in the center of the solid plastic target is used to infer the ablation and shock pressures. Laser–plasma instabilities produce hot-electrons with a moderate temperature (<100 keV). The instantaneous conversion efficiencies of laser power into hot-electron power reached up to ∼15% in the intensity spike. The large amount of hot electrons is correlated with an earlier x-ray flash and a strong increase in its magnitude. This suggests that hot electrons contribute to the augmentation of the shock strength.
Is shock index associated with outcome in children with sepsis/septic shock?*.
Yasaka, Yuki; Khemani, Robinder G; Markovitz, Barry P
2013-10-01
To investigate the association between PICU shock index (the ratio of heart rate to systolic blood pressure) and PICU mortality in children with sepsis/septic shock. To explore cutoff values for shock index for ICU mortality, how change in shock index over the first 6 hours of ICU admission is associated with outcome, and how the use of vasoactive therapy may affect shock index and its association with outcome. Retrospective cohort. Single-center tertiary PICU. Five hundred forty-four children with the diagnosis of sepsis/septic shock. None. From January 2003 to December 2009, 544 children met International Pediatric Sepsis Consensus Conference of 2005 criteria for sepsis/septic shock. Overall mortality was 23.7%. Among all patients, hourly shock index was associated with mortality: odds ratio of ICU mortality at 0 hour, 1.08, 95% CI (1.04-1.12); odds ratio at 1 hour, 1.09 (1.04-1.13); odds ratio at 2 hours, 1.09 (1.05-1.13); and odds ratio at 6 hours, 1.11 (1.06-1.15). When stratified by age, early shock index was associated with mortality only in children 1-3 and more than or equal to 12 years old. Area under the receiver operating characteristic curve in age 1-3 and more than or equal to 12 years old for shock index at admission was 0.69 (95% CI, 0.58-0.80) and 0.62 (95% CI, 0.52-0.72) respectively, indicating a fair predictive marker. Although higher shock index was associated with increased risk of mortality, there was no particular cutoff value with adequate positive or negative likelihood ratios to identify mortality in any age group of children. The improvement of shock index in the first 6 hours of ICU admission was not associated with outcome when analyzed in all patients. However, among patients whose shock index were above the 50th percentile at ICU admission for each age group, improvement of shock index was associated with lower ICU mortality in children between 1-3 and more than or equal to 12 years old (p = 0.02 and p = 0.03, respectively). When
Holtzapple, Mark T.; Madison, Maxine Jones; Ramirez, Rocio Sierra; Deimund, Mark A.; Falls, Matthew; Dunkelman, John J.
2014-07-01
Methods and apparatus for treating biomass that may include introducing a biomass to a chamber; exposing the biomass in the chamber to a shock event to produce a shocked biomass; and transferring the shocked biomass from the chamber. In some aspects, the method may include pretreating the biomass with a chemical before introducing the biomass to the chamber and/or after transferring shocked biomass from the chamber.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. Weixue Li. Articles written in Bulletin of Materials Science. Volume 29 Issue 3 June 2006 pp 313-316 Composites. Anisotropic properties of aligned SWNT modified poly (methyl methacrylate) nanocomposites · Weixue Li Qing Wang Jianfeng Dai · More Details Abstract Fulltext ...
Electrochemical behavior of LiV3O8 positive electrode in hybrid Li,Na-ion batteries
Maletti, S.; Sarapulova, A.; Tsirlin, A. A.; Oswald, S.; Fauth, F.; Giebeler, L.; Bramnik, N. N.; Ehrenberg, H.; Mikhailova, D.
2018-01-01
Vanadium(V)-containing oxides show superior intercalation properties for alkaline ions, although the performance of the material strongly depends on its surface morphology. In this work, intercalation activity of LiV3O8, prepared by a conventional solid state synthesis, is demonstrated for the first time in non-aqueous Li,Na-ion hybrid batteries with Na as negative electrode, and different Na/Li ratios in the electrolyte. In the pure Na-ion cell, one Na per formula unit of LiV3O8 can be reversibly inserted at room temperature via a two-step process, while further intercalation leads to gradual amorphisation of the material, with a specific capacity of 190 mAhg-1 after 10 cycles in the potential window of 0.8-3.4 V. Hybrid Li,Na-ion batteries feature simultaneous intercalation of Li+ and Na+ cations into LiV3O8, resulting in the formation of a second phase. Depending on the electrolyte composition, this second phase bears structural similarities either to Li0.7Na0.7V3O8 in Na-rich electrolytes, or to Li4V3O8 in Li-rich electrolytes. The chemical diffusion coefficients of Na+ and Li+ in crystalline LiV3O8 are very close, hence explaining the co-intercalation of these cations. As DFT calculations show, once formed, the Li0.7Na0.7V3O8-type structure favors intercalation of Na+, whereas the LiV3O8-type prefers to accommodate Li+ cations.
Li interactions with the B40 fullerene and its application in Li-ion batteries: DFT studies
Moradi, Morteza; Bagheri, Zargham; Bodaghi, Ali
2017-05-01
The interaction of Li and Li+ with a B40 all-boron fullerene was theoretically investigated at the B3LYP, and Minnesota 2006 levels of theory. It was found that, unexpectedly, the interaction Li+ cation with the electron deficient B40 fullerene is stronger than the Li atom. It indicates that the B40 fullerene does not act as a conventional Lewis acid because of its highly correlated structure. Frontier molecular orbitals, partial density of states, and natural bond orbital analyses were used to discuss this unusual behavior. Our calculations indicate that this behavior makes the B40 fullerene more appropriate for application in the Li-ion batteries as anode material. The calculated cell voltage is about 530 mV. Also, it was found that Hartree Fock (HF) exchange percentage of density functionals has a reverse effect on the adsorption energies of Li and Li+. This energy is increased and decreased, respectively, for Li+ and Li adsorptions by increasing %HF exchange. Finally, a potential energy surface for Li and Li+ penetration into B40 fullerene was predicted.
Cosmic-ray shock acceleration in oblique MHD shocks
Webb, G. M.; Drury, L. OC.; Volk, H. J.
1986-01-01
A one-dimensional, steady-state hydrodynamical model of cosmic-ray acceleration at oblique MHD shocks is presented. Upstream of the shock the incoming thermal plasma is subject to the adverse pressure gradient of the accelerated particles, the J x B force, as well as the thermal gas pressure gradient. The efficiency of the acceleration of cosmic-rays at the shock as a function of the upstream magnetic field obliquity and upstream plasma beta is investigated. Astrophysical applications of the results are briefly discussed.
Casalegno, Mosè; Castiglione, Franca; Passarello, Marco; Mele, Andrea; Passerini, Stefano; Raos, Guido
2016-07-21
Carboxymethylcellulose (CMC) has been proposed as a polymeric binder for electrodes in environmentally friendly Li-ion batteries. Its physical properties and interaction with Li(+) ions in water are interesting not only from the point of view of electrode preparation-processability in water is one of the main reasons for its environmental friendliness-but also for its possible application in aqueous Li-ion batteries. We combine molecular dynamics simulations and variable-time pulsed field gradient spin-echo (PFGSE) NMR spectroscopy to investigate Li(+) transport in CMC-based solutions. Both the simulations and experimental results show that, at concentrations at which Li-CMC has a gel-like consistency, the Li(+) diffusion coefficient is still very close to that in water. These Li(+) ions interact preferentially with the carboxylate groups of CMC, giving rise to a rich variety of coordination patterns. However, the diffusion of Li(+) in these systems is essentially unrestricted, with a fast, nanosecond-scale exchange of the ions between CMC and the aqueous environment. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Takeda, Nanami; Hoshino, Satoshi; Xie, Lixin; Chen, Shuo; Ikeuchi, Issei; Natsui, Ryuichi; Nakura, Kensuke; Yabuuchi, Naoaki
2017-11-01
A binary system of LiMoO2 - x LiF (0 ≤ x ≤ 2), Li1+xMoO2Fx, is systematically studied as potential positive electrode materials for rechargeable Li batteries. Single phase and nanosized samples on this binary system are successfully prepared by using a mechanical milling route. Crystal structures and Li storage properties on the binary system are also examined. Li2MoO2F (x = 1), which is classified as a cation-/anion-disordered rocksalt-type structure and is a thermodynamically metastable phase, delivers a large reversible capacity of over 300 mAh g-1 in Li cells with good reversibility. Highly reversible Li storage is realized for Li2MoO2F consisting of nanosized particles based on Mo3+/Mo5+ two-electron redox as evidenced by ex-situ X-ray absorption spectroscopy coupled with ex-situ X-ray diffractometry. Moreover, the presence of the most electronegative element in the framework structure effectively increases the electrode potential of Mo redox through an inductive effect. From these results, potential of nanosized lithium molybdenum oxyfluorides for high-capacity positive electrode materials of rechargeable Li batteries are discussed.
Irradiation cryostat for LiH and LiD polarized solid targets
International Nuclear Information System (INIS)
Goertz, S.
1991-01-01
Scattering experiments with polarized nucleon targets are an important tool to understand the nuclear spin structure. Pion photoproduction experiments on polarized protrons and neutrons as well as measurements of the neutron and deuteron formfactors will be performed at ELSA. 7 LiH and 6 LiD seem to be attractive target materials for these experiments, because they offer high proton and deuteron polarisation, respectively. Expecially 6 LiD has further very important advantages compared to the common deuteron target materials as d-Butanol and ND 3 . This work describes the mechanism of DNP (Dynamic Nuclear Polarization) in LiH and LiD and gives a view on the nature of the so-called paramagnetic impurities in these materials. In order to maximize the nuclear polarization, the production of these radicals have to take place under well defined temperature conditions. Therefore the first version of an irradiation cryostat was built and tested in regard to its cooling power and temperature adjustment. (orig.)
Li-ion batteries: Phase transition
International Nuclear Information System (INIS)
Hou Peiyu; Zhang Yantao; Zhang Lianqi; Chu Geng; Gao Jian
2016-01-01
Progress in the research on phase transitions during Li + extraction/insertion processes in typical battery materials is summarized as examples to illustrate the significance of understanding phase transition phenomena in Li-ion batteries. Physical phenomena such as phase transitions (and resultant phase diagrams) are often observed in Li-ion battery research and already play an important role in promoting Li-ion battery technology. For example, the phase transitions during Li + insertion/extraction are highly relevant to the thermodynamics and kinetics of Li-ion batteries, and even physical characteristics such as specific energy, power density, volume variation, and safety-related properties. (topical review)
Complex Diffusion Mechanisms for Li in Feldspar: Re-thinking Li-in-Plag Geospeedometry
Holycross, M.; Watson, E. B.
2017-12-01
In recent years, the lithium isotope system has been applied to model processes in a wide variety of terrestrial environments. In igneous settings, Li diffusion gradients have been frequently used to time heating episodes. Lithium partitioning behavior during decompression or cooling events drives Li transfer between phases, but the extent of Li exchange may be limited by its diffusion rate in geologic materials. Lithium is an exceptionally fast diffuser in silicate media, making it uniquely suited to record short-lived volcanic phenomena. The Li-in-plagioclase geospeedometer is often used to time explosive eruptions by applying laboratory-calibrated Li diffusion coefficients to model concentration profiles in magmatic feldspar samples. To quantify Li transport in natural scenarios, experimental measurements are needed that account for changing temperature and oxygen fugacity as well as different feldspar compositions and crystallographic orientation. Ambient pressure experiments were run at RPI to diffuse Li from a powdered spodumene source into polished sanidine, albite, oligoclase or anorthite crystals over the temperature range 500-950 ºC. The resulting 7Li concentration gradients developed in the mineral specimens were evaluated using laser ablation ICP-MS. The new data show that Li diffusion in all feldspar compositions simultaneously operates by both a "fast" and "slow" diffusion mechanism. Fast path diffusivities are similar to those found by Giletti and Shanahan [1997] for Li diffusion in plagioclase and are typically 10 to 20 times greater than slow path diffusivities. Lithium concentration gradients in the feldspar experiments plot in the shape of two superimposed error function curves with the slow diffusion regime in the near-surface of the crystal. Lithium diffusion is most sluggish in sanidine and is significantly faster in the plagioclase feldspars. It is still unclear what diffusion mechanism operates in nature, but the new measurements may impact
Modeling Li-ion conductivity in LiLa(PO{sub 3}){sub 4} powder
Energy Technology Data Exchange (ETDEWEB)
Mounir, Ferhi, E-mail: ferhi.mounir@gmail.com [Laboratoire de Physicochimie des Materiaux Mineraux et leurs Applications, Centre National des Recherches en Sciences des Materiaux, BP No. 73, 8027 Soliman (Tunisia); Karima, Horchani-Naifer [Laboratoire de Physicochimie des Materiaux Mineraux et leurs Applications, Centre National des Recherches en Sciences des Materiaux, BP No. 73, 8027 Soliman (Tunisia); Khaled, Ben Saad [Laboratoire de Photovoltaieque, Centre des Recherches et des Technologies de l' Energie, Technopole Borj Cedria, BP No. 95, 2050 Hammam Lif (Tunisia); Mokhtar, Ferid [Laboratoire de Physicochimie des Materiaux Mineraux et leurs Applications, Centre National des Recherches en Sciences des Materiaux, BP No. 73, 8027 Soliman (Tunisia)
2012-07-01
Polycrystalline powder and single-crystal of LiLa(PO{sub 3}){sub 4} are synthesized by solid state reaction and flux technique, respectively. A morphological description of the obtained product was made based on scanning electron microscopy micrographs. The obtained powder was characterized by X-ray powder diffraction, FTIR and Raman spectroscopies. Ionic conductivity of the LiLa(PO{sub 3}){sub 4} powder was measured and evaluated over a temperature range from 553 to 913 K. Single crystals of LiLa(PO{sub 3}){sub 4} are characterized by single-crystal X-ray diffraction. The LiLa(PO{sub 3}){sub 4} structure was found to be isotypic with LiNd(PO{sub 3}){sub 4}. It crystallizes in the monoclinic system with space group C2/c and cell parameters: a=16.635(6) A, b=7.130(3) A, c=9.913(3) A, {beta}=126.37(4) Degree-Sign , V=946.72(6) A{sup 3} and Z=4. The LiLa(PO{sub 3}){sub 4} structure was described as an alternation between spiraling chains (PO{sub 3}){sub n} and (La{sup 3+}, Li{sup +}) cations along the b direction. The small Li{sup +} ions, coordinated to four oxygen atoms, were located in the large connected cavities created between the LaO{sub 8} polyhedra and the polyphosphate chains. The jumping of Li{sup +} through tunnels of the crystalline network was investigated using complex impedance spectroscopy. The close value of the activation energies calculated through the analysis of conductivity data and loss spectra indicate that the transport in the investigated system is through hopping mechanism. The correlation between ionic conductivity of LiLa(PO{sub 3}){sub 4} and its crystallographic structure was investigated and the most probably transport pathway model was determined.
THE NEW DETECTIONS OF 7Li/6Li ISOTOPIC RATIO IN THE INTERSTELLAR MEDIA
International Nuclear Information System (INIS)
Kawanomoto, S.; Kajino, T.; Aoki, W.; Ando, H.; Noguchi, K.; Tanaka, W.; Bessell, M.; Suzuki, T. K.; Honda, S.; Izumiura, H.; Kambe, E.; Okita, K.; Watanabe, E.; Yoshida, M.; Sadakane, K.; Sato, B.; Tajitsu, A.; Takada-Hidai, M.
2009-01-01
We have determined the isotopic abundance ratio of 7 Li/ 6 Li in the interstellar media (ISMs) along lines of sight to HD169454 and HD250290 using the High-Dispersion Spectrograph on the Subaru Telescope. We also observed ζ Oph for comparison with previous data. The observed abundance ratios were 7 Li/ 6 Li = 8.1 +3.6 -1.8 and 6.3 +3.0 -1.7 for HD169454 and HD250290, respectively. These values are in reasonable agreement with those observed previously in the solar neighborhood ISMs within ±2σ error bars and are also consistent with our measurement of 7 Li/ 6 Li = 7.1 +2.9 -1.6 for a cloud along the line of sight to ζ Oph. This is good evidence for homogeneous mixing and instantaneous recycling of the gas component in the Galactic disk. We also discuss several source compositions of 7 Li, Galactic cosmic-ray interactions, stellar nucleosynthesis, and big bang nucleosynthesis.
Electrochemical behaviors of wax-coated Li powder/Li 4Ti 5O 12 cells
Park, Han Eol; Seong, Il Won; Yoon, Woo Young
The wax-coated Li powder specimen was effectively synthesized using the drop emulsion technique (DET). The wax layer on the powder was verified by SEM, Focused Ion Beam (FIB), EDX and XPS. The porosity of a sintered wax-coated Li electrode was measured by linear sweep voltammetry (LSV) and compared with that of a bare, i.e., un-coated Li electrode. The electrochemical behavior of the wax-coated Li powder anode cell was examined by the impedance analysis and cyclic testing methods. The cyclic behavior of the wax-coated Li powder anode with the Li 4Ti 5O 12 (LTO) cathode cell was examined at a constant current density of 0.35 mA cm -2 with the cut-off voltages of 1.2-2.0 V at 25 °C. Over 90% of the initial capacity of the cell remained even after the 300th cycle. The wax-coated Li powder was confirmed to be a stable anode material.
Structural and electrochemical studies of PPy/PEG-LiFePO4 cathode material for Li-ion batteries
International Nuclear Information System (INIS)
Fedorkova, Andrea; Nacher-Alejos, Ana; Gomez-Romero, Pedro; Orinakova, Renata; Kaniansky, Dusan
2010-01-01
A simple chemical oxidative polymerization of pyrrole (Py) directly onto the surface of LiFePO 4 particles was applied to the synthesis of polypyrrole-LiFePO 4 (PPy-LiFePO 4 ) powder. The LiFePO 4 sample without carbon coating was synthesized by a solvothermal method. The polyethylene glycol (PEG) was used as additive during Py polymerization for increasing the PPy-LiFePO 4 conductivity. Properties of resulting LiFePO 4 , PPy-LiFePO 4 and PPy/PEG-LiFePO 4 samples were characterized by XRD, SEM, TGA and galvanostatic charge-discharge measurements. These methods confirmed the presence of polypyrrole on LiFePO 4 particles and its homogeneous distribution in the resulting powder material. The PPy/PEG-LiFePO 4 composites show higher discharge capacity than pure LiFePO 4 , as PPy/PEG network improves the electron conductivity. It presents specific discharge capacity of 153 mAh/g at C/5 rate.
Residual salt separation from simulated spent nuclear fuel reduced in a LiCl-Li2O salt
International Nuclear Information System (INIS)
Hur, Jin-Mok; Hong, Sun-Seok; Seo, Chung-Seok
2006-01-01
The electrochemical reduction of spent nuclear fuel in LiCl-Li 2 O molten salt for the conditioning of spent nuclear fuel requires the separation of the residual salts from a reduced metal product after the reduction process. Considering the behavior of spent nuclear fuel during the electrochemical reduction process, a surrogate material matrix was constructed and inactive tests on a salt separation were carried out to produce the data required for active tests. Fresh uranium metal prepared from the electrochemical reduction of U 3 O 8 powder was used as the surrogates of the spent nuclear fuel Atomic Energy Society of Japan, Tokyo, Japan, All rights reservedopyriprocess. LiCl, Li 2 O, Y 2 O 3 and SrCl 2 were selected as the components of the residual salts. Interactions between the salts and their influence on the separation of the residual salts were analyzed by differential scanning calorimetry (DSC) and thermogravimetry (TG). Eutectic melting of LiCl-Li 2 O and LiCl-SrCl 2 led to a melting point which was lower than that of the LiCl molten salt was observed. Residual salts were separated by a vaporization method. Co-vaporization of LiCl-Li 2 O and LiCl-SrCl 2 was achieved below the temperatures which could make the uranium metal oxidation by Li 2 O possible. The salt vaporization rates at 950degC were measured as follows: LiCl-8 wt% Li 2 O>LiCl>LiCl-8 wt% SrCl 2 >SrCl 2 . (author)
Residual Salt Separation from the Metal Products Reduced in a LiCl-Li2O Molten Salt
International Nuclear Information System (INIS)
Hur, Jin Mok; Hong, Sun Seok; Kang, Dae Seung; Jeong, Meong Soo; Seo, Chung Seok
2006-02-01
The electrochemical reduction of spent nuclear fuel in a LiCl-Li 2 O molten salt for the conditioning of spent nuclear fuel requires the separation of the residual salts from a reduced metal product after the reduction process. Considering the behavior of spent nuclear fuel during the electrochemical reduction process, a surrogate material matrix was constructed and inactive tests on a salt separation were carried out to produce the data required for the active tests. Fresh uranium metal prepared from the electrochemical reduction of U 3 O 8 powder was used as the surrogates of the spent nuclear fuel components which might be metallized by the electrochemical reduction process. LiCl, Li 2 O, Y 2 O 3 and SrCl 2 were selected as the components of the residual salts. Interactions between the salts and their influence on the separation of the residual salts were analyzed by differential scanning calorimetry (DSC) and thermogravimetry (TG). Eutectic melting of LiCl-Li 2 O and LiCl-SrCl 2 led to a melting point which was lower than that of a LiCl molten salt was observed. Residual salts were separated by a vaporization method. Co-vaporization of LiCl-Li 2 O and LiCl-SrCl 2 was achieved below temperatures which could make the uranium metal oxidation by Li 2 O possible. The salt vaporization rates at 950 .deg. C were measured as follows: LiCl-8 wt% Li 2 O > LiCl > LiCl-8 wt% SrCl 2 > SrCl 2
LiCl-LiI molten salt electrolyte with bismuth-lead positive electrode for liquid metal battery
Kim, Junsoo; Shin, Donghyeok; Jung, Youngjae; Hwang, Soo Min; Song, Taeseup; Kim, Youngsik; Paik, Ungyu
2018-02-01
Liquid metal batteries (LMBs) are attractive energy storage device for large-scale energy storage system (ESS) due to the simple cell configuration and their high rate capability. The high operation temperature caused by high melting temperature of both the molten salt electrolyte and metal electrodes can induce the critical issues related to the maintenance cost and degradation of electrochemical properties resulting from the thermal corrosion of materials. Here, we report a new chemistry of LiCl-LiI electrolyte and Bi-Pb positive electrode to lower the operation temperature of Li-based LMBs and achieve the long-term stability. The cell (Li|LiCl-LiI|Bi-Pb) is operated at 410 °C by employing the LiCl-LiI (LiCl:LiI = 36:64 mol %) electrolyte and Bi-Pb alloy (Bi:Pb = 55.5:44.5 mol %) positive electrode. The cell shows excellent capacity retention (86.5%) and high Coulombic efficiencies over 99.3% at a high current density of 52 mA cm-2 during 1000th cycles.
Configuring PSx tetrahedral clusters in Li-excess Li7P3S11 solid electrolyte
Directory of Open Access Journals (Sweden)
Wo Dum Jung
2018-04-01
Full Text Available We demonstrate that the Li-ion conductivity can be improved by adding a certain amount of Li (x = 0.25–0.5 as a charge carrier to the composition of glass-ceramic Li7+xP3S11. Structural analysis clarified that the structural changes caused by the ratio of ortho-thiophosphate tetrahedra PS43− and pyro-thiophosphate ditetrahedra P2S74− affect the Li-ion conductivity. The ratio of PS43− and P2S74− varies depending on x and the highest Li-ion conductivity (2.5 × 10−3 S cm−1 at x = 0.25. All-solid-state LiNi0.8Co0.15Al0.05O2/Li7.25P3S11/In-metal cell exhibits the discharge capacity of 106.2 mAh g−1. This ion conduction enhancement from excess Li is expected to contribute to the future design of sulfide-type electrolytes.
LIBRA-LiTE: A commercial size light ion fusion power plant
International Nuclear Information System (INIS)
Badger, B.; Choi, B.; Engelstad, R.L.; Kulcinski, G.L.; Lovell, E.G.; MacFarlane, J.J.; Mogehed, E.A.; Moses, G.A.; Peterson, R.R.; Rutledge, S.; Sawan, M.E.; Sviatoslavsky, G.; Sviatoslavsky, I.N.; Wittenberg, L.J.
1992-05-01
LIBRA-LiTE is a concept study for future 1000 MWe nuclear fusion reactors operating on the principle of inertial confinement. Light ions, e.g. lithium ions, are given an energy of 25-35 MeV in an accelerator and focused symmetrically onto a target (deuterium-tritium filled sphere of 7 mm diameter) in a reactor chamber. The fusion reaction is ignited by shock wave induced compression of the target. The radiation (photons, neutrons, ions) is absorbed in a blanket where the thermal power is removed by a coolant and tritium is rebred. The LIBRA-LiTE concept study is the continuation of the earlier LIBRA study (330 MWe) with a modified concept of light ion beam focusing. Starting from an ion source (diode), the lithium ion beams are focused ballistically onto the target. For this to be achieved, lithium must be used as the coolant in the reactor chamber and the blanket concept must be slightly modified by providing steel tubes (HT-9) as guiding tubes for the coolant flow. A particular engineering problem to be solved are the ion beam focusing magnets, which have to extend rather closely up to the center of the reactor chamber. (orig.) [de
Li diffusion and the effect of local structure on Li mobility in Li2O-SiO2 glasses.
Bauer, Ute; Welsch, Anna-Maria; Behrens, Harald; Rahn, Johanna; Schmidt, Harald; Horn, Ingo
2013-12-05
Aimed to improve the understanding of lithium migration mechanisms in ion conductors, this study focuses on Li dynamics in binary Li silicate glasses. Isotope exchange experiments and conductivity measurements were carried out to determine self-diffusion coefficients and activation energies for Li migration in Li2Si3O7 and Li2Si6O13 glasses. Samples of identical composition but different isotope content were combined for diffusion experiments in couples or triples. Diffusion profiles developed between 511 and 664 K were analyzed by femtosecond laser ablation combined with multiple collector inductively coupled plasma mass spectrometry (fs LA-MC-ICP-MS) and secondary ion mass spectrometry (SIMS). Analyses of diffusion profiles and comparison of diffusion data reveal that the isotope effect of lithium diffusion in silicate glasses is rather small, consistent with classical diffusion behavior. Ionic conductivity of glasses was measured between 312 and 675 K. The experimentally obtained self-diffusion coefficient, D(IE), and ionic diffusion coefficient, D(σ), derived from specific DC conductivity provided information about correlation effects during Li diffusion. The D(IE)/D(σ) is higher for the trisilicate (0.27 ± 0.05) than that for the hexasilicate (0.17 ± 0.02), implying that increasing silica content reduces the efficiency of Li jumps in terms of long-range movement. This trend can be rationalized by structural concepts based on nuclear magnetic resonance (NMR) and Raman spectroscopy as well as molecular dynamic simulations, that is, lithium is percolating in low-dimensional, alkali-rich regions separated by a silica-rich matrix.
Shock Producers and Shock Absorbers in the Crisis
Sinn, Hans-Werner
2009-01-01
It is not surprising that the U.S. has been by far the world’s largest shock producer in this crisis. The big shock absorbers on the other hand were Japan, Russia and Germany, whose exports shrank more than their imports.
Epitaxial thin film growth of LiH using a liquid-Li atomic template
International Nuclear Information System (INIS)
Oguchi, Hiroyuki; Ikeshoji, Tamio; Orimo, Shin-ichi; Ohsawa, Takeo; Shiraki, Susumu; Hitosugi, Taro; Kuwano, Hiroki
2014-01-01
We report on the synthesis of lithium hydride (LiH) epitaxial thin films through the hydrogenation of a Li melt, forming abrupt LiH/MgO interface. Experimental and first-principles molecular dynamics studies reveal a comprehensive microscopic picture of the crystallization processes, which sheds light on the fundamental atomistic growth processes that have remained unknown in the vapor-liquid-solid method. We found that the periodic structure that formed, because of the liquid-Li atoms at the film/MgO-substrate interface, serves as an atomic template for the epitaxial growth of LiH crystals. In contrast, films grown on the Al 2 O 3 substrates indicated polycrystalline films with a LiAlO 2 secondary phase. These results and the proposed growth process provide insights into the preparation of other alkaline metal hydride thin films on oxides. Further, our investigations open the way to explore fundamental physics and chemistry of metal hydrides including possible phenomena that emerge at the heterointerfaces of metal hydrides
Fabrication of Li-intercalated bilayer graphene
Directory of Open Access Journals (Sweden)
K. Sugawara
2011-06-01
Full Text Available We have succeeded in fabricating Li-intercalated bilayer graphene on silicon carbide. The low-energy electron diffraction from Li-deposited bilayer graphene shows a sharp 3×3R30° pattern in contrast to Li-deposited monolayer graphene. This indicates that Li atoms are intercalated between two adjacent graphene layers and take the same well-ordered superstructure as in bulk C6Li. The angle-resolved photoemission spectroscopy has revealed that Li atoms are fully ionized and the π bands of graphene are systematically folded by the superstructure of intercalated Li atoms, producing a snowflake-like Fermi surface centered at the Γ point. The present result suggests a high potential of Li-intercalated bilayer graphene for application to a nano-scale Li-ion battery.
Shock loading predictions from application of indicial theory to shock-turbulence interactions
Keefe, Laurence R.; Nixon, David
1991-01-01
A sequence of steps that permits prediction of some of the characteristics of the pressure field beneath a fluctuating shock wave from knowledge of the oncoming turbulent boundary layer is presented. The theory first predicts the power spectrum and pdf of the position and velocity of the shock wave, which are then used to obtain the shock frequency distribution, and the pdf of the pressure field, as a function of position within the interaction region. To test the validity of the crucial assumption of linearity, the indicial response of a normal shock is calculated from numerical simulation. This indicial response, after being fit by a simple relaxation model, is used to predict the shock position and velocity spectra, along with the shock passage frequency distribution. The low frequency portion of the shock spectra, where most of the energy is concentrated, is satisfactorily predicted by this method.
Shock Isolation Elements Testing for High Input Loadings. Volume II. Foam Shock Isolation Elements.
SHOCK ABSORBERS ), (*GUIDED MISSILE SILOS, SHOCK ABSORBERS ), (*EXPANDED PLASTICS, (*SHOCK(MECHANICS), REDUCTION), TEST METHODS, SHOCK WAVES, STRAIN(MECHANICS), LOADS(FORCES), MATHEMATICAL MODELS, NUCLEAR EXPLOSIONS, HARDENING.
Ionic debye screening in dense liquid plasmas observed for Li+p, d reactions with liquid Li target
International Nuclear Information System (INIS)
Kasagi, J.; Yonemura, H.; Toriyabe, Y.; Nakagawa, A.; Sugawara, T.; Wang Tieshan
2009-01-01
Thick target yields of α particles emitted in the 6 Li(d,α) 4 He and 7 Li(p,α) 4 He reactions were measured for Li target in the solid and liquid phase. Observed reaction rates for the liquid Li are always larger than those for the solid. This suggests that the stopping power of hydrogen ion in the liquid Li metal might be smaller than in the solid. Using the empirically obtained stopping power for the liquid Li, we have deduced the screening potentials of the Li+p and Li+d reactions in both phases. The deduced screening potential for the liquid Li is about 500 eV larger than for the solid. This difference is attributed to the effect of liquefied Li + ions. It is concluded that the ionic screening is much stronger than the electronic screening in a low-temperature dense plasmas. (authors)
Ionic Debye Screening in Dense Liquid Plasmas Observed for Li+p,d Reactions with Liquid Li Target
Institute of Scientific and Technical Information of China (English)
J.Kasagi; H.Yonemura; Y.Toriyabe; A.Nakagawa; T.Sugawara; WANG Tie-shan
2009-01-01
Thick target yields of a particles emitted in the ~6Li(d,a)~4 He and ~7Li(p,a)~4 He reactions were measured for Li target in the solid and liquid phase.Observed reaction rates for the liquid Li are always larger than those for the solid.This suggests that the stopping power of hydrogen ion in the liquid Li metal might be smaller than in the solid.Using the empirically obtained stopping power for the liquid Li,we have deduced the screening potentials of the Li+p and Li+d reactions in both phases.The deduced screening potential for the liquid Li is about 500 eV larger than for the solid.This difference is attributed to the effect of liquefied Li~+ ions.It is concluded that the ionic screening is much stronger than the electronic screening in a low-temperature dense plasmas.
Gravitational shock waves and extreme magnetomaterial shock waves
International Nuclear Information System (INIS)
Lichnerowicz, Andre.
1975-01-01
Within an astrophysical context corresponding to high densities, a self-gravitating model is studied, which is the set of an extreme material medium of infinite conductivity and of a magnetic field. Corresponding shock waves generate necessarily, in general, gravitational shock waves [fr
Investigation of the $^{8}$Li($^{2}$H,p)$^{9}$Li Reaction at REX-ISOLDE
2002-01-01
We propose to investigate the $^{8}$Li($^{2}$H,p )$^{9}$Li reaction at REX-ISOLDE. The main aim is to test a recently found discrepancy in extracted spectroscopic factors for this reaction. As a byproduct we will obtain improved data relevant for predictions of the $^{8}$Li(n,$\\gamma$)$^{9}$Li rate in inhomogeneous nucleosynthesis. For the full experiment including beam tuning and background measurements we ask for 13 shifts.
A Study of Styrene-Butadiene Rubber Blends as Improved Flame Agents
1976-06-01
results of air gun tests. Thus, both elasticity and viscosity must be considered when DD I JAN 7 1473 EDITION OF I NOV 63 IS OBSOLETE UNCLASSIFIED sECURITy...L.EGEND!~ 23.9’ C 0~ 1:? 100 >.80 I.. 20 ini Sha at)sc Fiue2. Prcn eoyof2-ecnSR4/0a Vaiu aisa 38 227 I LI I : hi Ilii Al 01 100 130 6n0 40- Shear Rate
Relaxation-Induced Memory Effect of LiFePO4 Electrodes in Li-Ion Batteries.
Jia, Jianfeng; Tan, Chuhao; Liu, Mengchuang; Li, De; Chen, Yong
2017-07-26
In Li-ion batteries, memory effect has been found in several commercial two-phase materials as a voltage bump and a step in the (dis)charging plateau, which delays the two-phase transition and influences the estimation of the state of charge. Although memory effect has been first discovered in olivine LiFePO 4 , the origination and dependence are still not clear and are critical for regulating the memory effect of LiFePO 4 . Herein, LiFePO 4 has been synthesized by a home-built spray drying instrument, of which the memory effect has been investigated in Li-ion batteries. For as-synthesized LiFePO 4 , the memory effect is significantly dependent on the relaxation time after phase transition. Besides, the voltage bump of memory effect is actually a delayed voltage overshooting that is overlaid at the edge of stepped (dis)charging plateau. Furthermore, we studied the kinetics of LiFePO 4 electrode with electrochemical impedance spectroscopy (EIS), which shows that the memory effect is related to the electrochemical kinetics. Thereby, the underlying mechanism has been revealed in memory effect, which would guide us to optimize two-phase electrode materials and improve Li-ion battery management systems.
Preparation and Characterisation of LiFePO4/CNT Material for Li-Ion Batteries
Directory of Open Access Journals (Sweden)
Rushanah Mohamed
2011-01-01
Full Text Available Li-ion battery cathode materials were synthesised via a mechanical activation and thermal treatment process and systematically studied. LiFePO4/CNT composite cathode materials were successfully prepared from LiFePO4 material. The synthesis technique involved growth of carbon nanotubes onto the LiFePO4 using a novel spray pyrolysis-modified CVD technique. The technique yielded LiFePO4/CNT composite cathode material displaying good electrochemical activity. The composite cathode exhibited excellent electrochemical performances with 163 mAh/g discharge capacity with 94% cycle efficiency at a 0.1 C discharge rate in the first cycle, with a capacity fade of approximately 10% after 30 cycles. The results indicate that carbon nanotube addition can enable LiFePO4 to display a higher discharge capacity at a fast rate with high efficiency. The research is of potential interest for the application of carbon nanotubes as a new conducting additive in cathode preparation and for the development of high-power Li-ion batteries for hybrid electric vehicles.
Solid state opto-impedance of LiNiVO4 and LiMn2O4
International Nuclear Information System (INIS)
Kalyani, P; Sivasubramanian, S; Prabhu, S Naveen; Ragavendran, K; Kalaiselvi, N; Ranganathan, N G; Madhu, S; SundaraRaj, A; Manoharan, S P; Jagannathan, R
2005-01-01
Spinel type LiMn 2 O 4 and inverse spinel LiNiVO 4 systems serve as standard cathode materials or potential cathode systems for application in high energy density lithium-ion batteries. Upon photo-excitation using UV radiation of energy ∼5 eV, the LiNiVO 4 system shows significant modification in the solid state impedance pattern while the LiMn 2 O 4 system does not. This study has revealed a significant difference in the opto-impedance pattern for LiNiVO 4 with respect to LiMn 2 O 4 , which may be due to the different electronic processes involved. An attempt has been made to study this behaviour from the solid-state viewpoint
Quasilinear simulations of interplanetary shocks and Earth's bow shock
Afanasiev, Alexandr; Battarbee, Markus; Ganse, Urs; Vainio, Rami; Palmroth, Minna; Pfau-Kempf, Yann; Hoilijoki, Sanni; von Alfthan, Sebastian
2016-04-01
We have developed a new self-consistent Monte Carlo simulation model for particle acceleration in shocks. The model includes a prescribed large-scale magnetic field and plasma density, temperature and velocity profiles and a self-consistently computed incompressible ULF foreshock under the quasilinear approximation. Unlike previous analytical treatments, our model is time dependent and takes full account of the anisotropic particle distributions and scattering in the wave-particle interaction process. We apply the model to the problem of particle acceleration at traveling interplanetary (IP) shocks and Earth's bow shock and compare the results with hybrid-Vlasov simulations and spacecraft observations. A qualitative agreement in terms of spectral shape of the magnetic fluctuations and the polarization of the unstable mode is found between the models and the observations. We will quantify the differences of the models and explore the region of validity of the quasilinear approach in terms of shock parameters. We will also compare the modeled IP shocks and the bow shock, identifying the similarities and differences in the spectrum of accelerated particles and waves in these scenarios. The work has received funding from the European Union's Horizon 2020 research and innovation programme under grant agreement No 637324 (HESPERIA). The Academy of Finland is thanked for financial support. We acknowledge the computational resources provided by CSC - IT Centre for Science Ltd., Espoo.
Olsen, K M; Sutherland, B L; Small, L L
2007-10-01
White clover (Trifolium repens) is naturally polymorphic for cyanogenesis (hydrogen cyanide release following tissue damage). The ecological factors favouring cyanogenic and acyanogenic plants have been examined in numerous studies over the last half century, making this one of the best-documented examples of an adaptive polymorphism in plants. White clover cyanogenesis is controlled by two, independently segregating Mendelian genes: Ac/ac controls the presence/absence of cyanogenic glucosides; and Li/li controls the presence/absence of their hydrolysing enzyme, linamarase. In this study, we examine the molecular evolution and population genetics of Li as it relates to the cyanogenesis polymorphism. We report here that Li exists as a single-copy gene in plants possessing linamarase activity, and that the absence of enzyme activity in li/li plants is correlated with the absence of much or all of the gene from the white clover genome. Consistent with this finding, we confirm by reverse transcription-polymerase chain reaction that Li gene expression is absent in plants lacking enzyme activity. In a molecular population genetic analysis of Li and three unlinked genes using a worldwide sample of clover plants, we find an absence of nucleotide variation and statistically significant deviations from neutrality at Li; these findings are consistent with recent positive directional selection at this cyanogenesis locus.
Betsofen, S. Ya.; Antipov, V. V.; Knyazev, M. I.
2016-04-01
The results of studying the phase transformations, the texture formation, and the anisotropy of the mechanical properties in Al-Cu-Li and Al-Mg-Li alloys are generalized. A technique and equations are developed to calculate the amounts of the S1 (Al2MgLi), T1 (Al2CuLi), and δ' (Al3Li) phases. The fraction of the δ' phase in Al-Cu-Li alloys is shown to be significantly higher than in Al-Mg-Li alloys. Therefore, the role of the T1 phase in the hardening of Al-Cu-Li alloys is thought to be overestimated, especially in alloys with more than 1.5% Li. A new model is proposed to describe the hardening of Al-Cu-Li alloys upon aging, and the results obtained with this model agree well with the experimental data. A texture, which is analogous to that in aluminum alloys, is shown to form in sheets semiproducts made of Al-Cu-Li and Al-Mg-Li alloys. The more pronounced anisotropy of the properties of lithium-containing aluminum alloys is caused by a significant fraction of the ordered coherent δ' phase, the deformation mechanism in which differs radically from that in the solid solution.
Directory of Open Access Journals (Sweden)
Meng Qin
2017-06-01
Full Text Available This work reports on the synthesis of rare earth-doped Li4Ti5O12 nanosheets with high electrochemical performance as anode material both in Li half and Li4Ti5O12/LiFePO4 full cell batteries. Through the combination of decreasing the particle size and doping by rare earth atoms (Ce and La, Ce and La doped Li4Ti5O12 nanosheets show the excellent electrochemical performance in terms of high specific capacity, good cycling stability and excellent rate performance in half cells. Notably, the Ce-doped Li4Ti5O12 shows good electrochemical performance as anode in a full cell which LiFePO4 was used as cathode. The superior electrochemical performance can be attributed to doping as well as the nanosized particle, which facilitates transportation of the lithium ion and electron transportation. This research shows that the rare earth doped Li4Ti5O12 nanosheets can be suitable as a high rate performance anode material in lithium-ion batteries.
Qin, Meng; Li, Yueming; Lv, Xiao-Jun
2017-01-01
This work reports on the synthesis of rare earth-doped Li4Ti5O12 nanosheets with high electrochemical performance as anode material both in Li half and Li4Ti5O12/LiFePO4 full cell batteries. Through the combination of decreasing the particle size and doping by rare earth atoms (Ce and La), Ce and La doped Li4Ti5O12 nanosheets show the excellent electrochemical performance in terms of high specific capacity, good cycling stability and excellent rate performance in half cells. Notably, the Ce-doped Li4Ti5O12 shows good electrochemical performance as anode in a full cell which LiFePO4 was used as cathode. The superior electrochemical performance can be attributed to doping as well as the nanosized particle, which facilitates transportation of the lithium ion and electron transportation. This research shows that the rare earth doped Li4Ti5O12 nanosheets can be suitable as a high rate performance anode material in lithium-ion batteries. PMID:28632167
Synthesis, Structure, and Li-Ion Conductivity of LiLa(BH4)3X, X = Cl, Br, I
DEFF Research Database (Denmark)
Payandeh GharibDoust, SeyedHosein; Brighi, Matteo; Sadikin, Yolanda
2017-01-01
In this work, a new type of addition reaction between La(BH4)3 and LiX, X = Cl, Br, I, is used to synthesize LiLa(BH4)3Cl and two new compounds LiLa(BH4)3X, X = Br, I. This method increases the amounts of LiLa(BH4)3X and the sample purity. The highest Li-ion conductivity is observed for LiLa(BH4)...
Russell, C. T.; Mellott, M. M.; Smith, E. J.; King, J. H.
1983-01-01
ISEE 1, 2, 3, IMP 8, and Prognoz 7 observations of interplanetary shocks in 1978 and 1979 provide five instances where a single shock is observed by four spacecraft. These observations are used to determine best-fit normals for these five shocks. In addition to providing well-documented shocks for future investigations these data allow the evaluation of the accuracy of several shock normal determination techniques. When the angle between upstream and downstream magnetic field is greater than 20 deg, magnetic coplanarity can be an accurate single spacecraft method. However, no technique based solely on the magnetic measurements at one or multiple sites was universally accurate. Thus, the use of overdetermined shock normal solutions, utilizing plasma measurements, separation vectors, and time delays together with magnetic constraints, is recommended whenever possible.
Electrochemical studies on electrospun Li(Li1/3Ti5/3)O4 grains as an anode for Li-ion batteries
International Nuclear Information System (INIS)
Wu Yongzhi; Reddy, M.V.; Chowdari, B.V.R.; Ramakrishna, S.
2012-01-01
Highlights: ► We report (Li(Li 1/3 Ti 5/3 )O 4 ) (LTO) obtained via electrospinning and followed by heat treatment. ► Electrochemical studies on nano-LTO showed a reversible capacity of 165(±3) mAh g −1 and 78(±3) mAh g −1 at a current rate of 0.2 C and 10 C, respectively. ► Electrode kinetics studies of LTO were carried out the end of 380 cycle using GITT and EIS techniques. - Abstract: Li(Li 1/3 Ti 5/3 )O 4 or (Li 4 Ti 5 O 12 ) (LTO) grains are prepared via electrospinning a solution containing lithium acetate, titanium tetra(IV)-isopropoxide, polyvinyl acetate and acetic acid in N,N-dimethyl-formamide, followed by a subsequent sintering process. The structures and morphology were characterized by X-ray diffraction, scanning and transmission microscopy. Coin-type cells were assembled to test the electrochemical performance was evaluated using galvanostatic cycling at room temperature, in the cycling range, 1.0–2.8 V. The Li-cycling results showed characteristic discharge-charge plateaus at 1.55 and 1.8 V vs. Li/Li + , respectively. Electrospun LTO showed a reversible capacity of 165(±3) mAh g −1 at the end of 10th cycle at a current rate of 0.2 C. The later studies on rate capacities and cycling performance of LTO grains demonstrate good rate performance and long term cycling stability. Galvanostatic Intermittent Titration Technique (GITT) and Electrochemical Impedance Spectroscopy (EIS) studied were carried out at end of 381st and 382nd cycle to understand the electrode kinetics.
2013 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Nooksack
National Oceanic and Atmospheric Administration, Department of Commerce — In July 2012, WSI (Watershed Sciences, Inc.) was contracted by the Puget Sound LiDARConsortium (PSLC) to collect Light Detection and Ranging (LiDAR) data on a...
2013 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Entiat
National Oceanic and Atmospheric Administration, Department of Commerce — In October 2012, WSI (Watershed Sciences, Inc.) was contracted by the Puget Sound LiDARConsortium (PSLC) to collect Light Detection and Ranging (LiDAR) data for the...
Directory of Open Access Journals (Sweden)
Natasha Ross
2015-01-01
Full Text Available Au with Pd nanoparticles were synthesized and coated onto the spinel LiMn2O4 via a coprecipitation calcination method with the objective to improve the microstructure, conductivity, and electrochemical activities of pristine LiMn2O4. The novel LiPdAuxMn2-xO4 composite cathode had high phase purity, well crystallized particles, and more regular morphological structures with narrow size distributions. At enlarged cycling potential ranges the LiPdAuxMn2-xO4 sample delivered 90 mAh g−1 discharge capacity compared to LiMn2O4 (45 mAh g−1. It was concluded that even a small amount of the Pd and Au enhanced both the lithium diffusivity and electrochemical conductivity of the host sample due to the beneficial properties of their synergy.
Epitaxial thin film growth of LiH using a liquid-Li atomic template
Energy Technology Data Exchange (ETDEWEB)
Oguchi, Hiroyuki, E-mail: oguchi@nanosys.mech.tohoku.ac.jp [Department of Nanomechanics, Tohoku University, Sendai 980-8579 (Japan); Micro System Integration Center (muSIC), Tohoku University, Sendai 980-0845 (Japan); Ikeshoji, Tamio; Orimo, Shin-ichi [Institute for Materials Research, Tohoku University, Sendai 980-8577 (Japan); Advanced Institute for Materials Research (AIMR), Tohoku University, Sendai 980-8577 (Japan); Ohsawa, Takeo; Shiraki, Susumu; Hitosugi, Taro [Advanced Institute for Materials Research (AIMR), Tohoku University, Sendai 980-8577 (Japan); Kuwano, Hiroki [Department of Nanomechanics, Tohoku University, Sendai 980-8579 (Japan)
2014-11-24
We report on the synthesis of lithium hydride (LiH) epitaxial thin films through the hydrogenation of a Li melt, forming abrupt LiH/MgO interface. Experimental and first-principles molecular dynamics studies reveal a comprehensive microscopic picture of the crystallization processes, which sheds light on the fundamental atomistic growth processes that have remained unknown in the vapor-liquid-solid method. We found that the periodic structure that formed, because of the liquid-Li atoms at the film/MgO-substrate interface, serves as an atomic template for the epitaxial growth of LiH crystals. In contrast, films grown on the Al{sub 2}O{sub 3} substrates indicated polycrystalline films with a LiAlO{sub 2} secondary phase. These results and the proposed growth process provide insights into the preparation of other alkaline metal hydride thin films on oxides. Further, our investigations open the way to explore fundamental physics and chemistry of metal hydrides including possible phenomena that emerge at the heterointerfaces of metal hydrides.
Are Credit Shocks Supply or Demand Shocks?
Bijapur, Mohan
2013-01-01
This paper provides new insights into the relationship between the supply of credit and the macroeconomy. We present evidence that credit shocks constitute shocks to aggregate supply in that they have a permanent effect on output and cause inflation to rise in the short term. Our results also suggest that the effects on aggregate supply have grown stronger in recent decades.
Miniature shock tube for laser driven shocks.
Busquet, Michel; Barroso, Patrice; Melse, Thierry; Bauduin, Daniel
2010-02-01
We describe in this paper the design of a miniature shock tube (smaller than 1 cm(3)) that can be placed in a vacuum vessel and allows transverse optical probing and longitudinal backside extreme ultraviolet emission spectroscopy in the 100-500 A range. Typical application is the study of laser launched radiative shocks, in the framework of what is called "laboratory astrophysics."
Liu, Qi; He, Hao; Li, Zhe-Fei; Liu, Yadong; Ren, Yang; Lu, Wenquan; Lu, Jun; Stach, Eric A; Xie, Jian
2014-03-12
We have performed operando synchrotron high-energy X-ray diffraction (XRD) to obtain nonintrusive, real-time monitoring of the dynamic chemical and structural changes in commercial 18650 LiFePO4/C cells under realistic cycling conditions. The results indicate a nonequilibrium lithium insertion and extraction in the LiFePO4 cathode, with neither the LiFePO4 phase nor the FePO4 phase maintaining a static composition during lithium insertion/extraction. On the basis of our observations, we propose that the LiFePO4 cathode simultaneously experiences both a two-phase reaction mechanism and a dual-phase solid-solution reaction mechanism over the entire range of the flat voltage plateau, with this dual-phase solid-solution behavior being strongly dependent on charge/discharge rates. The proposed dual-phase solid-solution mechanism may explain the remarkable rate capability of LiFePO4 in commercial cells.
Energy Technology Data Exchange (ETDEWEB)
Chien-Chih Liu, James [Univ. of California, Berkeley, CA (United States)
1993-01-01
The work presented here investigates the phenomenon of shock wave propagation in gas continuous, two-phase media. The motivation for this work stems from the need to understand blast venting consequences in the HYLIFE inertial confinement fusion (ICF) reactor. The HYLIFE concept utilizes lasers or heavy ion beams to rapidly heat and compress D-T targets injected into the center of a reactor chamber. A segmented blanket of falling molten lithium or Li2BeF4 (Flibe) jets encircles the reactor`s central cavity, shielding the reactor structure from radiation damage, absorbing the fusion energy, and breeding more tritium fuel. X-rays from the fusion microexplosion will ablate a thin layer of blanket material from the surfaces which face toward the fusion site. This generates a highly energetic vapor, which mostly coalesces in the central cavity. The blast expansion from the central cavity generates a shock which propagates through the segmented blanket - a complex geometry, gas-continuous two-phase medium. The impulse that the blast gives to the liquid as it vents past, the gas shock on the chamber wall, and ultimately the liquid impact on the wall are all important quantities to the HYLIFE structural designers.
Radiation- and pair-loaded shocks
Lyutikov, Maxim
2018-06-01
We consider the structure of mildly relativistic shocks in dense media, taking into account the radiation and pair loading, and diffusive radiation energy transfer within the flow. For increasing shock velocity (increasing post-shock temperature), the first important effect is the efficient energy redistribution by radiation within the shock that leads to the appearance of an isothermal jump, whereby the flow reaches the final state through a discontinuous isothermal transition. The isothermal jump, on scales much smaller than the photon diffusion length, consists of a weak shock and a quick relaxation to the isothermal conditions. Highly radiation-dominated shocks do not form isothermal jump. Pair production can mildly increase the overall shock compression ratio to ≈10 (4 for matter-dominated shocks and 7 of the radiation-dominated shocks).
INTERFERENCE OF UNIDIRECTIONAL SHOCK WAVES
Directory of Open Access Journals (Sweden)
P. V. Bulat
2015-05-01
Full Text Available Subject of study.We consider interference of unidirectional shock waves or, as they are called, catching up shock waves. The scope of work is to give a classification of the shock-wave structures that arise in this type of interaction of shock waves, and the area of their existence. Intersection of unidirectional shock waves results in arising of a shock-wave structure at the intersection point, which contains the main shock wave, tangential discontinuity and one more reflected gas-dynamic discontinuity of unknown beforehand type. The problem of determining the type of reflected discontinuity is the main problem that one has to solve in the study of catching shock waves interference. Main results.The paper presents the pictures of shock-wave structures arising at the interaction of catching up shock waves. The areas with a regular and irregular unidirectional interaction of shocks are described. Characteristic shock-wave structures are of greatest interest, where reflected gas-dynamic discontinuity degenerates into discontinuous characteristics. Such structures have a number of extreme properties. We have found the areas of existence for such shock-wave structures. There are also areas in which the steady-state solution is not available. The latter has determined revival of interest for the theoretical study of the problem, because the facts of sudden shock-wave structure destruction inside the air intake of supersonic aircrafts at high Mach numbers have been discovered. Practical significance.The theory of interference for unidirectional shock waves and design procedure are usable in the design of supersonic air intakes. It is also relevant for application possibility investigation of catching up oblique shock waves to create overcompressed detonation in perspective detonation air-jet and rocket engines.
Shock/shock interactions between bodies and wings
Directory of Open Access Journals (Sweden)
Gaoxiang XIANG
2018-02-01
Full Text Available This paper examines the Shock/Shock Interactions (SSI between the body and wing of aircraft in supersonic flows. The body is simplified to a flat wedge and the wing is assumed to be a sharp wing. The theoretical spatial dimension reduction method, which transforms the 3D problem into a 2D one, is used to analyze the SSI between the body and wing. The temperature and pressure behind the Mach stem induced by the wing and body are obtained, and the wave configurations in the corner are determined. Numerical validations are conducted by solving the inviscid Euler equations in 3D with a Non-oscillatory and Non-free-parameters Dissipative (NND finite difference scheme. Good agreements between the theoretical and numerical results are obtained. Additionally, the effects of the wedge angle and sweep angle on wave configurations and flow field are considered numerically and theoretically. The influences of wedge angle are significant, whereas the effects of sweep angle on wave configurations are negligible. This paper provides useful information for the design and thermal protection of aircraft in supersonic and hypersonic flows. Keywords: Body and wing, Flow field, Hypersonic flow, Shock/shock interaction, Wave configurations
A Li-Garnet composite ceramic electrolyte and its solid-state Li-S battery
Huang, Xiao; Liu, Cai; Lu, Yang; Xiu, Tongping; Jin, Jun; Badding, Michael E.; Wen, Zhaoyin
2018-04-01
A high strength Li-Garnet solid electrolyte composite ceramic is successfully prepared via conventional solid state method with Li6.4La3Zr1.4Ta0.6O12 and nano MgO powders. Well sintered ceramic pellets and bars are obtained with 0-9 wt.% MgO. Fracture strength is approximately 135 MPa for composite ceramics with 5-9 wt.% MgO, which is ∼50% higher than that of pure Li6.4La3Zr1.4Ta0.6O12 (90 MPa). Lithium-ion conductivity of the composite is above 5 × 10-4 S cm-1 at room temperature; comparable to the pure Li6.4La3Zr1.4Ta0.6O12 material. SEM cross-sections of the composite ceramic shows a much more uniform microstructure comparing with pure ones, owing to the grain growth inhibition effect of the MgO second phase. A battery cell consisting of Li/composite ceramics/Sulfur-Carbon at 25 °C exhibits a capacity of 685 mAh g-1 at 0.2 C at the 200th cycle, while maintaining a coulombic efficiency of 100%. These results indicate that the composite ceramic Li6.4La3Zr1.4Ta0.6O12-MgO is promising for the production of electrolyte membrane and fabrication of Li-Sulfur batteries.
STEREO interplanetary shocks and foreshocks
Energy Technology Data Exchange (ETDEWEB)
Blanco-Cano, X. [Instituto de Geofisica, UNAM, CU, Coyoacan 04510 DF (Mexico); Kajdic, P. [IRAP-University of Toulouse, CNRS, Toulouse (France); Aguilar-Rodriguez, E. [Instituto de Geofisica, UNAM, Morelia (Mexico); Russell, C. T. [ESS and IGPP, University of California, Los Angeles, 603 Charles Young Drive, Los Angeles, CA 90095 (United States); Jian, L. K. [NASA Goddard Space Flight Center, Greenbelt, MD and University of Maryland, College Park, MD (United States); Luhmann, J. G. [SSL, University of California Berkeley (United States)
2013-06-13
We use STEREO data to study shocks driven by stream interactions and the waves associated with them. During the years of the extended solar minimum 2007-2010, stream interaction shocks have Mach numbers between 1.1-3.8 and {theta}{sub Bn}{approx}20-86 Degree-Sign . We find a variety of waves, including whistlers and low frequency fluctuations. Upstream whistler waves may be generated at the shock and upstream ultra low frequency (ULF) waves can be driven locally by ion instabilities. The downstream wave spectra can be formed by both, locally generated perturbations, and shock transmitted waves. We find that many quasiperpendicular shocks can be accompanied by ULF wave and ion foreshocks, which is in contrast to Earth's bow shock. Fluctuations downstream of quasi-parallel shocks tend to have larger amplitudes than waves downstream of quasi-perpendicular shocks. Proton foreshocks of shocks driven by stream interactions have extensions dr {<=}0.05 AU. This is smaller than foreshock extensions for ICME driven shocks. The difference in foreshock extensions is related to the fact that ICME driven shocks are formed closer to the Sun and therefore begin to accelerate particles very early in their existence, while stream interaction shocks form at {approx}1 AU and have been producing suprathermal particles for a shorter time.
STEREO interplanetary shocks and foreshocks
International Nuclear Information System (INIS)
Blanco-Cano, X.; Kajdič, P.; Aguilar-Rodríguez, E.; Russell, C. T.; Jian, L. K.; Luhmann, J. G.
2013-01-01
We use STEREO data to study shocks driven by stream interactions and the waves associated with them. During the years of the extended solar minimum 2007-2010, stream interaction shocks have Mach numbers between 1.1-3.8 and θ Bn ∼20-86°. We find a variety of waves, including whistlers and low frequency fluctuations. Upstream whistler waves may be generated at the shock and upstream ultra low frequency (ULF) waves can be driven locally by ion instabilities. The downstream wave spectra can be formed by both, locally generated perturbations, and shock transmitted waves. We find that many quasiperpendicular shocks can be accompanied by ULF wave and ion foreshocks, which is in contrast to Earth's bow shock. Fluctuations downstream of quasi-parallel shocks tend to have larger amplitudes than waves downstream of quasi-perpendicular shocks. Proton foreshocks of shocks driven by stream interactions have extensions dr ≤0.05 AU. This is smaller than foreshock extensions for ICME driven shocks. The difference in foreshock extensions is related to the fact that ICME driven shocks are formed closer to the Sun and therefore begin to accelerate particles very early in their existence, while stream interaction shocks form at ∼1 AU and have been producing suprathermal particles for a shorter time.
Residual Salt Separation from the Metal Products Reduced in a LiCl-Li{sub 2}O Molten Salt
Energy Technology Data Exchange (ETDEWEB)
Hur, Jin Mok; Hong, Sun Seok; Kang, Dae Seung; Jeong, Meong Soo; Seo, Chung Seok
2006-02-15
The electrochemical reduction of spent nuclear fuel in a LiCl-Li{sub 2}O molten salt for the conditioning of spent nuclear fuel requires the separation of the residual salts from a reduced metal product after the reduction process. Considering the behavior of spent nuclear fuel during the electrochemical reduction process, a surrogate material matrix was constructed and inactive tests on a salt separation were carried out to produce the data required for the active tests. Fresh uranium metal prepared from the electrochemical reduction of U{sub 3}O{sub 8} powder was used as the surrogates of the spent nuclear fuel components which might be metallized by the electrochemical reduction process. LiCl, Li{sub 2}O, Y{sub 2}O{sub 3} and SrCl{sub 2} were selected as the components of the residual salts. Interactions between the salts and their influence on the separation of the residual salts were analyzed by differential scanning calorimetry (DSC) and thermogravimetry (TG). Eutectic melting of LiCl-Li{sub 2}O and LiCl-SrCl{sub 2} led to a melting point which was lower than that of a LiCl molten salt was observed. Residual salts were separated by a vaporization method. Co-vaporization of LiCl-Li{sub 2}O and LiCl-SrCl{sub 2} was achieved below temperatures which could make the uranium metal oxidation by Li{sub 2}O possible. The salt vaporization rates at 950 .deg. C were measured as follows: LiCl-8 wt% Li{sub 2}O > LiCl > LiCl-8 wt% SrCl{sub 2} > SrCl{sub 2}.
International Nuclear Information System (INIS)
Liu, J. Chien-Chih
1993-01-01
The work presented here investigates the phenomenon of shock wave propagation in gas continuous, two-phase media. The motivation for this work stems from the need to understand blast venting consequences in the HYLIFE inertial confinement fusion (ICF) reactor. The HYLIFE concept utilizes lasers or heavy ion beams to rapidly heat and compress D-T targets injected into the center of a reactor chamber. A segmented blanket of failing molten lithium or Li 2 BeF 4 (Flibe) jets encircles the reactors central cavity, shielding the reactor structure from radiation damage, absorbing the fusion energy, and breeding more tritium fuel
International Nuclear Information System (INIS)
Sagdeev, R.Z.; Kennel, C.F.
1991-01-01
Collisionless shocks cannot occur naturally on the earth, because nearly all matter here consists of electrically neutral atoms and molecules. In space, however, high temperatures and ultraviolet radiation from hot stars decompose atoms into their constituent nuclei and electrons, producing a soup of electrically charged particles known as a plasma. Plasma physicists proposed that the collective electrical and magnetic properties of plasmas could produce interactions that take the place of collisions and permit shocks to form. In 1964 the theoretical work found its first experimental confirmation. Norman F. Ness and his colleagues at the Goddard Space Flight Center, using data collected from the iMP-1 spacecraft, detected clear signs that a collisionless shock exists where the solar wind encounters the earth's magnetic field. More recent research has demonstrated that collisionless shocks appear in a dazzling array of astronomical settings. For example, shocks have been found in the solar wind upstream (sunward) of all the planet and comets that have been visited by spacecraft. Violent flares on the sun generate shocks that propagate to the far reaches of the solar system; tremendous galactic outbursts create disruptions in the intergalactic medium that are trillions of times larger. In addition, many astrophysicists think that shocks from supernova explosions in our galaxy accelerate cosmic rays, a class of extraordinarily energetic elementary particles and atomic nuclei that rain down on the earth from all directions
Design and operation of thermal-convection loops for corrosion measurements in LiF--LiCl--LiBr
International Nuclear Information System (INIS)
Keiser, J.R.; DeVan, J.H.
1979-01-01
Using a most sophisticated design of a thermal-convection loop to study the corrosion behavior of type 316 stainless steel and the salt mixture LiF--LiCl--LiBr is reported. The corrosion rate is being determined as a function of time and temperature through weight change measurements. The maximum corrosion rate measured is about 20 μm/year on removable corrosion specimens. Controlled potential voltammetry has been found to be satisfactory and is being used to monitor the oxidation potential of the salt. Measurements demonstrate the effect on the oxidation potential of impurities introduced during specimen insertion, and techniques should show the effect of a lithium addition on the oxidation potential
Wang, Han; Cao, Hujun; Zhang, Weijin; Chen, Jian; Wu, Hui; Pistidda, Claudio; Ju, Xiaohua; Zhou, Wei; Wu, Guotao; Etter, Martin; Klassen, Thomas; Dornheim, Martin; Chen, Ping
2018-01-26
Complex hydrides have played important roles in energy storage area. Here a complex hydride made of Li 2 NH and LiBH 4 was synthesized, which has a structure tentatively indexed using an orthorhombic cell with a space group of Pna2 1 and lattice parameters of a=10.121, b=6.997, and c=11.457 Å. The Li 2 NH-LiBH 4 sample (in a molar ratio of 1:1) shows excellent hydrogenation kinetics, starting to absorb H 2 at 310 K, which is more than 100 K lower than that of pristine Li 2 NH. Furthermore, the Li + ion conductivity of the Li 2 NH-LiBH 4 sample is about 1.0×10 -5 S cm -1 at room temperature, and is higher than that of either Li 2 NH or LiBH 4 at 373 K. Those unique properties of the Li 2 NH-LiBH 4 complex render it a promising candidate for hydrogen storage and Li ion conduction. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Relativistic Shock Acceleration
International Nuclear Information System (INIS)
Duffy, P.; Downes, T.P.; Gallant, Y.A.; Kirk, J.G.
1999-01-01
In this paper we briefly review the basic theory of shock waves in relativistic hydrodynamics and magneto-hydrodynamics, emphasising some astrophysically interesting cases. We then present an overview of the theory of particle acceleration at such shocks describing the methods used to calculate the spectral indices of energetic particles. Recent results on acceleration at ultra-relativistic shocks are discussed. (author)
Scintillation properties of LiF–SrF{sub 2} and LiF–CaF{sub 2} eutectic
Energy Technology Data Exchange (ETDEWEB)
Yanagida, Takayuki, E-mail: yanagida@lsse.kyutech.ac.jp [Kyushu Institute of Technology, 2-4 Hibikino, Wakamatsu-ku, Kitakyushu 808-0196 (Japan); Kawaguchi, Noriaki [Tokuyama Corporation, 1-1 Mikage-cho, Shunan-shi, Yamaguchi 745-8648 (Japan); Fujimoto, Yutaka [Kyushu Institute of Technology, 2-4 Hibikino, Wakamatsu-ku, Kitakyushu 808-0196 (Japan); Fukuda, Kentaro [Tokuyama Corporation, 1-1 Mikage-cho, Shunan-shi, Yamaguchi 745-8648 (Japan); Watanabe, Kenichi; Yamazaki, Atsushi; Uritani, Akira [Quantum Science and Energy Engineering, Graduate School of Engineering, Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8603 (Japan)
2013-12-15
Dopant free eutectic scintillators {sup 6}LiF–SrF{sub 2} and {sup 6}LiF–CaF{sub 2} were developed by the vertical Bridgeman method for the purpose of thermal neutron detection. The molar ratio of LiF and Ca/SrF{sub 2} was 4:1 on its eutectic composition. The α-ray induced radioluminescence spectra of the scintillators showed intense emission peak at 300 nm due to the emission from the self-trapped exciton in Ca/SrF{sub 2} layers. When the samples were irradiated with {sup 252}Cf neutrons, {sup 6}LiF–SrF{sub 2} and {sup 6}LiF–CaF{sub 2} exhibited the light yields of 4700 and 9400 ph/n, respectively. Scintillation decay times of {sup 6}LiF–SrF{sub 2} and {sup 6}LiF–CaF{sub 2} were accepted for scintillation detectors, 90 and 250 ns, respectively. -- Highlights: • Nondoped LiF–CaF{sub 2} and LiF–SrF{sub 2} eutectic scinitillators are reported for the first time. • Two sample showed self-trapped exciton emission. • LiF–SrF{sub 2} sample exhibited the light yield of 9400 ph/n and this value was comparable to conventional materials doped with rare earth ions. • Scintillation decay times of LiF–CaF{sub 2} and LiF–SrF{sub 2} were 250 and 90 ns, respectively.
Continuous flame aerosol synthesis of carbon-coated nano-LiFePO4 for Li-ion batteries
Waser, Oliver; Büchel, Robert; Hintennach, Andreas; Novák, Petr; Pratsinis, Sotiris E.
2013-01-01
Core-shell, nanosized LiFePO4-carbon particles were made in one step by scalable flame aerosol technology at 7 g/h. Core LiFePO4 particles were made in an enclosed flame spray pyrolysis (FSP) unit and were coated in-situ downstream by auto thermal carbonization (pyrolysis) of swirl-fed C2H2 in an O2-controlled atmosphere. The formation of acetylene carbon black (ACB) shell was investigated as a function of the process fuel-oxidant equivalence ratio (EQR). The core-shell morphology was obtained at slightly fuel-rich conditions (1.0 < EQR < 1.07) whereas segregated ACB and LiFePO4 particles were formed at fuel-lean conditions (0.8 < EQR < 1). Post-annealing of core-shell particles in reducing environment (5 vol% H2 in argon) at 700 °C for up to 4 hours established phase pure, monocrystalline LiFePO4 with a crystal size of 65 nm and 30 wt% ACB content. Uncoated LiFePO4 or segregated LiFePO4-ACB grew to 250 nm at these conditions. Annealing at 800 °C induced carbothermal reduction of LiFePO4 to Fe2P by ACB shell consumption that resulted in cavities between carbon shell and core LiFePO4 and even slight LiFePO4 crystal growth but better electrochemical performance. The present carbon-coated LiFePO4 showed superior cycle stability and higher rate capability than the benchmark, commercially available LiFePO4. PMID:23407817
International Nuclear Information System (INIS)
Wang, Dan; Huang, Yan; Huo, Zhenqing; Chen, Li
2013-01-01
Highlights: • Layered Li[Li 0.2 Ni 0.2−x Mn 0.6−x Mg 2x ]O 2 (2x = 0, 0.01, 0.02, 0.05) were synthetized. • Li[Li 0.2 Ni 0.2−x Mn 0.6−x Mg 2x ]O 2 exhibit enhanced electrochemical properties. • The improved performance is attributed to enhanced structure stability. -- Abstract: Mg-doped Li[Li 0.2 Ni 0.2 Mn 0.6 ]O 2 as a Li-rich cathode material of lithium-ion batteries were prepared by co-precipitation method and ball-milling treatment using Mg(OH) 2 as a dopant. Scanning electron microscopy (SEM), ex situ X-ray powder diffraction (XRD), cyclic voltammetry (CV), electrochemical impedance spectroscopy (EIS) and galvantatic charge/discharge were used to investigate the effect of Mg doping on structure and electrochemical performance. Compared with the bare material, Mg-doped materials exhibit better cycle stabilities and superior rate capabilities. Li[Li 0.2 Ni 0.195 Mn 0.595 Mg 0.01 ]O 2 displays a high reversible capacity of 226.5 mAh g −1 after 60 cycles at 0.1 C. The excellent cycle performance can be attributed to the improvement in structure stability, which is verified by XRD tests before and after 60 cycles. EIS results show that Mg doping decreases the charge-transfer resistance and enhances the reaction kinetics, which is considered to be the major factor for higher rate performance
Chen, Lin; Dilena, Enrico; Paolella, Andrea; Bertoni, Giovanni; Ansaldo, Alberto; Colombo, Massimo; Marras, Sergio; Scrosati, Bruno; Manna, Liberato; Monaco, Simone
2016-02-17
LiMnPO4 is an attractive cathode material for the next-generation high power Li-ion batteries, due to its high theoretical specific capacity (170 mA h g(-1)) and working voltage (4.1 V vs Li(+)/Li). However, two main drawbacks prevent the practical use of LiMnPO4: its low electronic conductivity and the limited lithium diffusion rate, which are responsible for the poor rate capability of the cathode. The electronic resistance is usually lowered by coating the particles with carbon, while the use of nanosize particles can alleviate the issues associated with poor ionic conductivity. It is therefore of primary importance to develop a synthetic route to LiMnPO4 nanocrystals (NCs) with controlled size and coated with a highly conductive carbon layer. We report here an effective surface etching process (using LiPF6) on colloidally synthesized LiMnPO4 NCs that makes the NCs dispersible in the aqueous glucose solution used as carbon source for the carbon coating step. Also, it is likely that the improved exposure of the NC surface to glucose facilitates the formation of a conductive carbon layer that is in intimate contact with the inorganic core, resulting in a high electronic conductivity of the electrode, as observed by us. The carbon coated etched LiMnPO4-based electrode exhibited a specific capacity of 118 mA h g(-1) at 1C, with a stable cycling performance and a capacity retention of 92% after 120 cycles at different C-rates. The delivered capacities were higher than those of electrodes based on not etched carbon coated NCs, which never exceeded 30 mA h g(-1). The rate capability here reported for the carbon coated etched LiMnPO4 nanocrystals represents an important result, taking into account that in the electrode formulation 80% wt is made of the active material and the adopted charge protocol is based on reasonable fast charge times.
Bhatti, Humaira S
2016-04-20
Li4Ti5O12, Li2TiO3 and dual-phase Li4Ti5O12/Li2TiO3 composite were prepared by sol-gel method with average particle size of 1 µm, 0.3 µm and 0.4 µm, respectively. Though Li2TiO3 is electrochemically inactive, the rate capability of Li4Ti5O12/Li2TiO3 is comparable to Li4Ti5O12 at different current rates. Li4Ti5O12/Li2TiO3 also shows good rate performance of 90 mA h g-1 at high rate of 10 C in voltage range of 1−3 V, attributable to increased interfaces in the composite. While Li4Ti5O12 delivers capacity retention of 88.6 % at 0.2 C over 50 cycles, Li4Ti5O12/Li2TiO3 exhibits no capacity fading at 0.2 C (40 cycles) and capacity retention of 98.45 % at 0.5 C (50 cycles). This highly stable cycling performance is attributed to the contribution of Li2TiO3 in preventing undesirable reaction of Li4Ti5O12 with the electrolyte during cycling. CV curves of Li4Ti5O12/Li2TiO3 in 0−3 V range exhibit two anodic peaks at 1.51 V and 0.7−0.0 V, indicating two modes of lithium intercalation into the lattice sites of active material. Owing to enhanced intercalation/de-intercalation kinetics in 0−3 V, composite electrode delivers superior rate performance of 203 mAh/g at 2.85 C and 140 mAh/g at 5.7 C with good reversible capacity retention over 100 cycles.
Bhatti, Humaira S; Anjum, Dalaver H.; Ullah, Shafiq; Ahmed, Bilal; Habib, Amir; Karim, Altaf; Hasanain, Syed Khurshid
2016-01-01
Li4Ti5O12, Li2TiO3 and dual-phase Li4Ti5O12/Li2TiO3 composite were prepared by sol-gel method with average particle size of 1 µm, 0.3 µm and 0.4 µm, respectively. Though Li2TiO3 is electrochemically inactive, the rate capability of Li4Ti5O12/Li2TiO3 is comparable to Li4Ti5O12 at different current rates. Li4Ti5O12/Li2TiO3 also shows good rate performance of 90 mA h g-1 at high rate of 10 C in voltage range of 1−3 V, attributable to increased interfaces in the composite. While Li4Ti5O12 delivers capacity retention of 88.6 % at 0.2 C over 50 cycles, Li4Ti5O12/Li2TiO3 exhibits no capacity fading at 0.2 C (40 cycles) and capacity retention of 98.45 % at 0.5 C (50 cycles). This highly stable cycling performance is attributed to the contribution of Li2TiO3 in preventing undesirable reaction of Li4Ti5O12 with the electrolyte during cycling. CV curves of Li4Ti5O12/Li2TiO3 in 0−3 V range exhibit two anodic peaks at 1.51 V and 0.7−0.0 V, indicating two modes of lithium intercalation into the lattice sites of active material. Owing to enhanced intercalation/de-intercalation kinetics in 0−3 V, composite electrode delivers superior rate performance of 203 mAh/g at 2.85 C and 140 mAh/g at 5.7 C with good reversible capacity retention over 100 cycles.
On possible structures of normal ionizing shock waves in electromagnetic shock tubes
International Nuclear Information System (INIS)
Liberman, M.A.; Synakh, V.S.; Zakajdakhov, V.V.; Velikovich, A.L.
1982-01-01
The problem of possible structures of normal ionizing shock waves is studied. On the basis of the general theory of ionizing shock waves in magnetic fields, a similarity solution of the piston problem for an impenetrable piston and a magnetic piston is described and a numerical solution of the non-stationary piston problem is obtained. It is shown that precursor photo-ionization of the neutral gas by the radiation of the shock-heated gas is the dominant factor in shaping normal ionizing shock structures. In particular, it is shown that the strong overheating of atoms and ions in shock fronts is due to the tensor form of Ohm's law in the precursor region. (author)
International Nuclear Information System (INIS)
Russell, C.T.; Mellott, M.M.; Smith, E.J.; King, J.H.
1983-01-01
ISEE 1,2,3 IMP8, and Prognoz 7 observations of interplanetary shocks in 1978 and 1979 provide five instances where a single shock is observed by four spacecraft. These observations are used to determine best-fit normals for these five shocks. In addition to providing well-documented shocks for furture techniques. When the angle between upstream and downstream magnetic field is greater than 20, magnetic coplanarity can be an accurate single spacecraft method. However, no technique based solely on the magnetic measurements at one or multiple sites was universally accurate. Thus, we recommend using overdetermined shock normal solutions whenever possible, utilizing plasma measurements, separation vectors, and time delays together with magnetic constraints
International Nuclear Information System (INIS)
Nemeth, J.D.
1981-01-01
A shock absorber for the support of piping and components in a nuclear power plant is described. It combines a high degree of stiffness under sudden shocks, e.g. seismic disturbances, with the ability to allow for thermal expansion without resistance when so required. (JIW)
DFT+U study of polaronic conduction in Li2O2 and Li2CO3
DEFF Research Database (Denmark)
García Lastra, Juan Maria; Myrdal, J.S.G.; Christensen, Rune
2013-01-01
The main discharge products formed at the cathode of nonaqueous Li-air batteries are known to be Li2O2 and residual Li2CO3. Recent experiments indicate that the charge transport through these materials is the main limiting factor for the battery performance. It has been also shown...... that the performance of the battery decreases drastically when the amount of Li2CO3 at the cathode increases with respect to Li2O2. In this work, we study the formation and transport of hole and electron polarons in Li2O2 and Li2CO3 using density functional theory (DFT) within the PBE+U approximation. For both...... materials, we find that the formation of polarons (both hole and electron) is stabilized with respect to the delocalized states for all physically relevant values of U. We find a much higher mobility for hole polarons than for the electron polarons, and we show that the poor charge transport in Li2CO3...
International Nuclear Information System (INIS)
Liu, X.H.; Yi, X.Q.; Jiang, Y.
2011-01-01
Mass transfer performance of two commonly used liquid desiccants, LiBr aqueous solution and LiCl aqueous solution, is compared in this paper on the basis of the same solution temperature and surface vapor pressure. According to the analysis of the analytical solutions of heat and mass transfer processes, the key performance influencing factors are heat capacity ratio of air to desiccant m * and mass transfer unit NTU m . The heat capacities of the two liquid desiccants are about the same at same volumetric flow rate, and LiBr solution has higher density and smaller specific heat capacity. The variance of mass transfer unit with different operating conditions and liquid desiccants are derived based on the experimental results. In the condition of the same desiccant mass flow rate, the dehumidification performance of LiCl solution is better, and the regeneration performance of LiBr solution is a little better or almost the same as that of LiCl solution. In the condition of the same desiccant volumetric flow rate, the dehumidification performance of LiCl solution is a little better or about the same compared with LiBr solution, and the regeneration performance of LiBr solution is better. The COPs of the liquid desiccant systems using these two desiccants are similar; while LiCl solution costs 18% lower than LiBr solution at current Chinese price.
System Shock: The Archetype of Operational Shock
2017-05-25
the battle space. They can also facilitate a much greater understanding of the variables involved in each party’s decision - making process. However...system shock nests within current US Army Unified Land Operations doctrine. In order to test the utility of system shock theory to Gray Zone...23 Neil E. Harrison, “Thinking about the World We Make ” in Chaos Theory in the Social Sciences: Foundations and Applications
[100]-Oriented LiFePO4 Nanoflakes toward High Rate Li-Ion Battery Cathode.
Li, Zhaojin; Peng, Zhenzhen; Zhang, Hui; Hu, Tao; Hu, Minmin; Zhu, Kongjun; Wang, Xiaohui
2016-01-13
[100] is believed to be a tough diffusion direction for Li(+) in LiFePO4, leading to the belief that the rate performance of [100]-oriented LiFePO4 is poor. Here we report the fabrication of 12 nm-thick [100]-oriented LiFePO4 nanoflakes by a simple one-pot solvothermal method. The nanoflakes exhibit unexpectedly excellent electrochemical performance, in stark contrast to what was previously believed. Such an exceptional result is attributed to a decreased thermodynamic transformation barrier height (Δμb) associated with increased active population.
Unlimited Relativistic Shock Surfing Acceleration
International Nuclear Information System (INIS)
Ucer, D.; Shapiro, V. D.
2001-01-01
Nonrelativistic shock surfing acceleration at quasiperpendicular shocks is usually considered to be a preacceleration mechanism for slow pickup ions to initiate diffusive shock acceleration. In shock surfing, the particle accelerates along the shock front under the action of the convective electric field of the plasma flow. However, the particle also gains kinetic energy normal to the shock and eventually escapes downstream. We consider the case when ions are accelerated to relativistic velocities. In this case, the ions are likely to be trapped for infinitely long times, because the energy of bounce oscillations tends to decrease during acceleration. This suggests the possibility of unlimited acceleration by shock surfing
Fürtauer, Siegfried; Effenberger, Herta S; Flandorfer, Hans
2014-12-01
The stannides CuLi 2 Sn (CSD-427095) and Cu 2 LiSn (CSD-427096) were synthesized by induction melting of the pure elements and annealing at 400 °C. The phases were reinvestigated by X-ray powder and single-crystal X-ray diffractometry. Within both crystal structures the ordered CuSn and Cu 2 Sn lattices form channels which host Cu and Li atoms at partly mixed occupied positions exhibiting extensive vacancies. For CuLi 2 Sn, the space group F-43m. was verified (structure type CuHg 2 Ti; a =6.295(2) Å; wR 2 ( F ²)=0.0355 for 78 unique reflections). The 4( c ) and 4( d ) positions are occupied by Cu atoms and Cu+Li atoms, respectively. For Cu 2 LiSn, the space group P 6 3 / mmc was confirmed (structure type InPt 2 Gd; a =4.3022(15) Å, c =7.618(3) Å; wR 2 ( F ²)=0.060 for 199 unique reflections). The Cu and Li atoms exhibit extensive disorder; they are distributed over the partly occupied positions 2( a ), 2( b ) and 4( e ). Both phases seem to be interesting in terms of application of Cu-Sn alloys as anode materials for Li-ion batteries.
Direct Rehydrogenation of LiBH4 from H-Deficient Li2B12H12−x
Directory of Open Access Journals (Sweden)
Yigang Yan
2018-03-01
Full Text Available Li2B12H12 is commonly considered as a boron sink hindering the reversible hydrogen sorption of LiBH4. Recently, in the dehydrogenation process of LiBH4 an amorphous H-deficient Li2B12H12−x phase was observed. In the present study, we investigate the rehydrogenation properties of Li2B12H12−x to form LiBH4. With addition of nanostructured cobalt boride in a 1:1 mass ratio, the rehydrogenation properties of Li2B12H12−x are improved, where LiBH4 forms under milder conditions (e.g., 400 °C, 100 bar H2 with a yield of 68%. The active catalytic species in the reversible sorption reaction is suggested to be nonmetallic CoxB (x = 1 based on 11B MAS NMR experiments and its role has been discussed.
Huang, Shiqiang; Wang, Shuwei; Hu, Guohong; Cheong, Ling-Zhi; Shen, Cai
2018-05-01
Solid-electrolyte interphase (SEI) layer is an organic-inorganic composite layer that allows Li+ transport across but blocks electron flow across and prevents solvent diffusing to electrode surface. Morphology, thickness, mechanical and chemical properties of SEI are important for safety and cycling performance of lithium-ion batteries. Herein, we employ a combination of in-situ AFM and XPS to investigate the effects of two electrolyte additives namely lithium difluoro(oxalate)borate (LiDFOB) and lithium bis(oxalato)borate (LiBOB) on SEI layer. LiDFOB is found to result in a thin but hard SEI layer containing more inorganic species (LiF and LiCO3); meanwhile LiBOB promotes formation of a thick but soft SEI layer containing more organic species such as ROCO2Li. Findings from present study will help development of electrolyte additives that promote formation of good SEI layer.
Synthesis, Structure, and Li-Ion Conductivity of LiLa(BH4)3X, X = Cl, Br, I
DEFF Research Database (Denmark)
GharibDoust, Seyed Hosein Payandeh; Brighi, Matteo; Sadikin, Yolanda
2017-01-01
In this work, a new type of addition reaction between La(BH4)3 and LiX, X = Cl, Br, I, is used to synthesize LiLa(BH4)3Cl and two new compounds LiLa(BH4)3X, X = Br, I. This method increases the amounts of LiLa(BH4)3X and the sample purity. The highest Li-ion conductivity is observed for LiLa(BH4...... with increasing lattice parameter, that is, increasing size of the halide ion in the structure. Thus, we conclude that the sizes of both windows are important for the lithium ion conduction in LiLa(BH4)3X compounds. The lithium ion conductivity is measured over one to three heating cycles and with different...
Formation and reduction behaviors of zirconium oxide compounds in LiCl–Li{sub 2}O melt at 923 K
Energy Technology Data Exchange (ETDEWEB)
Sakamura, Yoshiharu, E-mail: sakamura@criepi.denken.or.jp [Central Research Institute of Electric Power Industry (CRIEPI), 2-11-1 Iwadokita, Komae-shi, Tokyo 201-8511 (Japan); Iizuka, Masatoshi [Central Research Institute of Electric Power Industry (CRIEPI), 2-11-1 Iwadokita, Komae-shi, Tokyo 201-8511 (Japan); Kitawaki, Shinichi; Nakayoshi, Akira; Kofuji, Hirohide [International Research Institute for Nuclear Decommissioning (IRID), 2-23-1 Nishi-shimbashi, Minato-ku, Tokyo 105-0003 (Japan); Japan Atomic Energy Agency (JAEA), 4-33 Muramatsu, Tokai-mura, Naka-gun, Ibaraki 319-1194 (Japan)
2015-11-15
The reduction behaviors of ZrO{sub 2}, Li{sub 2}ZrO{sub 3} and (U,Pu,Zr)O{sub 2} in a LiCl–Li{sub 2}O salt bath at 923 K were investigated. This study was conducted as part of a feasibility study on the pyrochemical treatment of damaged fuel debris generated by severe accidents at light water reactors. It was demonstrated in electrolytic reduction tests that the uranium in synthetic corium specimens of (U,Pu,Zr)O{sub 2} with various ZrO{sub 2} contents could be reduced to the metallic form and that part of the zirconium was converted to Li{sub 2}ZrO{sub 3}. Zirconium metal and Li{sub 2}ZrO{sub 3} were obtained by the reduction of ZrO{sub 2}. The reduction of Li{sub 2}ZrO{sub 3} did not proceed even in LiCl containing no Li{sub 2}O. Moreover, the stable chemical forms of the ZrO{sub 2}–Li{sub 2}O complex oxide were investigated as a function of the Li{sub 2}O concentration in LiCl. ZrO{sub 2} was converted to Li{sub 2}ZrO{sub 3} at a Li{sub 2}O concentration of 0.018 wt%. As the Li{sub 2}O concentration was increased, Li{sub 2}ZrO{sub 3} was converted to Li{sub 6}Zr{sub 2}O{sub 7} and then to Li{sub 8}ZrO{sub 6}. It is suggested that the removal of Li{sub 2}ZrO{sub 3} from the reduction product is a key point in the pyrochemical treatment of corium. - Highlights: • The uranium in (U,Pu,Zr)O{sub 2} could be reduced to the metallic form in LiCl–Li{sub 2}O. • Part of the zirconium was converted to Li{sub 2}ZrO{sub 3} during electrolytic reduction. • Li{sub 6}Zr{sub 2}O{sub 7} and Li{sub 8}ZrO{sub 6} formed at high Li{sub 2}O concentrations in LiCl.
Measurements of the fundamental thermodynamic parameters of Li/BCX and Li/SOCl2 cells
Kalu, E. E.; White, R. E.; Darcy, E. C.
1992-01-01
Two experimental techniques - equilibrium or reversible cell discharge and measurement of open circuit potential as a function of temperature - are used to determine the thermodynamic data needed to estimate the heat generation characteristics of Li/BCX and Li/SOCl2 cells. The results obtained showed that the reversible cell potential, the temperature dependence of the reversible cell potential, and the thermoneutral potential of the BCX cell were 3.74 V, -0.857 +/- 0.198 mV/K, and 3.994 +/- 0.0603 V, respectively. The respective values obtained for the Li/SOCl2 cell were 3.67 V, -0.776 +/- 0.255 mV/K, and 3.893 +/- 0.0776 V. The difference between the thermoneutral potential of Li/BCX and Li/SCl2 cells is attributable to the difference in their electroactive components.
Choi, Eun-Young; Jeon, Min Ku; Lee, Jeong; Kim, Sung-Wook; Lee, Sang Kwon; Lee, Sung-Jai; Heo, Dong Hyun; Kang, Hyun Woo; Jeon, Sang-Chae; Hur, Jin-Mok
2017-03-01
We present our findings that uranium (U) metal prepared by using the electrolytic reduction process for U oxide (UO2) in a Li2O-LiCl salt can be reoxidized into UO2 through the reaction between the U metal and Li2O in LiCl. Two salt types were used for immersion of the U metal: one was the salt used for electrolytic reduction, and the other was applied to the unused LiCl salts with various concentrations of Li2O and Li metal. Our results revealed that the degree of reoxidation increases with the increasing Li2O concentration in LiCl and that the presence of the Li metal in LiCl suppresses the reoxidation of the U metal.
Klein, Marty; Rilling, Mark
1972-01-01
Two experiments investigated free-operant avoidance responding with pigeons using a treadle-pressing response. In Experiment I, pigeons were initially trained on a free-operant avoidance schedule with a response-shock interval of 32 sec and a shock-shock interval of 10 sec, and were subsequently exposed to 10 values of the response-shock parameter ranging from 2.5 to 150 sec. The functions relating response rate to response-shock interval were similar to the ones reported by Sidman in his 1953 studies employing rats, and were independent of the order of presentation of the response-shock values. Shock rates decreased as response-shock duration increased. In Experiment II, a free-operant avoidance schedule with a response-shock interval of 20 sec and a shock-shock interval of 5 sec was used, and shock intensities were varied over five values ranging from 2 to 32 mA. Response rates increased markedly as shock intensity increased from 2 to 8 mA, but rates changed little with further increases in shock intensity. Shock rates decreased as intensity increased from 2 to 8 mA, and showed little change as intensity increased from 8 to 32 mA. PMID:4652617
7Li(d,p)8Li transfer reaction in the NCSM/RGM approach
Raimondi, F.; Hupin, G.; Navrátil, P.; Quaglioni, S.
2018-03-01
Recently, we applied an ab initio method, the no-core shell model combined with the resonating group method, to the transfer reactions with light p-shell nuclei as targets and deuteron as the projectile. In particular, we studied the elastic scattering of deuterium on 7Li and the 7Li(d,p)8Li transfer reaction starting from a realistic two-nucleon interaction. In this contribution, we review of our main results on the 7Li(d,p)8Li transfer reaction, and we extend the study of the relevant reaction channels, by showing the dominant resonant phase shifts of the scattering matrix. We assess also the impact of the polarization effects of the deuteron below the breakup on the positive-parity resonant states in the reaction. For this purpose, we perform an analysis of the convergence trend of the phase and eigenphase shifts, with respect to the number of deuteron pseudostates included in the model space.
Diaphragmless shock wave generators for industrial applications of shock waves
Hariharan, M. S.; Janardhanraj, S.; Saravanan, S.; Jagadeesh, G.
2011-06-01
The prime focus of this study is to design a 50 mm internal diameter diaphragmless shock tube that can be used in an industrial facility for repeated loading of shock waves. The instantaneous rise in pressure and temperature of a medium can be used in a variety of industrial applications. We designed, fabricated and tested three different shock wave generators of which one system employs a highly elastic rubber membrane and the other systems use a fast acting pneumatic valve instead of conventional metal diaphragms. The valve opening speed is obtained with the help of a high speed camera. For shock generation systems with a pneumatic cylinder, it ranges from 0.325 to 1.15 m/s while it is around 8.3 m/s for the rubber membrane. Experiments are conducted using the three diaphragmless systems and the results obtained are analyzed carefully to obtain a relation between the opening speed of the valve and the amount of gas that is actually utilized in the generation of the shock wave for each system. The rubber membrane is not suitable for industrial applications because it needs to be replaced regularly and cannot withstand high driver pressures. The maximum shock Mach number obtained using the new diaphragmless system that uses the pneumatic valve is 2.125 ± 0.2%. This system shows much promise for automation in an industrial environment.
Single-crystalline LiFePO4 nanosheets for high-rate Li-ion batteries.
Zhao, Yu; Peng, Lele; Liu, Borui; Yu, Guihua
2014-05-14
The lithiation/delithiation in LiFePO4 is highly anisotropic with lithium-ion diffusion being mainly confined to channels along the b-axis. Controlling the orientation of LiFePO4 crystals therefore plays an important role for efficient mass transport within this material. We report here the preparation of single crystalline LiFePO4 nanosheets with a large percentage of highly oriented {010} facets, which provide the highest pore density for lithium-ion insertion/extraction. The LiFePO4 nanosheets show a high specific capacity at low charge/discharge rates and retain significant capacities at high C-rates, which may benefit the development of lithium batteries with both favorable energy and power density.
Li-atoms-induced structure changes of Guinier–Preston–Bagaryatsky zones in AlCuLiMg alloys
Energy Technology Data Exchange (ETDEWEB)
Duan, S.Y.; Le, Z.; Chen, Z.K.; Gao, Z. [Center for High-Resolution Electron Microscopy, College of Materials Science and Engineering, Hunan University, Changsha, Hunan 410082 (China); Chen, J.H., E-mail: jhchen123@hnu.edu.cn [Center for High-Resolution Electron Microscopy, College of Materials Science and Engineering, Hunan University, Changsha, Hunan 410082 (China); Advanced Research Center, Central South University, Changsha 410083 (China); Ming, W.Q.; Li, S.Y.; Wu, C.L. [Center for High-Resolution Electron Microscopy, College of Materials Science and Engineering, Hunan University, Changsha, Hunan 410082 (China); Yan, N. [Advanced Research Center, Central South University, Changsha 410083 (China)
2016-11-15
Guinier–Preston–Bagaryatsky (GPB) zones are the well-known strengthening precipitates of AlCuMg alloys formed upon thermal ageing. Here we report that when formed in AlCuLiMg alloys the GPB zones can change significantly in morphology and structure. It is shown that though they do still consist of Al, Cu and Mg elements fundamentally, the GPB zones in AlCuLiMg alloys have a rather different structure due to a featured Li-segregation at their interfaces with the matrix and possible Li-replacement of partial Mg atoms in the structure. As such the Li-containing GPB zones often develop from one-dimensional to quasi-two-dimensional precipitates. - Highlights: • We observe Guinier–Preston–Bagaryatsky zone variants in AlCuLiMg alloys. • We obtain atomic-resolution images of the precipitates and model their structures. • Li-atoms play a key role in modifying the structure of these precipitate variants.
Takayama, Kazuyoshi; Obara, Tetsuro; Onodera, Osamu
1991-04-01
Underwater shock wave focusing is successfully applied to disintegrate and remove kidney stones or gallbladder stones without using surgical operations. This treatment is one of the most peaceful applications ofshock waves and is named as the Extracorporeal Shock Wave Lithotripsy. Ajoint research project is going on between the Institute ofFluid Science, Tohoku University and the School ofMedicine, Tohoku University. The paper describes a result of the fundamental research on the underwater shock wave focusing applied to the ESWL. Quantitatively to visualize the underwater shock waves, various optical flow visualization techniques were successfully used such as holographic interferometry, and shadowgraphs combined with Ima-Con high speed camera. Double exposure holographic interferometric observation revealed the mechanism of generation, propagation and focusing of underwater shock waves. The result of the present research was already used to manufacture a prototype machine and it has already been applied successfully to ESWL crinical treatments. However, despite of success in the clinical treatments, important fundamental questions still remain unsolved, i.e., effects of underwater shock wave focusing on tissue damage during the treatment. Model experiments were conducted to clarify mechanism of the tissue damage associated with the ESWL. Shock-bubble interactions were found responsible to the tissue damage during the ESWL treatment. In order to interprete experimental findings and to predict shock wave behavior and high pressures, a numerical simulation was carried. The numerical results agreed with the experiments.
Energy Technology Data Exchange (ETDEWEB)
Choi, Eun-Young, E-mail: eychoi@kaeri.re.kr [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Jeon, Min Ku [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Department of Quantum Energy Chemical Engineering, University of Science and Technology, Gajeong-ro 217, Yuseong-gu, Daejeon 34113 (Korea, Republic of); Lee, Jeong [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Kim, Sung-Wook [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Department of Quantum Energy Chemical Engineering, University of Science and Technology, Gajeong-ro 217, Yuseong-gu, Daejeon 34113 (Korea, Republic of); Lee, Sang Kwon [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Lee, Sung-Jai [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of); Department of Quantum Energy Chemical Engineering, University of Science and Technology, Gajeong-ro 217, Yuseong-gu, Daejeon 34113 (Korea, Republic of); Heo, Dong Hyun; Kang, Hyun Woo; Jeon, Sang-Chae; Hur, Jin-Mok [Korea Atomic Energy Research Institute, Daedoek-daero 989-111, Yuseong-gu, Daejeon 34057 (Korea, Republic of)
2017-03-15
We present our findings that uranium (U) metal prepared by using the electrolytic reduction process for U oxide (UO{sub 2}) in a Li{sub 2}O–LiCl salt can be reoxidized into UO{sub 2} through the reaction between the U metal and Li{sub 2}O in LiCl. Two salt types were used for immersion of the U metal: one was the salt used for electrolytic reduction, and the other was applied to the unused LiCl salts with various concentrations of Li{sub 2}O and Li metal. Our results revealed that the degree of reoxidation increases with the increasing Li{sub 2}O concentration in LiCl and that the presence of the Li metal in LiCl suppresses the reoxidation of the U metal. - Highlights: • Uranium (U) metal can be reoxidized into UO{sub 2} through the reaction between the U metal and Li{sub 2}O in LiCl. • The degree of reoxidation increases with the Li{sub 2}O concentration in LiCl. • The presence of the Li metal in LiCl suppresses the reoxidation of the U metal.
2013 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Tulalip Partnership
National Oceanic and Atmospheric Administration, Department of Commerce — In October 2012, WSI (Watershed Sciences, Inc.) was contracted by the Puget Sound LiDAR Consortium (PSLC)to collect Light Detection and Ranging (LiDAR) data on a...
2013 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Saddle Mountain
National Oceanic and Atmospheric Administration, Department of Commerce — In October 2013, WSI, a Quantum Spatial Company (QSI), was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR) data...
International Nuclear Information System (INIS)
Wu, C.Y.R.; Crooks, J.B.; Yang, S.C.; Way, K.R.; Stwalley, W.C.
1977-01-01
The characterization of a lithium supersonic nozzle beam was made using spectroscopic techniques. It is found that at a stagnation pressure of 5.3 kPa (40 torr) and a nozzle throat diameter of 0.4 mm the ground state vibrational population of Li 2 can be described by a Boltzmann distribution with T/sub v/ = 195 +- 30 0 K. The rotational temperature is found to be T/sub r/ = 70 +- 20 0 K by band shape analysis. Measurements by quadrupole mass spectrometer indicates that approximately 10 mole per cent Li 2 dimers are formed at an oven body temperature of 1370 0 K n the supersonic nozzle expansion. This measured mole fraction is in good agreement with the existing dimerization theory
SHOCK ABSORBERS ), (*GUIDED MISSILE SILOS, SHOCK ABSORBERS ), (*SPRINGS, (*SHOCK(MECHANICS), REDUCTION), TORSION BARS, ELASTOMERS, DAMPING, EQUATIONS OF MOTION, MODEL TESTS, TEST METHODS, NUCLEAR EXPLOSIONS, HARDENING.
International Nuclear Information System (INIS)
Arthur, Aaron D.; Le Roux, Jakobus A.
2013-01-01
Observations by the plasma and magnetic field instruments on board the Voyager 2 spacecraft suggest that the termination shock is weak with a compression ratio of ∼2. However, this is contrary to the observations of accelerated particle spectra at the termination shock, where standard diffusive shock acceleration theory predicts a compression ratio closer to ∼2.9. Using our focused transport model, we investigate pickup proton acceleration at a stationary spherical termination shock with a moderately strong compression ratio of 2.8 to include both the subshock and precursor. We show that for the particle energies observed by the Voyager 2 Low Energy Charged Particle (LECP) instrument, pickup protons will have effective length scales of diffusion that are larger than the combined subshock and precursor termination shock structure observed. As a result, the particles will experience a total effective termination shock compression ratio that is larger than values inferred by the plasma and magnetic field instruments for the subshock and similar to the value predicted by diffusive shock acceleration theory. Furthermore, using a stochastically varying magnetic field angle, we are able to qualitatively reproduce the multiple power-law structure observed for the LECP spectra downstream of the termination shock
Effect of [Li]/[Nb] ratio on composition and defect structure of Zr:Yb:Tm:LiNbO3 crystals
Liu, Chunrui; Dai, Li; Wang, Luping; Shao, Yu; Yan, Zhehua; Xu, Yuheng
2018-04-01
Zr:Yb:Tm:LiNbO3 crystals with various [Li]/[Nb] ratios (0.946, 1.05, 1.20 and 1.38) were grown by the Czochralski technique. Distribution coefficients of Zr4+, Yb3+ and Tm3+ ions were analyzed by the inductively coupled plasma-atomic emission spectrometer (ICP-AES). The influence of [Li]/[Nb] ratio on the composition and defect structure of Zr:Yb:Tm:LiNbO3 crystals was investigated by X-ray diffraction and IR transmission spectrum. The results show that as the [Li]/[Nb] ratio increases in the melt, the distribution coefficients of Yb3+ and Tm3+ ions both increase while that of Zr4+ ion deceases. When the [Li]/[Nb] ratio increases to 1.20 in the melt, Zr:Yb:Tm:LiNbO3 crystal is nearly stoichiometric. In addition, when the [Li]/[Nb] ratio reaches up to 1.38, NbLi4+ are completely replaced and Li+ starts to impel the Zr4+, Yb3+ and Tm3+ into the normal Li sites.
International Nuclear Information System (INIS)
Sanchez, Rodolfo; Noertershaeuser, Wilfried; Dax, Andreas; Ewald, Guido; Goette, Stefan; Kirchner, Reinhard; Kluge, H.-Juergen; Kuehl, Thomas; Wojtaszek, Agnieszka; Bushaw, Bruce A.; Drake, Gordon W. F.; Yan Zongchao; Zimmermann, Claus; Albers, Daniel; Behr, John; Bricault, Pierre; Dilling, Jens; Dombsky, Marik; Lassen, Jens; Phil Levy, C. D.
2006-01-01
We have determined the nuclear charge radius of 11 Li by high-precision laser spectroscopy. The experiment was performed at the TRIUMF-ISAC facility where the 7 Li- 11 Li isotope shift (IS) was measured in the 2s → 3s electronic transition using Doppler-free two-photon spectroscopy with a relative accuracy better than 10 -5 . The accuracy for the IS of the other lithium isotopes was also improved. IS's are mainly caused by differences in nuclear mass, but changes in proton distribution also give small contributions. Comparing experimentally measured IS with advanced atomic calculation of purely mass-based shifts, including QED and relativistic effects, allows derivation of the nuclear charge radii. The radii are found to decrease monotonically from 6 Li to 9 Li, and then increase with 11 Li about 11% larger than 9 Li. These results are a benchmark for the open question as to whether nuclear core excitation by halo neutrons is necessary to explain the large nuclear matter radius of 11 Li; thus, the results are compared with a number of nuclear structure models.
Fabrication and tritium release property of Li2TiO3-Li4SiO4 biphasic ceramics
Yang, Mao; Ran, Guangming; Wang, Hailiang; Dang, Chen; Huang, Zhangyi; Chen, Xiaojun; Lu, Tiecheng; Xiao, Chengjian
2018-05-01
Li2TiO3-Li4SiO4 biphasic ceramic pebbles have been developed as an advanced tritium breeder due to the potential to combine the advantages of both Li2TiO3 and Li4SiO4. Wet method was developed for the pebble fabrication and Li2TiO3-Li4SiO4 biphasic ceramic pebbles were successfully prepared by wet method using the powders synthesized by hydrothermal method. The tritium release properties of the Li2TiO3-Li4SiO4 biphasic ceramic pebbles were evaluated. The biphasic pebbles exhibited good tritium release property at low temperatures and the tritium release temperature was around 470 °C. Because of the isotope exchange reaction between H2 and tritium, the addition of 0.1%H2 to purge gas He could significantly enhance the tritium gas release and the fraction of molecular form of tritium increased from 28% to 55%. The results indicate that the Li2TiO3-Li4SiO4 biphasic ceramic pebbles fabricated by wet method exhibit good tritium release property and hold promising potential as advanced breeder pebbles.
Simplified PCR protocols for INNO-LiPA HBV Genotyping and INNO-LiPA HBV PreCore assays
Qutub, Mohammed O.; Germer, Jeffrey J.; Rebers, Sjoerd P. H.; Mandrekar, Jayawant N.; Beld, Marcel G. H. M.; Yao, Joseph D. C.
2006-01-01
INNO-LiPA HBV Genotyping (LiPA HBV GT) and INNO-LiPA HBV PreCore (LiPA HBV PC) are commercially available assays for hepatitis B virus (HBV) characterization. These assays are labor-intensive and may be prone to exogenous DNA contamination due to their use of nested PCR amplification procedures and
Mullabaev, Albert; Tkacheva, Olga; Shishkin, Vladimir; Kovrov, Vadim; Zaikov, Yuriy; Sukhanov, Leonid; Mochalov, Yuriy
2018-03-01
Crystallization temperatures (liquidus and solidus) in the LiCl-Li2O and (LiCl-KCl)-Li2O systems with the KCl content of 10 and 20 mol.% were obtained with independent methods of thermal analysis using cooling curves, isothermal saturation, and differential scanning calorimetry. The linear sweep voltammetry was applied to control the time of the equilibrium establishment in the molten system after the Li2O addition, which depended on the composition of the base melt and the concentration of Li2O. The fragments of the binary LiCl-Li2O and quazi-binary [LiCl-KCl(10 mol.%)]-Li2O and [LiCl-KCl(20 mol.%)]-Li2O phase diagrams in the Li2O concentration range from 0 to 12 mol.% were obtained. The KCl presence in the LiCl-KCl-Li2O molten mixture in the amount of 10 and 20 mol.% reduces the liquidus temperature by 30 and 80°, respectively, but the region of the homogeneous molten state of the system is considerably narrowed, which complicates its practical application. The Li2O solubility in the molten LiCl, LiCl-KCl(10 mol.%) and LiCl-KCl(20 mol.%) decreases with increasing the KCl content and is equal to 11.5, 7.7 and 3.9 mol.% at 650°С, respectively. The LiCl-KCl melt with 10 mol.% KCl can be recommended for practical use as a medium for the SNF pyro-chemical reprocessing at temperature below 700 °C.
Directory of Open Access Journals (Sweden)
Yusei Takemoto
2017-12-01
Full Text Available Go-sha-jinki-gan (GJG, a traditional Japanese herbal medicine has a clinical implication to alleviate age-related symptoms, especially in some motor disorders. However, the scientific evidence is limited, and there is a possibility to expand the medical application range of GJG. Using senescence-accelerated mice, our group showed that GJG exerted an effect to prevent sarcopenia, the aged-related loss of skeletal muscle. Because muscular dystrophy is characterized by a progressive loss of skeletal muscle, we examined the effects of GJG on a mouse model of muscular dystrophy. Using a newly established mouse model for Duchenne muscular dystrophy (DMD, DBA/2-mdx, we showed that GJG significantly increased the body and skeletal muscle weights in comparison to the control DBA/2-mdx mice, regardless of gender. The increased skeletal muscle mass resulted from an increment in the myofiber size, but not from the myofiber number. Both the skeletal muscle regenerative ability and the accumulation of fibrosis (the dystrophic pathology in GJG-fed DBA/2-mdx mice were comparable to those in control DBA/2-mdx mice, suggesting that the cellular target of GJG is myofibers, with no contribution from the muscle satellite cells neither in an direct nor in an indirect manner. Taken together, GJG increased the skeletal muscle mass in a mouse model of muscular dystrophy, in addition to our previously tested sarcopenia mouse model.
The cosmic-ray shock structure problem for relativistic shocks
Webb, G. M.
1985-01-01
The time asymptotic behaviour of a relativistic (parallel) shock wave significantly modified by the diffusive acceleration of cosmic-rays is investigated by means of relativistic hydrodynamical equations for both the cosmic-rays and thermal gas. The form of the shock structure equation and the dispersion relation for both long and short wavelength waves in the system are obtained. The dependence of the shock acceleration efficiency on the upstream fluid spped, long wavelength Mach number and the ratio N = P sub co/cP sub co+P sub go)(Psub co and P sub go are the upstream cosmic-ray and thermal gas pressures respectively) are studied.
Directory of Open Access Journals (Sweden)
Qian Wan
2015-04-01
Full Text Available Research on shock wave mitigation in channels has been a topic of much attention in the shock wave community. One approach to attenuate an incident shock wave is to use obstacles of various geometries arranged in different patterns. This work is inspired by the study from Chaudhuri et al. (2013, in which cylinders, squares and triangles placed in staggered and non-staggered subsequent columns were used to attenuate a planar incident shock wave. Here, we present numerical simulations using a different obstacle pattern. Instead of using a matrix of obstacles, an arrangement of square or cylindrical obstacles placed along a logarithmic spiral curve is investigated, which is motivated by our previous work on shock focusing using logarithmic spirals. Results show that obstacles placed along a logarithmic spiral can delay both the transmitted and the reflected shock wave. For different incident shock Mach numbers, away from the logarithmic spiral design Mach number, this shape is effective to either delay the transmitted or the reflected shock wave. Results also confirm that the degree of attenuation depends on the obstacle shape, effective flow area and obstacle arrangement, much like other obstacle configurations.
The tin-rich copper lithium stannides: Li3Cu6Sn4 and Li2CuSn2
International Nuclear Information System (INIS)
Fuertauer, Siegfried; Flandorfer, Hans; Effenberger, Herta S.
2015-01-01
The Sn rich ternary intermetallic compounds Li 3 Cu 6 Sn 4 (CSD-427097) and Li 2 CuSn 2 (CSD-427098) were synthesized from the pure elements by induction melting and annealing at 400 C. Structural investigations were performed by powder- and single-crystal XRD. Li 3 Cu 6 Sn 4 crystallizes in space group P6/mmm; it is structurally related to but not isotypic with MgFe 6 Ge 6 (a = 5.095(2) Aa, c = 9.524(3) Aa; wR 2 = 0.059; 239 unique F 2 -values, 17 free variables). Li 3 Cu 6 Sn 4 is characterized by two sites with a mixed Cu:Sn occupation. In contrast to all other Cu-Li-Sn compounds known so far, any mixed occupation was found for Cu-Li pairs only. In addition, one Li site is only half occupied. The second Sn rich phase is Li 2 CuSn 2 (space group I4 1 /amd, a = 4.4281(15) Aa, c = 19.416(4) Aa; wR 2 = 0.033; 213 unique F 2 -values, 12 atom free variables); it is the only phase in the Cu-Li-Sn system which is noted for full ordering. Both crystal structures exhibit 3D-networks which host Li atoms in channels. They are important for understanding the lithiation mechanism in Cu-Sn electrodes for Li-ion batteries.
Storage and Effective Migration of Li-Ion for Defected β-LiFePO4 Phase Nanocrystals.
Guo, Hua; Song, Xiaohe; Zhuo, Zengqing; Hu, Jiangtao; Liu, Tongchao; Duan, Yandong; Zheng, Jiaxin; Chen, Zonghai; Yang, Wanli; Amine, Khalil; Pan, Feng
2016-01-13
Lithium iron phosphate, a widely used cathode material, crystallizes typically in olivine-type phase, α-LiFePO4 (αLFP). However, the new phase β-LiFePO4 (βLFP), which can be transformed from αLFP under high temperature and pressure, is originally almost electrochemically inactive with no capacity for Li-ion battery, because the Li-ions are stored in the tetrahedral [LiO4] with very high activation barrier for migration and the one-dimensional (1D) migration channels for Li-ion diffusion in αLFP disappear, while the Fe ions in the β-phase are oriented similar to the 1D arrangement instead. In this work, using experimental studies combined with density functional theory calculations, we demonstrate that βLFP can be activated with creation of effective paths of Li-ion migration by optimized disordering. Thus, the new phase of βLFP cathode achieved a capacity of 128 mAh g(-1) at a rate of 0.1 C (1C = 170 mA g(-1)) with extraordinary cycling performance that 94.5% of the initial capacity retains after 1000 cycles at 1 C. The activation mechanism can be attributed to that the induced disorder (such as FeLiLiFe antisite defects, crystal distortion, and amorphous domains) creates new lithium migration passages, which free the captive stored lithium atoms and facilitate their intercalation/deintercalation from the cathode. Such materials activated by disorder are promising candidate cathodes for lithium batteries, and the related mechanism of storage and effective migration of Li-ions also provides new clues for future design of disordered-electrode materials with high capacity and high energy density.
Converging cylindrical shocks in ideal magnetohydrodynamics
Pullin, D. I.
2014-09-01
We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R = √μ0/p0 I/(2π) where I is the current, μ0 is the permeability, and p0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field then
Converging cylindrical shocks in ideal magnetohydrodynamics
International Nuclear Information System (INIS)
Pullin, D. I.; Mostert, W.; Wheatley, V.; Samtaney, R.
2014-01-01
We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R=√(μ 0 /p 0 ) I/(2 π) where I is the current, μ 0 is the permeability, and p 0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field
Converging cylindrical shocks in ideal magnetohydrodynamics
Energy Technology Data Exchange (ETDEWEB)
Pullin, D. I. [Graduate Aerospace Laboratories, California Institute of Technology, Pasadena, California 91125 (United States); Mostert, W.; Wheatley, V. [School of Mechanical and Mining Engineering, University of Queensland, Queensland 4072 (Australia); Samtaney, R. [Mechanical Engineering, Physical Sciences and Engineering Division, King Abdullah University of Science and Technology, Thuwal (Saudi Arabia)
2014-09-15
We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R=√(μ{sub 0}/p{sub 0}) I/(2 π) where I is the current, μ{sub 0} is the permeability, and p{sub 0} is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The
Converging cylindrical shocks in ideal magnetohydrodynamics
Pullin, D. I.; Mostert, W.; Wheatley, V.; Samtaney, Ravi
2014-01-01
We consider a cylindrically symmetrical shock converging onto an axis within the framework of ideal, compressible-gas non-dissipative magnetohydrodynamics (MHD). In cylindrical polar co-ordinates we restrict attention to either constant axial magnetic field or to the azimuthal but singular magnetic field produced by a line current on the axis. Under the constraint of zero normal magnetic field and zero tangential fluid speed at the shock, a set of restricted shock-jump conditions are obtained as functions of the shock Mach number, defined as the ratio of the local shock speed to the unique magnetohydrodynamic wave speed ahead of the shock, and also of a parameter measuring the local strength of the magnetic field. For the line current case, two approaches are explored and the results compared in detail. The first is geometrical shock-dynamics where the restricted shock-jump conditions are applied directly to the equation on the characteristic entering the shock from behind. This gives an ordinary-differential equation for the shock Mach number as a function of radius which is integrated numerically to provide profiles of the shock implosion. Also, analytic, asymptotic results are obtained for the shock trajectory at small radius. The second approach is direct numerical solution of the radially symmetric MHD equations using a shock-capturing method. For the axial magnetic field case the shock implosion is of the Guderley power-law type with exponent that is not affected by the presence of a finite magnetic field. For the axial current case, however, the presence of a tangential magnetic field ahead of the shock with strength inversely proportional to radius introduces a length scale R = √μ0/p0 I/(2π) where I is the current, μ0 is the permeability, and p0 is the pressure ahead of the shock. For shocks initiated at r ≫ R, shock convergence is first accompanied by shock strengthening as for the strictly gas-dynamic implosion. The diverging magnetic field then
INSIDAD BAB AL-IJTIHAD DAN PENGARUHNYA TERHADAP MADHHAB SHAFI‘I
Directory of Open Access Journals (Sweden)
Luthfi Hadi Aminuddin
2016-02-01
Abstract: This work is based on historcal Islamic legal development especially discourse of closing ijtiha>d ’authority’. Muslem and non-moslem specialist writers sure that this discourse happened pasca a’immat al-madha>hib phase. This phase refers to the era when the creative thinking is stagnant. Amount of Shafi’ithe ulama> who state a binding ruling in religious matters of closing ijtiha>d authority, according to them, are responsible. This paper is to show that closing ijtiha>d ’authority’ discourse (insida>d ba> al-ijtiha>d begins from the times when al-Ghaza>li>, al-Ra>fi’i>, and al-Nawa>wi> clasify mujtahid prerequsites. Their ’mujtahid qualifications’ are efforts which can close ijtiha>d ’authority’ (bab> al-ijtiha>d. Mujtahids did do Ijtiha>d as a creative thinking such as insha>’i> and intiqa>’i>. But they did this as mujtahid muntasib, mujtahid fi> al-madhhab or al-mujtahid al-murajjih} as a different level from mujtahid mustaqill. As}ha>b al-Sha>fi‘i> such as al-Muzani>, al-Buwayt}i>, a-Juwayni>, al-Shayra>zi>, al-Ghaza>li>, al-Ra>fi‘i> and al-Nawa>wi> standardize istinba>t} method which Sha>fi’i> formulated. Keywords: Insida>d Ba>b al-Ijtiha>d, Dissenting Opinion, Tah}ri>r, Ijtiha>d Intiqa>’i>, Takhri>j.
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics. Xiao Qing Li. Articles written in Pramana – Journal of Physics. Volume 78 Issue 3 March 2012 pp 439-449 Research Articles. Modulation instability of an intense laser beam in an unmagnetized electron–positron–ion plasma · San Qiu Liu Wei Tang Xiao Qing Li · More Details ...
Ab initio study of isomerism of Li2AB2 molecules and Li2AB2+ ions with 16 valent electrons
International Nuclear Information System (INIS)
Charkin, O.P.; Klimenko, N.M.; MakKi, M.L.
2000-01-01
In the framework of MP2(6-31*//HF/6-31G + ZPE(HF/6-31G*) and MP4SDTQ/6-31G*//MP2/6-31G* + ZPE(MP2/6-31G*) approximations ab initio calculations of surfaces of potential energy of molecules of lithium salts of Li 2 AB 2 (Li 2 BeO 2 , L 2 MgO 2 , Li 2 BeS 2 , Li 2 MgS 2 , Li 2 CN 2 , Li 2 SiN 2 , Li 2 CP 2 ) type and ions of Li 2 AB 2 + (Li 2 BO 2 + , Li 2 AlO 2 + , Li 2 BS 2 + , Li 2 AlS 2 + , Li 2 N 3 + , Li 2 PN 2 + , Li 2 P 3 + ) type with 16 valent electrons are done. For oxide and nitride systems global minimum corresponds to symmetric linear structure D ∞h and for their sulfide and phosphorus analogues curved plane or unplane (C 2 ) structure with bond angle φ(LBA)=90-110 Deg are preferable. Equilibrium geometric parameters, relative energies and energies of isomer decomposition, frequencies and IR-intensities of normal vibrations are determined [ru
Synthesis of LiFePO4/Li2SiO3/reduced Graphene Oxide (rGO) Composite via Hydrothermal Method
Arifin, M.; Iskandar, F.; Aimon, A. H.; Munir, M. M.; Nuryadin, B. W.
2016-08-01
LiFePO4 is a type of cathode active material used for lithium ion batteries. It has a high electrochemical performance. However, it suffers from certain disadvantages such as a very low intrinsic electronic conductivity and low ionic diffusion. This study was conducted to increase the conductivity of LiFePO4. We have investigated the addition of Li2SiO3 and reduced graphene oxide (rGO) to LiFePO4. The objective of this research was to synthesize LiFePO4/Li2SiO3/rGO via hydrothermal method. Fourier transform infrared spectroscopy (FTIR) measurement showed that the peaks corresponded to the vibration of LiFePO4/Li2SiO3. Further, X-ray diffraction (XRD) measurement confirmed a single phase of LiFePO4. Finally, scanning electron microscopy (SEM) images showed that rGO was distributed on the LiFePO4/Li2SiO3 structure.
Synthesis of LiFePO4/Li2SiO3/reduced Graphene Oxide (rGO) Composite via Hydrothermal Method
International Nuclear Information System (INIS)
Arifin, M; Iskandar, F; Aimon, A H; Munir, M M; Nuryadin, B W
2016-01-01
LiFePO 4 is a type of cathode active material used for lithium ion batteries. It has a high electrochemical performance. However, it suffers from certain disadvantages such as a very low intrinsic electronic conductivity and low ionic diffusion. This study was conducted to increase the conductivity of LiFePO4. We have investigated the addition of Li2SiO3 and reduced graphene oxide (rGO) to LiFePO4. The objective of this research was to synthesize LiFePO 4 /Li 2 SiO 3 /rGO via hydrothermal method. Fourier transform infrared spectroscopy (FTIR) measurement showed that the peaks corresponded to the vibration of LiFePO 4 /Li 2 SiO 3 . Further, X-ray diffraction (XRD) measurement confirmed a single phase of LiFePO4. Finally, scanning electron microscopy (SEM) images showed that rGO was distributed on the LiFePO 4 /Li 2 SiO 3 structure. (paper)
Lepping, R. P.; Chao, J. K.
1976-01-01
An estimated shape is presented for the surface of the flare-associated interplanetary shock of February 15-16, 1967, as seen in the ecliptic-plane cross section. The estimate is based on observations by Explorer 33 and Pioneers 6 and 7. The estimated shock normal at the Explorer 33 position is obtained by a least-squares shock parameter-fitting procedure for that satellite's data; the shock normal at the Pioneer 7 position is found by using the magnetic coplanarity theorem and magnetic-field data. The average shock speed from the sun to each spacecraft is determined along with the local speed at Explorer 33 and the relations between these speeds and the position of the initiating solar flare. The Explorer 33 shock normal is found to be severely inclined and not typical of interplanetary shocks. It is shown that the curvature of the shock surface in the ecliptic plane near the earth-Pioneer 7 region is consistent with a radius of not more than 0.4 AU.
Pediatric Toxic Shock Syndrome
Directory of Open Access Journals (Sweden)
Jennifer Yee
2017-09-01
Full Text Available Audience: This scenario was developed to educate emergency medicine residents on the diagnosis and management of a pediatric patient with toxic shock syndrome. The case is also appropriate for teaching of medical students and advanced practice providers, as well as a review of the principles of crisis resource management, teamwork, and communication. Introduction: Toxic shock syndrome is a low-frequency, high-acuity scenario requiring timely identification and aggressive management. If patients suffering from this condition are managed incorrectly, they may progress into multi-organ dysfunction and potentially death. Toxic shock syndrome has been associated with Streptococcus and Staphylococcus aureus (Staph. Approximately half of Staph cases are associated with menstruation, which was first described in the 1970s-1980s and was associated with the use of absorbent tampons.1 Group A Streptococcus may cause complications such as necrotizing fasciitis and gangrenous myositis.2 Pediatric patients may present critically ill from toxic shock syndrome. Providers need to perform a thorough history and physical exam to discern the source of infection. Management requires aggressive care with antibiotics and IV fluids. Objectives: By the end of this simulation session, the learner will be able to: 1 Recognize toxic shock syndrome. 2 Review the importance of a thorough physical exam. 3 Discuss management of toxic shock syndrome, including supportive care and the difference in antibiotic choices for streptococcal and staphylococcal toxic shock syndrome. 4 Appropriately disposition a patient suffering from toxic shock syndrome. 5 Communicate effectively with team members and nursing staff during a resuscitation of a critically ill patient. Method: This session was conducted using high-fidelity simulation, followed by a debriefing session and lecture on toxic shock syndrome.
Selfsimilar time dependent shock structures
International Nuclear Information System (INIS)
Beck, R.; Drury, L.O.
1985-01-01
Diffusive shock acceleration as an astrophysical mechanism for accelerating charged particles has the advantage of being highly efficient. This means however that the theory is of necessity nonlinear; the reaction of the accelerated particles on the shock structure and the acceleration process must be self-consistently included in any attempt to develop a complete theory of diffusive shock acceleration. Considerable effort has been invested in attempting, at least partially, to do this and it has become clear that in general either the maximum particle energy must be restricted by introducing additional loss processes into the problem or the acceleration must be treated as a time dependent problem (Drury, 1984). It is concluded that stationary modified shock structures can only exist for strong shocks if additional loss processes limit the maximum energy a particle can attain. This is certainly possible and if it occurs the energy loss from the shock will lead to much greater shock compressions. It is however equally possible that no such processes exist and we must then ask what sort of nonstationary shock structure develops. The same argument which excludes stationary structures also rules out periodic solutions and indeed any solution where the width of the shock remains bounded. It follows that the width of the shock must increase secularly with time and it is natural to examine the possibility of selfsimilar time dependent solutions
Selfsimilar time dependent shock structures
Beck, R.; Drury, L. O.
1985-01-01
Diffusive shock acceleration as an astrophysical mechanism for accelerating charged particles has the advantage of being highly efficient. This means however that the theory is of necessity nonlinear; the reaction of the accelerated particles on the shock structure and the acceleration process must be self-consistently included in any attempt to develop a complete theory of diffusive shock acceleration. Considerable effort has been invested in attempting, at least partially, to do this and it has become clear that in general either the maximum particle energy must be restricted by introducing additional loss processes into the problem or the acceleration must be treated as a time dependent problem (Drury, 1984). It is concluded that stationary modified shock structures can only exist for strong shocks if additional loss processes limit the maximum energy a particle can attain. This is certainly possible and if it occurs the energy loss from the shock will lead to much greater shock compressions. It is however equally possible that no such processes exist and we must then ask what sort of nonstationary shock structure develops. The ame argument which excludes stationary structures also rules out periodic solutions and indeed any solution where the width of the shock remains bounded. It follows that the width of the shock must increase secularly with time and it is natural to examine the possibility of selfsimilar time dependent solutions.
The interstellar lithium abundance and the 7Li/6Li ratio
International Nuclear Information System (INIS)
Ferlet, R.; Dennefeld, M.
1985-01-01
The λ 6708 doublet of interstellar Li I has been observed at high spectral resolution (3.km s -1 ) and very good signal to noise ratio (∼ 4000) towards δ Sco and ζ Oph. Using a profile fitting method, we derive for the first time outside the solar system a 7 Li/ 6 Li ratio of 38 for a diffuse cloud in front of ζ Oph. Even the lower limit of the error bar is incompatible with the ratio measured in meteorites and is not explained by recent models of galactic evolution. The existence of a local inhomogeneity is suggested. Finally, as for other alkalis, lithium is depleted on to dust grains in the diffuse interstellar medium [fr
International Nuclear Information System (INIS)
Roth, Johannes
2002-01-01
Quasicrystals and ordinary crystals both possess long-range translational order. But quasicrystals are aperiodic since their symmetry is non-crystallographic. The aim of this project is to study the behavior of shock waves in periodic and aperiodic structures and to compare the results. The expectation is that new types of defects are generated in the aperiodic materials. The materials studied are two models of (AlCu)Li quasicrystals and the C15 Laves phase, a low-order approximant of the quasicrystals. An elastic wave is found in the simulations up to a piston velocity of about up < 0.25 cl. Between 0.5 < up/cl < 0.5 the slope of elastic wave velocity slows down, and a new plastic wave is observed. Extended defect are generated, but no simple two-dimensional walls. The defect bands have finite width and a disordered structure. If the crystal is quenched a polycrystalline phase is obtained. For the quasicrystal the transformation is more complex since ring processes occur in the elastic regime already. Starting at about up < 0.5 cl a single plastic shock wave is observed. In this range all structures are destroyed completely
Inferring Pre-shock Acoustic Field From Post-shock Pitot Pressure Measurement
Wang, Jian-Xun; Zhang, Chao; Duan, Lian; Xiao, Heng; Virginia Tech Team; Missouri Univ of Sci; Tech Team
2017-11-01
Linear interaction analysis (LIA) and iterative ensemble Kalman method are used to convert post-shock Pitot pressure fluctuations to static pressure fluctuations in front of the shock. The LIA is used as the forward model for the transfer function associated with a homogeneous field of acoustic waves passing through a nominally normal shock wave. The iterative ensemble Kalman method is then employed to infer the spectrum of upstream acoustic waves based on the post-shock Pitot pressure measured at a single point. Several test cases with synthetic and real measurement data are used to demonstrate the merits of the proposed inference scheme. The study provides the basis for measuring tunnel freestream noise with intrusive probes in noisy supersonic wind tunnels.
Energy Technology Data Exchange (ETDEWEB)
Skryleva, E.A., E-mail: easkryleva@gmail.com; Kubasov, I.V., E-mail: kubasov.ilya@gmail.com; Kiryukhantsev-Korneev, Ph.V., E-mail: kiruhancev-korneev@yandex.ru; Senatulin, B.R., E-mail: borisrs@yandex.ru; Zhukov, R.N., E-mail: rom_zhuk@mail.ru; Zakutailov, K.V., E-mail: zakkonst@gmail.com; Malinkovich, M.D., E-mail: malinkovich@yandex.ru; Parkhomenko, Yu.N., E-mail: parkh@rambler.ru
2016-12-15
Highlights: • XPS Li/Nb ratio measurement uncertainty in LNbO3 specimens was obtained. • The effect of polarization on surface chemistry was observed only on cleaves. • Li/Nb ratio on positive cleave surface is higher than on negative one. • The positive cleave surface adsorbs fluorine more efficiently than negative one. • Mechanical processing of crystals reduces surface Li/Nb. - Abstract: Different sections of congruent lithium niobate (CLN) crystals have been studied using X-ray photoelectron spectroscopy (XPS). We have developed a method for measuring the lithium-to-niobium atomic ratio Li/Nb from the ratio of the Li1s and Nb4s spectral integral intensities with an overall error of within 8 %. Polarity and mechanical processing affect the Li/Nb ratio on CLN crystal surfaces. The Li/Nb ratio is within the tolerance (0.946 ± 0.074) on the negative cleave surface Z, and there is excess lithium (Li/Nb = 1.25 ± 0.10) on the positive surface. The positive surfaces of the 128° Y cut plates after long exposure to air exhibit LiOH formation indications (obvious lithium excess, higher Li1s spectral binding energy and a wide additional peak in the O1s spectrum produced by nonstructural oxygen). XPS and glow discharge optical electron spectroscopy showed that mechanical processing of differently oriented crystals (X, Z and 128° Y) and different polarities dramatically reduces the Li/Nb ratio. In situ fluorine adsorption experiments revealed the following regularities: fluorine adsorption only occurred on crystal cleaves and was not observed for mechanically processed specimens. Positive cleave surfaces have substantially higher fluorine adsorption capacity compared to negative ones.
THE EFFECTS OF AREA CONTRACTION ON SHOCK WAVE STRENGTH AND PEAK PRESSURE IN SHOCK TUBE
Directory of Open Access Journals (Sweden)
A. M. Mohsen
2012-06-01
Full Text Available This paper presents an experimental investigation into the effects of area contraction on shock wave strength and peak pressure in a shock tube. The shock tube is an important component of the short duration, high speed fluid flow test facility, available at the Universiti Tenaga Nasional (UNITEN, Malaysia. The area contraction was facilitated by positioning a bush adjacent to the primary diaphragm section, which separates the driver and driven sections. Experimental measurements were performed with and without the presence of the bush, at various diaphragm pressure ratios, which is the ratio of air pressure between the driver (high pressure and driven (low pressure sections. The instantaneous static pressure variations were measured at two locations close to the driven tube end wall, using high sensitivity pressure sensors, which allow the shock wave strength, shock wave speed and peak pressure to be analysed. The results reveal that the area contraction significantly reduces the shock wave strength, shock wave speed and peak pressure. At a diaphragm pressure ratio of 10, the shock wave strength decreases by 18%, the peak pressure decreases by 30% and the shock wave speed decreases by 8%.
Effect of Heat Treatment on the Lithium Ion Conduction of the LiBH4–LiI Solid Solution
DEFF Research Database (Denmark)
Sveinbjörnsson, Dadi Þorsteinn; Mýrdal, Jón Steinar Garðarsson; Blanchard, Didier
2013-01-01
The LiBH4–LiI solid solution is a good Li+ conductor and a promising crystalline electrolyte for all-solid-state lithium based batteries. The focus of the present work is on the effect of heat treatment on the Li+ conduction. Solid solutions with a LiI content of 6.25–50% were synthesized by high...
Energy Technology Data Exchange (ETDEWEB)
Liu, James Chien-Chih [Univ. of California, Berkeley, CA (United States)
1993-01-01
The work presented here investigates the phenomenon of shock wave propagation in gas continuous, two-phase media. The motivation for this work stems from the need to understand blast venting consequences in the HYLIFE inertial confinement fusion (ICF) reactor. The HYLIFE concept utilizes lasers or heavy ion beams to rapidly heat and compress D-T targets injected into the center of a reactor chamber. A segmented blanket of failing molten lithium or Li2BeF4 (Flibe) jets encircles the reactors central cavity, shielding the reactor structure from radiation damage, absorbing the fusion energy, and breeding more tritium fuel.
Structure of intermediate shocks and slow shocks in a magnetized plasma with heat conduction
International Nuclear Information System (INIS)
Tsai, C.L.; Wu, B.H.; Lee, L.C.
2005-01-01
The structure of slow shocks and intermediate shocks in the presence of a heat conduction parallel to the local magnetic field is simulated from the set of magnetohydrodynamic equations. This study is an extension of an earlier work [C. L. Tsai, R. H. Tsai, B. H. Wu, and L. C. Lee, Phys. Plasmas 9, 1185 (2002)], in which the effects of heat conduction are examined for the case that the tangential magnetic fields on the two side of initial current sheet are exactly antiparallel (B y =0). For the B y =0 case, a pair of slow shocks is formed as the result of evolution of the initial current sheet, and each slow shock consists of two parts: the isothermal main shock and the foreshock. In the present paper, cases with B y ≠0 are also considered, in which the evolution process leads to the presence of an additional pair of time-dependent intermediate shocks (TDISs). Across the main shock of the slow shock, jumps in plasma density, velocity, and magnetic field are significant, but the temperature is continuous. The plasma density downstream of the main shock decreases with time, while the downstream temperature increases with time, keeping the downstream pressure constant. The foreshock is featured by a smooth temperature variation and is formed due to the heat flow from downstream to upstream region. In contrast to the earlier study, the foreshock is found to reach a steady state with a constant width in the slow shock frame. In cases with B y ≠0, the plasma density and pressure increase and the magnetic field decreases across TDIS. The TDIS initially can be embedded in the slow shock's foreshock structure, and then moves out of the foreshock region. With an increasing B y , the propagation speed of foreshock leading edge tends to decrease and the foreshock reaches its steady state at an earlier time. Both the pressure and temperature downstreams of the main shock decrease with increasing B y . The results can be applied to the shock heating in the solar corona and
Shi, Jianjian; Wang, Zhiguo; Qing Fu, Yong
2016-12-01
Coating LiMnPO4 with a thin layer of LiFePO4 shows a better electrochemical performance than the pure LiFePO4 and LiMnPO4, thus it is critical to understand Li diffusion at their interfaces to improve the performance of electrode materials. Li diffusion at the (1 0 0)\\text{LiFeP{{\\text{O}}4}} //(1 0 0)\\text{LiMnP{{\\text{O}}4}} , (0 1 0)\\text{LiFeP{{\\text{O}}4}} //(0 1 0)\\text{LiMnP{{\\text{O}}4}} , and (0 0 1)\\text{LiFeP{{\\text{O}}4}} //(0 0 1)\\text{LiMnP{{\\text{O}}4}} interfaces between LiFePO4 and LiMnPO4 was investigated using density functional theory. The calculated diffusion energy barriers are 0.55 eV for Li to diffuse along the (0 0 1) interface, 0.44 and 0.49 eV for the Li diffusion inside the LiMnPO4 and along the (1 0 0) interface, respectively. When Li diffuses from the LiFePO4 to LiMnPO4 by passing through the (0 1 0) interfaces, the diffusion barriers are 0.45 and 0.60 eV for the Li diffusions in both sides. The diffusion barriers for Li to diffuse in LiMnPO4 near the interfaces decrease compared with those in the pure LiMnPO4. The calculated diffusion coefficient of Li along the (1 0 0) interface is in the range of 3.65 × 10-11-5.28 × 10-12 cm2 s-1, which is larger than that in the pure LiMnPO4 with a value of 7.5 × 10-14 cm2 s-1. Therefore, the charging/discharging rate performance of the LiMnPO4 can be improved by surface coating with the LiFePO4.
Chen, Bingbing; Ju, Jiangwei; Ma, Jun; Zhang, Jianjun; Xiao, Ruijuan; Cui, Guanglei; Chen, Liquan
2017-11-29
Density functional theory simulations and experimental studies were performed to investigate the interfacial properties, including lithium ion migration kinetics, between lithium metal anode and solid electrolyte Li 10 GeP 2 S 12 (LGPS). The LGPS[001] plane was chosen as the studied surface because the easiest Li + migration pathway is along this direction. The electronic structure of the surface states indicated that the electrochemical stability was reduced at both the PS 4 - and GeS 4 -teminated surfaces. For the interface cases, the equilibrium interfacial structures of lithium metal against the PS 4 -terminated LGPS[001] surface (Li/PS 4 -LGPS) and the GeS 4 -terminated LGPS[001] surface (Li/GeS 4 -LGPS) were revealed based on the structural relaxation and adhesion energy analysis. Solid electrolyte interphases were expected to be formed at both Li/PS 4 -LGPS and Li/GeS 4 -LGPS interfaces, resulting in an unstable state of interface and large interfacial resistance, which was verified by the EIS results of the Li/LGPS/Li cell. In addition, the simulations of the migration kinetics show that the energy barriers for Li + crossing the Li/GeS 4 -LGPS interface were relatively low compared with the Li/PS 4 -LGPS interface. This may contribute to the formation of Ge-rich phases at the Li/LGPS interface, which can tune the interfacial structures to improve the ionic conductivity for future all-solid-state batteries. This work will offer a thorough understanding of the Li/LGPS interface, including local structures, electronic states and Li + diffusion behaviors in all-solid-state batteries.
Mérawa, M.; Dargelos, A.
1998-07-01
The present paper gives an account of investigations of the polarizability of the alkali atoms Li, Na, diatomics homonuclear and heteronuclear Li2, Na2 and NaLi at SCF (Self Consistent Field) level of approximation and at correlated level, using a time Time-Dependent Gauge Invariant method (TDGI). Our static polarizability values agree with the best experimental and theoretical determinations. The Van der Waals C6 coefficients for the atom-atom, atom-dimer and dimer-dimer interactions have been evaluated. Les polarisabilités des atomes alcalins Li, Na, et des molécules diatomiques homonucléaires et hétéronucléaire Li2, Na2 et NaLi, ont été calculées au niveau SCF (Self Consistent Field) et au niveau corrélé à partir d'une méthode invariante de jauge dépendante du temps(TDGI). Nos valeurs des polarisabilités statiques sont en accord avec les meilleurs déterminations expérimentales et théoriques. Les coefficients C6 de Van de Waals pour les interactions atome-atome, atome-dimère et dimère-dimère ont également été évalués.
Relaxation-phenomena in LiAl/FeS-cells
Borger, W.; Kappus, W.; Panesar, H. S.
A theoretical model of the capacity of strongly relaxing electrochemical systems is applied to the LiAl/FeS system. Relaxation phenomena in LiAl and FeS electrodes can be described by this model. Experimental relaxation data indicate that lithium transport through the alpha-LiAl layer to the particle surface is the capacity limiting process at high discharge current density in the LiAl electrode in LiCl-KCl and LiF-LiCl-LiBr mixtures. Strong relaxation is observed in the FeS electrode with LiCl-KCl electrolyte caused by lithium concentration gradients and precipitation of KCl in the pores.
International Nuclear Information System (INIS)
Niu, K.
1996-01-01
A shock wave is a discontinuous surface that connects supersonic flow with subsonic flow. After a shock wave, flow velocity is reduced, and pressure and temperature increase; entropy especially increases across a shock wave. Therefore, flow is in nonequilibrium, and irreversible processes occur inside the shock layer. The thickness of a shock wave in neutral gas is of the order of the mean free path of the fluid particle. A shock wave also appears in magnetized plasma. Provided that when the plasma flow is parallel to the magnetic field, a shock wave appears if the governing equation for velocity potential is in hyperbolic type in relation with the Mach number and the Alfven number. When the flow is perpendicular to the magnetic field, the Maxwell stress, in addition to the pressure, plays a role in the shock wave in plasma. When the plasma temperature is so high, as the plasma becomes collision-free, another type of shock wave appears. In a collision-free shock wave, gyromotions of electrons around the magnetic field lines cause the shock formation instead of collisions in a collision-dominant plasma or neutral gas. Regardless of a collision-dominant or collision-free shock wave, the fluid that passes through the shock wave is heated in addition to being compressed. In inertial confinement fusion, the fuel must be compressed. Really, implosion motion performs fuel compression. A shock wave, appearing in the process of implosion, compresses the fuel. The shock wave, however, heats the fuel more intensively, and it makes it difficult to compress the fuel further because high temperatures invite high pressure. Adiabatic compression of the fuel is the desired result during the implosion, without the formation of a shock wave. (Author)
Energy Technology Data Exchange (ETDEWEB)
Chen, S
1984-01-01
The Khekou basin of the second order which is located in the Eastern part of the Tsziyan basin in the oil and gas Bokhayvan'skiy pool has an area of about 900 km/sup 2/. The main productive level occurs in sandstone beds in the Sha-3 subseries (reaching thickness of about 400 m) of the Shakhetsze series. The Bonan oil field was discovered in this region in 1975. The initially productive deposits were viewed as fluvial-delta; however, studies of recent years, including investigation of the sedimentation sequences and the structures that mark the surfaces of the microscopic level in the core sample, together with an analysis of borehole geophysical data, indicated that the sandy bodies of the productive beds in the basin must be viewed as deposits of turbidite flows and deposits of gravitational flows in channels. Insofar as distribution of the turbidite sandstones differs significantly from the delta, this led to a review of the long-term trends in the neighboring fields.
Shock therapy: Gris Gun's shock absorber can take the punch
Energy Technology Data Exchange (ETDEWEB)
Anon.
2000-04-01
A newly developed shock impedance tool that isolates downhole tools that measure the effects of well stimulation techniques from being damaged by the violent shaking caused by various well stimulation techniques which combine perforating and propellant technology in a single tool, is discussed. The shock exerted by a perforating gun can exceed 25,000 G forces within 100 to 300 milliseconds, may damage or even destroy the sensitive electronics housed in the various recorders that record data about fracture gradients, permeability and temperature. The shock absorber developed by Tesco Gris Gun and Computalog, incorporates the mechanics of a piston style shock absorber in combination with a progressive spring stack and energy-dampening silicone oil chambers. The end results is an EUE 'slim line' assembly that is adaptable between the gun perforating string and the electronic equipment. It is typically attached below, reducing the shock load by as much as 90 per cent. The shock absorber is now available commercially through Gris Gun's exclusive distributorship. An improved version, currently under development, will be used for wireline perforating and tubing-conveyed perforating applications. 2 figs.
Charge carrier density in Li-intercalated graphene
Kaloni, Thaneshwor P.
2012-05-01
The electronic structures of bulk C 6Li, Li-intercalated free-standing bilayer graphene, and Li-intercalated bilayer and trilayer graphene on SiC(0 0 0 1) are studied using density functional theory. Our estimate of Young\\'s modulus suggests that Li-intercalation increases the intrinsic stiffness. For decreasing Li-C interaction, the Dirac point shifts to the Fermi level and the associated band splitting vanishes. For Li-intercalated bilayer graphene on SiC(0 0 0 1) the splitting at the Dirac point is tiny. It is also very small at the two Dirac points of Li-intercalated trilayer graphene on SiC(0 0 0 1). For all the systems under study, a large enhancement of the charge carrier density is achieved by Li intercalation. © 2012 Elsevier B.V. All rights reserved.
Initial ISEE magnetometer results: shock observation
International Nuclear Information System (INIS)
Russell, C.T.
1979-01-01
ISEE-1 and -2 magnetic field profiles across 6 terrestrial bow shock and one interplanetary shock are examined. The inteplanetary shock illustrates the behavior of a low Mach number shock. Three examples of low or moderate β, high Mach number, quasi-perpendicular shocks are examined. These did not have upstream waves, but rather had waves growing in the field gradient. Two examples of high β shocks showed little coherence in field variation even though the two vehicles were only a few hundred kilometers apart. The authors present the joint behavior of wave, particle and field data across some of these shocks to show some of the myriad of shock features whose behavior they are now beginning to investigate. (Auth.)
Probing the failure mechanism of nanoscale LiFePO4 for Li-ion batteries
International Nuclear Information System (INIS)
Gu, Meng; Yan, Pengfei; Wang, Chongmin; Shi, Wei; Zheng, Jianming; Zhang, Ji-guang
2015-01-01
LiFePO 4 is a high power rate cathode material for lithium ion battery and shows remarkable capacity retention, featuring a 91% capacity retention after 3300 cycles. In this work, we use high-resolution transmission electron microscopy and electron energy loss spectroscopy to study the gradual capacity fading mechanism of LiFePO 4 materials. We found that upon prolonged electrochemical cycling of the battery, the LiFePO 4 cathode shows surface amorphization and loss of oxygen species, which directly contribute to the gradual capacity fading of the battery. The finding can guide the design and improvement of LiFePO 4 cathode for high-energy and high-power rechargeable battery for electric transportation
International Nuclear Information System (INIS)
Ross, M.; Rogers, F.J.
1985-01-01
Hypernetted-chain equation calculations have been made for the ion-ion pair distribution functions in shock-melted CsI, CsBr, KBr, KCl, NaCl, and LiF. The results show that the melt undergoes a gradual pressure-induced structural change from an open NaCl-like structure with six nearest neighbors of opposite charge to one that has a rare-gas close-packed-like arrangement containing about 12 neighbors of mixed charge. These effects are most pronounced for the larger ions in which the short-range repulsions are stronger relative to long-range Coulomb attractions
2009 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Lewis County, Washington
National Oceanic and Atmospheric Administration, Department of Commerce — Watershed Sciences, Inc. (WSI) collected Light Detection and Ranging (LiDAR) data for the Lewis County survey area for the Puget Sound LiDAR Consortium. This data...
Analytical solutions of hypersonic type IV shock - shock interactions
Frame, Michael John
An analytical model has been developed to predict the effects of a type IV shock interaction at high Mach numbers. This interaction occurs when an impinging oblique shock wave intersects the most normal portion of a detached bow shock. The flowfield which develops is complicated and contains an embedded jet of supersonic flow, which may be unsteady. The jet impinges on the blunt body surface causing very high pressure and heating loads. Understanding this type of interaction is vital to the designers of cowl lips and leading edges on air- breathing hypersonic vehicles. This analytical model represents the first known attempt at predicting the geometry of the interaction explicitly, without knowing beforehand the jet dimensions, including the length of the transmitted shock where the jet originates. The model uses a hyperbolic equation for the bow shock and by matching mass continuity, flow directions and pressure throughout the flowfield, a prediction of the interaction geometry can be derived. The model has been shown to agree well with the flowfield patterns and properties of experiments and CFD, but the prediction for where the peak pressure is located, and its value, can be significantly in error due to a lack of sophistication in the model of the jet fluid stagnation region. Therefore it is recommended that this region of the flowfield be modeled in more detail and more accurate experimental and CFD measurements be used for validation. However, the analytical model has been shown to be a fast and economic prediction tool, suitable for preliminary design, or for understanding the interactions effects, including the basic physics of the interaction, such as the jet unsteadiness. The model has been used to examine a wide parametric space of possible interactions, including different Mach number, impinging shock strength and location, and cylinder radius. It has also been used to examine the interaction on power-law shaped blunt bodies, a possible candidate for
International Nuclear Information System (INIS)
Vrillon, Bernard.
1973-01-01
The mechanical shock absorber described is made of a constant thickness plate pierced with circular holes regularly distributed in such a manner that for all the directions along which the strain is applied during the shock, the same section of the substance forming the plate is achieved. The shock absorber is made in a metal standing up to extensive deformation before breaking, selected from a group comprising mild steels and austenitic stainless steels. This apparatus is used for handling pots of fast neutron reactor fuel elements [fr
Evaluation of Li3N accumulation in a fused LiCl/Li salt matrix
International Nuclear Information System (INIS)
Eberle, C. S.
1998-01-01
Pyrochemical conditioning of spent nuclear fuel for the purpose of final disposal is currently being demonstrated at Argonne National Laboratory (ANL), and ongoing research in this area includes the demonstration of this process on spent oxide fuel. In conjunction with this research a pilot scale of the preprocessing stage is being designed by ANL-W to demonstrate the in situ hot cell capability of the chemical reduction stage. An impurity evaluation was completed for a Li/LiCl salt matrix in the presence of spent LWR uranium oxide fuel. A simple analysis was performed in which the sources of impurities in the salt matrix were only from the cell atmosphere. Only reactions with the lithium were considered. The levels of impurities were shown to be highly sensitive system conditions. A predominance diagram for the Li-O-N system was constructed for the device, and the general oxidation, nitridation and combined reactions were calculated as a function of oxygen and nitrogen partial pressure. These calculations and hotcell atmosphere data were used to determine the total number and type of impurities expected in the salt matrix and the mass rate for the device was determined
Protons scattering on Li isotopes at intermediate energies
International Nuclear Information System (INIS)
Zhusupov, M.A.; Imambekov, O.; Sanfirova, A.V.; Ibraeva, E.T.
2003-01-01
The protons scattering differential cross section on the 6,7,8 Li nuclei are calculated within the framework the Glauber-Sitenko multiple scattering theory at intermediate energies (from 100 to 1000 MeV). In the calculations the multi-cluster wave functions (αt for 7 Li, αnp for 6 Li, and αtn for 8 Li) considering within potential cluster model have been used. Differential cross sections for 6 Li, 7 Li, 8 Li and 9 Li nuclei are similar: absolute cross sections are almost the same, diffraction minimum for large A shifting to the field of the least scattering angles that reflecting increase of the material radius. For the 11 Li the differential cross section absolute value is smaller about in two time than for the rest isotopes. At present it is reliably established, that the 11 Li nucleus has an exotic structure - the nine-nucleon core ( 9 Li) around which the two-neutron halo is rotating. The principal characteristics of the Li nuclei are presented in tabular form
Effects of Alfvénic Drift on Diffusive Shock Acceleration at Weak Cluster Shocks
Kang, Hyesung; Ryu, Dongsu
2018-03-01
Non-detection of γ-ray emission from galaxy clusters has challenged diffusive shock acceleration (DSA) of cosmic-ray (CR) protons at weak collisionless shocks that are expected to form in the intracluster medium. As an effort to address this problem, we here explore possible roles of Alfvén waves self-excited via resonant streaming instability during the CR acceleration at parallel shocks. The mean drift of Alfvén waves may either increase or decrease the scattering center compression ratio, depending on the postshock cross-helicity, leading to either flatter or steeper CR spectra. We first examine such effects at planar shocks, based on the transport of Alfvén waves in the small amplitude limit. For the shock parameters relevant to cluster shocks, Alfvénic drift flattens the CR spectrum slightly, resulting in a small increase of the CR acceleration efficiency, η. We then consider two additional, physically motivated cases: (1) postshock waves are isotropized via MHD and plasma processes across the shock transition, and (2) postshock waves contain only forward waves propagating along with the flow due to a possible gradient of CR pressure behind the shock. In these cases, Alfvénic drift could reduce η by as much as a factor of five for weak cluster shocks. For the canonical parameters adopted here, we suggest η ∼ 10‑4–10‑2 for shocks with sonic Mach number M s ≈ 2–3. The possible reduction of η may help ease the tension between non-detection of γ-rays from galaxy clusters and DSA predictions.
The Heliospheric Termination Shock
Jokipii, J. R.
2013-06-01
The heliospheric termination shock is a vast, spheroidal shock wave marking the transition from the supersonic solar wind to the slower flow in the heliosheath, in response to the pressure of the interstellar medium. It is one of the most-important boundaries in the outer heliosphere. It affects energetic particles strongly and for this reason is a significant factor in the effects of the Sun on Galactic cosmic rays. This paper summarizes the general properties and overall large-scale structure and motions of the termination shock. Observations over the past several years, both in situ and remote, have dramatically revised our understanding of the shock. The consensus now is that the shock is quite blunt, is with the front, blunt side canted at an angle to the flow direction of the local interstellar plasma relative to the Sun, and is dynamical and turbulent. Much of this new understanding has come from remote observations of energetic charged particles interacting with the shock, radio waves and radiation backscattered from interstellar neutral atoms. The observations and the implications are discussed.
Arifin, M.; Rus, Y. B.; Aimon, A. H.; Iskandar, F.; Winata, T.; Abdullah, M.; Khairurrijal, K.
2017-03-01
LiFePO4 is commonly used as cathode material for Li-ion batteries due to its stable operational voltage and high specific capacity. However, it suffers from certain disadvantages such as low intrinsic electronic conductivity and low ionic diffusion. This study was conducted to analyse the effect of reduced graphene oxide (rGO) on the electrochemical properties of LiFePO4/Li2SiO3 composite. This composite was synthesized by a hydrothermal method. Fourier transform infrared spectroscopy measurement identified the O-P-O, Fe-O, P-O, and O-Si-O- bands in the LiFePO4/Li2SiO3 composite. X-ray diffraction measurement confirmed the formation of LiFePO4. Meanwhile, Raman spectroscopy confirmed the number of rGO layers. Further, scanning electron microscopy images showed that rGO was distributed around the LiFePO4/Li2SiO3 particles. Finally, the electrochemical impedance spectroscopy results showed that the addition of 1 wt% of rGO to the LiFePO4/Li2SiO3 composite reduced charge transfer resistance. It may be concluded that the addition of 1 wt% rGO to LiFePO4/Li2SiO3 composite can enhance its electrochemical performance as a cathode material.
Improved Dehydrogenation Properties of 2LiNH2-MgH2 by Doping with Li3AlH6
Directory of Open Access Journals (Sweden)
Shujun Qiu
2017-01-01
Full Text Available Doping with additives in a Li-Mg-N-H system has been regarded as one of the most effective methods of improving hydrogen storage properties. In this paper, we prepared Li3AlH6 and evaluated its effect on the dehydrogenation properties of 2LiNH2-MgH2. Our studies show that doping with Li3AlH6 could effectively lower the dehydrogenation temperatures and increase the hydrogen content of 2LiNH2-MgH2. For example, 2LiNH2-MgH2-0.1Li3AlH6 can desorb 6.43 wt % of hydrogen upon heating to 300 °C, with the onset dehydrogenation temperature at 78 °C. Isothermal dehydrogenation testing indicated that 2LiNH2-MgH2-0.1Li3AlH6 had superior dehydrogenation kinetics at low temperature. Moreover, the release of byproduct NH3 was successfully suppressed. Measurement of the thermal diffusivity suggests that the enhanced dehydrogenation properties may be ascribed to the fact that doping with Li3AlH6 could improve the heat transfer for solid–solid reaction.
International Nuclear Information System (INIS)
Wang, Ning; Zhao, Naiqin; Shi, Chunsheng; Liu, Enzuo; He, Chunnian; He, Fang; Ma, Liying
2017-01-01
Graphical abstract: A facile method is proposed to prepare lithium sulfide@porous carbon composites (Li 2 S@PC) by in-situ reaction of lithium sulfate (Li 2 SO 4 ) and the pyrolytic carbon from glucose. We assembled graphite-Li 2 S@PC full-cells using the obtained Li 2 S@PC composites as the cathode, graphite as the anode and DOL/DME with LiNO 3 additive as the electrolyte. Display Omitted -- Highlights: •A simple synthesis method was proposed to form Li 2 S@porous carbon composites. •Graphite-Li 2 S full-cells were constructed in DME-based electrolyte. •A novel method was proposed to activate the full cells. -- Abstract: Lithium-sulfur (Li-S) batteries have been recognized as one of the promising next-generation energy storage devices owing to their high energy density, low cost and eco-friendliness. As for cathode’s performance, the main challenges for developing highly-efficient and long-life Li-S batteries are to retard the polysulfides diffusion into electrolyte and the reaction with metallic lithium (Li). Especially, the safety issues, derived from metallic Li in anode, must be overcome. Herein, we fabricated lithium sulfide@porous carbon composites (Li 2 S@PC) by an in-situ reaction between the lithium sulfate (Li 2 SO 4 ) and the pyrolytic carbon from glucose. The nanosized Li 2 S particles were uniformly distributed in the carbon matrix, which not only significantly improve electronic conductivity of the electrode but also effectively trap the dissolved polysulfides. Furthermore, on the basis of the graphite’s electrochemical features in ether-based electrolyte, we assembled graphite-Li 2 S@PC full cells using the obtained Li 2 S@PC composites as the cathode, graphite as the anode and the DOL/DME with LiNO 3 additive as the electrolyte. A unique strategy was proposed to activate the full-cells in descending order using constant voltage and current to charge the cut-off voltage. This Li-S full cell exhibits stable cycling performance at 0.5 C over
Charge carrier density in Li-intercalated graphene
Kaloni, Thaneshwor P.; Cheng, Yingchun; Kahaly, M. Upadhyay; Schwingenschlö gl, Udo
2012-01-01
The electronic structures of bulk C 6Li, Li-intercalated free-standing bilayer graphene, and Li-intercalated bilayer and trilayer graphene on SiC(0 0 0 1) are studied using density functional theory. Our estimate of Young's modulus suggests that Li
Energy Technology Data Exchange (ETDEWEB)
Jeong, Eunkyung; Hong, Chan; Tak, Yongsug [Department of Chemical Engineering, Inha University, Inchon 402-751 (Korea, Republic of); Nam, Sang Cheol [Nuricell Inc., Jungrang-Ku, Seoul 131-220 (Korea, Republic of); Cho, Sungbaek [Agency for Defense Development, P.O. Box 35, Daejeon (Korea, Republic of)
2006-09-13
All solid-state thin film battery was prepared with conventional sputtering technologies. Low conductivity of lithium phosphorus oxynitride (LiPON) electrolyte and higher resistance at the interface of LiCoO{sub 2}/LiPON was crucial for the development of thin film battery. Presence of thermally treated Al{sub 2}O{sub 3} thin film at the interface of LiCoO{sub 2}/LiPON decreased the interfacial resistance and increased the discharge capacity with the better cycling behaviors. Surface analysis and electrochemical impedance measurement indicate the formation of solid solution LiCo{sub 1-y}Al{sub y}O{sub 2} at the interface of LiCoO{sub 2}/LiPON. (author)
Energy Technology Data Exchange (ETDEWEB)
Kolb, M.H.H., E-mail: Matthias.kolb@kit.edu [Karlsruhe Institute of Technology, Institute for Applied Materials, PO Box 3640, 76021, Karlsruhe (Germany); Knitter, R. [Karlsruhe Institute of Technology, Institute for Applied Materials, PO Box 3640, 76021, Karlsruhe (Germany); Hoshino, T. [Breeding Functional Materials Development Group, Department of Blanket Systems Research, Rokkasho Fusion Institute, Fusion Energy Research and Development Directorate, National Institutes for Quantum and Radiological Science and Technology (QST) (Japan)
2017-02-15
Highlights: • The mechanical strength of Li{sub 4}SiO{sub 4}-based breeder pebbles can be improved by adding either LMT, LAO or LLTO as second phase. • The increase in strength is closely linked to a reduction of the open porosity of the pebbles. • All fabricated pebbles show a highly homogenous microstructure with mostly low closed porosity. • Adding LLTO, although it decomposes during sintering, greatly improves the strength of the pebbles. - Abstract: The pebble properties of novel two-phase Li{sub 4}SiO{sub 4} pebbles of 1 mm diameter with additions of Li{sub 2}TiO{sub 3}, LiAlO{sub 2} or Li{sub x}La{sub y}TiO{sub 3} are evaluated in this work as a function of the second phase concentration and the microstructure of the pebbles. The characterization focused on the mechanical strength, microstructure and open as well as closed porosity. Therefore crush load tests, SEM analyses as well as helium pycnometry and optical image analysis were performed, respectively. This work shows that generally additions of a second phase to Li{sub 4}SiO{sub 4} considerably improve the mechanical strength. It also shows that the fabrication processes have to be well-controlled to achieve high mechanical strengths. When Li{sub 2}TiO{sub 3} is added in different concentrations, the determinant for the crush load seems to be the open porosity of the pebbles. The strengthening effect of LiAlO{sub 2} compared to Li{sub 2}TiO{sub 3} is similar, while additions of Li{sub x}La{sub y}TiO{sub 3} increase the mechanical strength much more. Yet, Li{sub 4}SiO{sub 4} and Li{sub x}La{sub y}TiO{sub 3} react with each other to a number of different phases upon sintering. In general the pebble properties of all samples are favorable for use within a fusion breeder blanket.
Capturing and Processing Soil GHG Fluxes Using the LI-COR LI-8100A
Xu, Liukang; McDermitt, Dayle; Hupp, Jason; Johnson, Mark; Madsen, Rod
2015-04-01
The LI-COR LI-8100A Automated Soil CO2 Flux System is designed to measure soil CO2 efflux using automated chambers and a non-steady state measurement protocol. While CO2 is an important gas in many contexts, it is not the only gas of interest for many research applications. With some simple plumbing modifications, many third party analyzers capable of measuring other trace gases, e.g. N2O, CH4, or 13CO2 etc., can be interfaced with the LI-8100A System, and LI-COR's data processing software (SoilFluxPro™) can be used to compute fluxes for these additional gases. In this paper we describe considerations for selecting an appropriate third party analyzer to interface with the system, how to integrate data into the system, and the procedure used to compute fluxes of additional gases in SoilFluxPro™. A case study is presented to demonstrate methane flux measurements using an Ultra-Portable Greenhouse Gas Analyzer (Ultra-Portable GGA, model 915-0011), manufactured by Los Gatos Research and integrated into the LI-8100A System. Laboratory and field test results show that the soil CO2 efflux based on the time series of CO2 data measured either with the LI-8100A System or with the Ultra-Portable GGA are essentially the same. This suggests that soil GHG fluxes measured with both systems are reliable.
Microstructure Analysis of Synthesized LiBOB
Directory of Open Access Journals (Sweden)
Etty Marti Wigayati
2015-11-01
Full Text Available Lithium bis (oxalate borate or LiBOB is an active material used as the electrolyte for lithium battery application. LiBOB (LiB(C2O42 powder was prepared from LiOH, H2C2O4 and H3BO3. The employed method was solid state reaction. LiBOB powder produced from the reaction was then observed using SEM and TEM. Surface area was analyzed using Quantachrome Nova 4200e. From the analysis analyzed using XRD to identify the resulting phases, crystal structure, and crystallite size. The functional groups were analyzed using FT-IR. The particle morphology was result, it was seen that the resulted phases were C4LiBO8 and LiB(C2O42.H2O, the crystal structure was orthorhombic with space group Pbca and Pnma. From the particle morphology observation it was shown that micro pores were created irregularly. When the observation was deepened, nanopores with elongated round shape were seen within the micropores. The pore size was approximately 50–100 nm. The surface area, total pore volume, and average pore diameter of LiBOB powder was 88.556 m2/g, 0.4252 cm3/g, and 19.2 nm respectively.
Kim, Ji Young; Kim, A-Young; Liu, Guicheng; Woo, Jae-Young; Kim, Hansung; Lee, Joong Kee
2018-03-14
An amorphous SiO 2 (a-SiO 2 ) thin film was developed as an artificial passivation layer to stabilize Li metal anodes during electrochemical reactions. The thin film was prepared using an electron cyclotron resonance-chemical vapor deposition apparatus. The obtained passivation layer has a hierarchical structure, which is composed of lithium silicide, lithiated silicon oxide, and a-SiO 2 . The thickness of the a-SiO 2 passivation layer could be varied by changing the processing time, whereas that of the lithium silicide and lithiated silicon oxide layers was almost constant. During cycling, the surface of the a-SiO 2 passivation layer is converted into lithium silicate (Li 4 SiO 4 ), and the portion of Li 4 SiO 4 depends on the thickness of a-SiO 2 . A minimum overpotential of 21.7 mV was observed at the Li metal electrode at a current density of 3 mA cm -2 with flat voltage profiles, when an a-SiO 2 passivation layer of 92.5 nm was used. The Li metal with this optimized thin passivation layer also showed the lowest charge-transfer resistance (3.948 Ω cm) and the highest Li ion diffusivity (7.06 × 10 -14 cm 2 s -1 ) after cycling in a Li-S battery. The existence of the Li 4 SiO 4 artificial passivation layer prevents the corrosion of Li metal by suppressing Li dendritic growth and improving the ionic conductivity, which contribute to the low charge-transfer resistance and high Li ion diffusivity of the electrode.
International Nuclear Information System (INIS)
Jadhav, Harsharaj S.; Kalubarme, Ramchandra S.; Jadhav, Arvind H.; Seo, Jeong Gil
2016-01-01
Highlights: • LiPON thin film deposited by RF-sputtering technique. • The effect of deposition temperature on ionic conductivity was investigated. • The LiPON/B-LAGP composite was successfully employed in Li-O 2 battery. • LiPON interlayer enhances stability of B-LAGP in contact with Li-metal. - Abstract: Lithium ion conducting membranes are barely studied, although they are essentially indispensable for building Li-air batteries composed of aqueous and non-aqueous electrolytes for long-term operation. Lithium phosphorous oxynitride (LiPON) thin films were deposited by RF-sputtering technique on B 2 O 3 -added lithium aluminum germanium phosphate (B-LAGP). Compact thin amorphous LiPON layer could act as a protective interlayer for B-LAGP by separating it from Li metal electrode and mitigate the reaction between them. Large electrochemical stability window (0–5 V) of LiPON/B-LAGP solid electrolyte shows promising feasibility for applications in all lithium based batteries. The aprotic Li-O 2 cell with protected lithium electrode configuration employing LiPON/B-LAGP solid electrolyte has exhibited reasonable cycling stability with long-life of 52 cycles at a limited capacity of 1000 mA h g −1 .
Probing the failure mechanism of nanoscale LiFePO₄ for Li-ion batteries
Energy Technology Data Exchange (ETDEWEB)
Gu, Meng [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Shi, Wei [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Energy and Environmental Directorate; Beijing Jiaotong University (China). School of Electrical Engineering, National Active Distribution Network Technology Research Center; Zheng, Jianming [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Energy and Environmental Directorate; Yan, Pengfei [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Zhang, Ji-guang [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Energy and Environmental Directorate; Wang, Chongmin [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL)
2015-05-18
LiFePO4 is a high power rate cathode material for lithium ion battery and shows remarkable capacity retention, featuring a 91% capacity retention after 3300 cycles. In this work, we use high-resolution transmission electron microscopy (HRTEM), energy dispersive x-ray spectroscopy (EDS), and electron energy loss spectroscopy (EELS) to study the gradual capacity fading mechanism of LiFePO4 materials. We found that upon prolonged electrochemical cycling of the battery, the LiFePO4 cathode shows surface amorphization and loss of oxygen species, which directly contribute to the gradual capacity fading of the battery. The finding is of great importance for the design and improvement of new LiFePO4 cathode for high-energy and high-power rechargeable battery for electric transportation.
Lestariningsih, Titik; Wigayati, Etty Marty; Sabrina, Qolby; Prihandoko, Bambang; Priyono, Slamet
2018-04-01
Development of the synthesis of LiB(C2O4)2 compounds continues to evolve along with the need for electrolyte salts to support the research of the manufacture of lithium ion batteries. A study had been conducted on the effect of Li2CO3 substitution on the synthesis of LiB(C2O4)2 or LiBOB compounds. LiBOB was a major candidate to replace LiPF6 as a highly toxic lithium battery electrolyte and harmful to human health. Synthesis of Lithium bis(oxalato) borate used powder metallurgy method. The raw materials used are H2C2O4.2H2O, Li2CO3 or LiOH and H2BO3 from Merck Germany products. The materials are mixed with 2: 1: 1 mol ratio until homogeneous. The synthesis of LiBOB refers to previous research, where the heating process was done gradually. The first stage heating is carried out at 120°C for 4 hours, then the next stage heating is carried out at 240°C for 7 hours. The sample variation in this study was to distinguish the lithium source from Li2CO3 and LiOH. Characterization was done by XRD to know the phase formed, FTIR to confirm that functional group of LiB(C2O4)2 compound, SEM to know the morphological structure, and TG/DTA to know the thermal properties. The results of the analysis shows that LiBOB synthesis using Lithium source from Li2CO3 has succeeded to form LiBOB compound with more LiBOB phase composition is 59.1% and 40.9% LiBOB hydrate phase, SEM morphology shows powder consist of elongated round particle porous and similar to LiBOB commercial and show higher thermal stability.
Directory of Open Access Journals (Sweden)
Phung Khanh Lam
Full Text Available To identify risk factors and develop a prediction model for the development of profound and recurrent shock amongst children presenting with dengue shock syndrome (DSS.We analyzed data from a prospective cohort of children with DSS recruited at the Paediatric Intensive Care Unit of the Hospital for Tropical Disease in Ho Chi Minh City, Vietnam. The primary endpoint was "profound DSS", defined as ≥2 recurrent shock episodes (for subjects presenting in compensated shock, or ≥1 recurrent shock episodes (for subjects presenting initially with decompensated/hypotensive shock, and/or requirement for inotropic support. Recurrent shock was evaluated as a secondary endpoint. Risk factors were pre-defined clinical and laboratory variables collected at the time of presentation with shock. Prognostic model development was based on logistic regression and compared to several alternative approaches.The analysis population included 1207 children of whom 222 (18% progressed to "profound DSS" and 433 (36% had recurrent shock. Independent risk factors for both endpoints included younger age, earlier presentation, higher pulse rate, higher temperature, higher haematocrit and, for females, worse hemodynamic status at presentation. The final prognostic model for "profound DSS" showed acceptable discrimination (AUC=0.69 for internal validation and calibration and is presented as a simple score-chart.Several risk factors for development of profound or recurrent shock among children presenting with DSS were identified. The score-chart derived from the prognostic models should improve triage and management of children presenting with DSS in dengue-endemic areas.
Bubble Dynamics and Shock Waves
2013-01-01
This volume of the Shock Wave Science and Technology Reference Library is concerned with the interplay between bubble dynamics and shock waves. It is divided into four parts containing twelve chapters written by eminent scientists. Topics discussed include shock wave emission by laser generated bubbles (W Lauterborn, A Vogel), pulsating bubbles near boundaries (DM Leppinen, QX Wang, JR Blake), interaction of shock waves with bubble clouds (CD Ohl, SW Ohl), shock propagation in polydispersed bubbly liquids by model equations (K Ando, T Colonius, CE Brennen. T Yano, T Kanagawa, M Watanabe, S Fujikawa) and by DNS (G Tryggvason, S Dabiri), shocks in cavitating flows (NA Adams, SJ Schmidt, CF Delale, GH Schnerr, S Pasinlioglu) together with applications involving encapsulated bubble dynamics in imaging (AA Doinikov, A Novell, JM Escoffre, A Bouakaz), shock wave lithotripsy (P Zhong), sterilization of ships’ ballast water (A Abe, H Mimura) and bubbly flow model of volcano eruptions ((VK Kedrinskii, K Takayama...
Gómez, Leopoldo R.; Turner, Ari M.; van Hecke, Martin; Vitelli, Vincenzo
2012-02-01
Nonlinear sound is an extreme phenomenon typically observed in solids after violent explosions. But granular media are different. Right when they jam, these fragile and disordered solids exhibit a vanishing rigidity and sound speed, so that even tiny mechanical perturbations form supersonic shocks. Here, we perform simulations in which two-dimensional jammed granular packings are dynamically compressed and demonstrate that the elementary excitations are strongly nonlinear shocks, rather than ordinary phonons. We capture the full dependence of the shock speed on pressure and impact intensity by a surprisingly simple analytical model.
Energy Technology Data Exchange (ETDEWEB)
Chandra, B.P.; Parganiha, S.; Sonwane, V.D. [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, Chhattisgarh (India); Chandra, V.K. [Department of Electrical and Electronics Engineering, Chhatrapati Shivaji Institute of Technology, Shivaji Nagar, Kolihapuri, Durg 491001, Chhattisgarh (India); Jha, Piyush, E-mail: piyushjha22@rediffmail.com [Department of Applied Physics, Raipur Institute of Technology, Chhatauna, Mandir Hasuad, Raipur 492101, Chhattisgarh (India); Baghel, R.N. [School of Studies in Physics and Astrophysics, Pt. Ravishankar Shukla University, Raipur 492010, Chhattisgarh (India)
2016-10-15
The impact of a projectile propelled to velocities in the range of 0.5–2.5 km/s on to a target (X-cut quartz crystal) produces shock waves travelling at velocity of nearly 10 km/s in target, in which intense mechanoluminescence (ML) pulses of microsecond duration are produced, both in compression and post-compression conditions. The piezoelectric field produced due to surface charges of fractured target, causes band bending and subsequently, the free charge carriers are generated in the respective bands and the emission of ML occurs. The ML appears after a delay time t{sub th} whose value decreases with increasing value of the shock pressure. Initially, the ML intensity increases with the shock pressure because of the creation of more surfaces; however, for higher values of the shock pressure, the ML intensity tends to attain a saturation value because of the hardening of the crystals due to the creation of small crystallites in which the creation of new surfaces becomes difficult. The ratio between peak ML intensity in the uncompressed region and the maximum ML intensity in the compressed region decreases with increasing shock pressure because more defects produced at high pressure generate higher barrier for the relaxation of blocked cracks under compression. The expressions derived for characteristics of shock-induced ML are able to explain satisfactorily the experimental results. Shock-wave velocity, shock pressure, transit time, lifetime of electrons in conduction band, etc. can be determined by the shock-induced ML.As such, the shock-induced ML provides a new optical technique for the studies of materials under shock pressure.
Ding, Mingquan; Jiang, Yurong; Cao, Yuefen; Lin, Lifeng; He, Shae; Zhou, Wei; Rong, Junkang
2014-02-10
Ligon lintless-1 (Li1) is a monogenic dominant mutant of Gossypium hirsutum (upland cotton) with a phenotype of impaired vegetative growth and short lint fibers. Despite years of research involving genetic mapping and gene expression profile analysis of Li1 mutant ovule tissues, the gene remains uncloned and the underlying pathway of cotton fiber elongation is still unclear. In this study, we report the whole genome-level deep-sequencing analysis of leaf tissues of the Li1 mutant. Differentially expressed genes in leaf tissues of mutant versus wild-type (WT) plants are identified, and the underlying pathways and potential genes that control leaf and fiber development are inferred. The results show that transcription factors AS2, YABBY5, and KANDI-like are significantly differentially expressed in mutant tissues compared with WT ones. Interestingly, several fiber development-related genes are found in the downregulated gene list of the mutant leaf transcriptome. These genes include heat shock protein family, cytoskeleton arrangement, cell wall synthesis, energy, H2O2 metabolism-related genes, and WRKY transcription factors. This finding suggests that the genes are involved in leaf morphology determination and fiber elongation. The expression data are also compared with the previously published microarray data of Li1 ovule tissues. Comparative analysis of the ovule transcriptomes of Li1 and WT reveals that a number of pathways important for fiber elongation are enriched in the downregulated gene list at different fiber development stages (0, 6, 9, 12, 15, 18dpa). Differentially expressed genes identified in both leaf and fiber samples are aligned with cotton whole genome sequences and combined with the genetic fine mapping results to identify a list of candidate genes for Li1. Copyright © 2013 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Kolb, M.H.H., E-mail: Matthias.kolb@kit.edu [Karlsruhe Institute of Technology, Institute for Applied Materials, PO Box 3640, 76021 Karlsruhe (Germany); Mukai, K.; Knitter, R. [Karlsruhe Institute of Technology, Institute for Applied Materials, PO Box 3640, 76021 Karlsruhe (Germany); Hoshino, T. [Breeding Functional Materials Development Group, Department of Blanket Systems Research, Rokkasho Fusion Institute, Fusion Energy Research and Development Directorate, National Institutes for Quantum and Radiological Science and Technology (QST) (Japan)
2017-02-15
Highlights: • This study shows that the emulsion method can easily be adapted to add different phases into Li4SiO4 breeder pebbles. • Slurries with various compositions to form LOS + LMT, LOS + LAO and LOS + LLTO were processed.The calculated activation behavior shows that samples with added LAO or LLTO qualify as low activation material. • Yet, the long-term activation of the LAO containing samples is problematic as hands-on level activity is not reached quickly. - Abstract: Wet-chemical fabrication processes are highly adaptable to a wide range of raw materials and are therefore well suited for evaluating new material compositions. Here the established emulsion method was modified to fabricate novel two-phase Li{sub 4}SiO{sub 4} pebbles of 1 mm diameter with additions of Li{sub 2}TiO{sub 3}, LiAlO{sub 2} or Li{sub x}La{sub y}TiO{sub 3}. As the lithium density of the latter two compounds is relatively low, only moderate contents were added. The Li{sub 2}TiO{sub 3} additions, however, cover the full compositional range. The fabrication process was characterized with regard to its constancy and aptness for the anticipated pebble compositions by optical pebble size measurements. Also the phase content and the elemental composition of the fabricated pebbles were analyzed by XRD and ICP-OES combined with XRF, respectively. This work shows that the emulsion method is an appropriate method to produce pebbles with the anticipated Li{sub 2}TiO{sub 3} and LiAlO{sub 2} concentrations in a Li{sub 4}SiO{sub 4} matrix. However, Li{sub 4}SiO{sub 4} and Li{sub x}La{sub y}TiO{sub 3} react with each other to a number of different phases. To evaluate the activation properties of the pebbles, FISPACT calculations with a DEMO relevant neutron source are applied as well. The addition of aluminum seems to be unfavorable for a fusion application, but moderate concentrations of lanthanum can be tolerated.
Li{sub 2}MnSiO{sub 4} as a potential Li-battery cathode material
Energy Technology Data Exchange (ETDEWEB)
Dominko, R.; Bele, M.; Gaberscek, M.; Jamnik, J. [National Institute of Chemistry, P.O.B. 660, SI-1001 Ljubljana (Slovenia); Kokalj, A. [Institute Jozef Stefan, Jamova 39, SI-1000 Ljubljana (Slovenia)
2007-12-06
Recently we synthesized and preliminary characterized a new material for potential use in Li-battery cathodes: Li{sub 2}MnSiO{sub 4}. Although its theoretical capacity is about 330 mAh g{sup -1}, the actual measurements showed a much smaller value (about 120 mAh g{sup -1}). One of the reasons for the poor performance could be the poor electronic conductivity (<10{sup -14} S cm{sup -1} at RT) causing a huge polarization during charge-discharge. However, in the present paper we show that reducing the particle size down to the range of 20-50 nm and additional particle embedment into a carbon phase does not significantly improve the electrochemistry of Li{sub 2}MnSiO{sub 4}. Observations of structural changes during the first charge shows a complete loss of peaks when reaching the nominal composition of ca. Li{sub 1}MnSiO{sub 4}. The peaks are not recovered during subsequent cycling. It is supposed that extraction of Li causes significant structural changes so that the resulting material is only able to reversibly exchange a limited amount of Li. (author)
Prediction of massive bleeding. Shock index and modified shock index.
Terceros-Almanza, L J; García-Fuentes, C; Bermejo-Aznárez, S; Prieto-Del Portillo, I J; Mudarra-Reche, C; Sáez-de la Fuente, I; Chico-Fernández, M
2017-12-01
To determine the predictive value of the Shock Index and Modified Shock Index in patients with massive bleeding due to severe trauma. Retrospective cohort. Severe trauma patient's initial attention at the intensive care unit of a tertiary hospital. Patients older than 14 years that were admitted to the hospital with severe trauma (Injury Severity Score >15) form January 2014 to December 2015. We studied the sensitivity (Se), specificity (Sp), positive and negative predictive value (PV+ and PV-), positive and negative likelihood ratio (LR+ and LR-), ROC curves (Receiver Operating Characteristics) and the area under the same (AUROC) for prediction of massive hemorrhage. 287 patients were included, 76.31% (219) were male, mean age was 43,36 (±17.71) years and ISS was 26 (interquartile range [IQR]: 21-34). The overall frequency of massive bleeding was 8.71% (25). For Shock Index: AUROC was 0.89 (95% confidence intervals [CI] 0.84 to 0.94), with an optimal cutoff at 1.11, Se was 91.3% (95% CI: 73.2 to 97.58) and Sp was 79.69% (95% CI: 74.34 to 84.16). For the Modified Shock Index: AUROC was 0.90 (95% CI: 0.86 to 0.95), with an optimal cutoff at 1.46, Se was 95.65% (95% CI: 79.01 to 99.23) and Sp was 75.78% (95% CI: 70.18 to 80.62). Shock Index and Modified Shock Index are good predictors of massive bleeding and could be easily incorporated to the initial workup of patients with severe trauma. Copyright © 2017 Elsevier España, S.L.U. y SEMICYUC. All rights reserved.
International Nuclear Information System (INIS)
Le Roux, J. A.; Webb, G. M.
2012-01-01
Some of the most sophisticated models for solar energetic particle (SEP) acceleration at coronal mass ejection driven shocks are based on standard diffusive shock acceleration theory. However, this theory, which only applies when SEP pitch-angle anisotropies are small, might have difficulty in describing first-order Fermi acceleration or the shock pre-heating and injection of SEPs into first-order Fermi acceleration accurately at lower SEP speeds where SEP pitch-angle anisotropies upstream near the shock can be large. To avoid this problem, we use a time-dependent focused transport model to reinvestigate first-order Fermi acceleration at planar parallel and quasi-parallel spherical traveling shocks between the Sun and Earth with high shock speeds associated with rare extreme gradual SEP events. The focused transport model is also used to investigate and compare three different shock pre-heating mechanisms associated with different aspects of the nonuniform cross-shock solar wind flow, namely, the convergence of the flow (adiabatic compression), the shear tensor of the flow, and the acceleration of the flow, and a fourth shock pre-heating mechanism associated with the cross-shock electric field, to determine which pre-heating mechanism contributes the most to injecting shock pre-heated source particles into the first-order Fermi acceleration process. The effects of variations in traveling shock conditions, such as increasing shock obliquity and shock slowdown, and variations in the SEP source with increasing shock distance from the Sun on the coupled processes of shock pre-heating, injection, and first-order Fermi acceleration are analyzed. Besides the finding that the cross-shock acceleration of the solar wind flow yields the dominant shock pre-heating mechanism at high shock speeds, we find that first-order Fermi acceleration at fast traveling shocks differs in a number of respects from the predictions and assumptions of standard steady-state diffusive shock
30th International Symposium on Shock Waves
Sadot, Oren; Igra, Ozer
2017-01-01
These proceedings collect the papers presented at the 30th International Symposium on Shock Waves (ISSW30), which was held in Tel-Aviv Israel from July 19 to July 24, 2015. The Symposium was organized by Ortra Ltd. The ISSW30 focused on the state of knowledge of the following areas: Nozzle Flow, Supersonic and Hypersonic Flows with Shocks, Supersonic Jets, Chemical Kinetics, Chemical Reacting Flows, Detonation, Combustion, Ignition, Shock Wave Reflection and Interaction, Shock Wave Interaction with Obstacles, Shock Wave Interaction with Porous Media, Shock Wave Interaction with Granular Media, Shock Wave Interaction with Dusty Media, Plasma, Magnetohyrdrodynamics, Re-entry to Earth Atmosphere, Shock Waves in Rarefied Gases, Shock Waves in Condensed Matter (Solids and Liquids), Shock Waves in Dense Gases, Shock Wave Focusing, Richtmyer-Meshkov Instability, Shock Boundary Layer Interaction, Multiphase Flow, Blast Waves, Facilities, Flow Visualization, and Numerical Methods. The two volumes serve as a reference ...
Advanced and Exploratory Shock Sensing Mechanisms.
Energy Technology Data Exchange (ETDEWEB)
Nelsen, Nicholas H. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kolb, James D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Kulkarni, Akshay G. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Sorscher, Zachary [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Habing, Clayton D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Mathis, Allen [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Beller, Zachary J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2017-09-01
Mechanical component response to shock environments must be predictable in order to ensure reliability and safety. Whether the shock input results from accidental drops during transportation to projectile impact scenarios, the system must irreversibly transition into a safe state that is incapable of triggering the component . With this critical need in mind, the 2017 Nuclear Weapons Summer Product Realization Institute (NW SPRINT) program objective sought the design of a passive shock failsafe with emphasis on additively manufactured (AM) components. Team Advanced and Exploratory (A&E) responded to the challenge by designing and delivering multiple passive shock sensing mech anisms that activate within a prescribed mechanical shock threshold. These AM failsafe designs were tuned and validated using analytical and computational techniques including the shock response spectrum (SRS) and finite element analysis (FEA). After rapid prototyping, the devices experienced physical shock tests conducted on Sandia drop tables to experimentally verify performance. Keywords: Additive manufacturing, dynamic system, failsafe, finite element analysis, mechanical shock, NW SPRINT, shock respon se spectrum
Neutron flux measurement with 6Li and 7Li dual glass scintillators by γ compensation method
International Nuclear Information System (INIS)
Ji Changsong; Zhang Shulan; Zhang Shuheng
1996-01-01
Based on the characteristics of 6 Li glass scintillator which is sensitive to both neutron and gamma rays, and 7 Li glass scintillator which is sensitive to gamma rays only, a new method of detecting weak neutron flux under interference of strong gamma radiation has been investigated by means of 6 Li- 7 Li pair glass scintillator gamma compensation method. The result of neutron flux measurement by above-mentioned method with an error of about 1% when the gamma ray interference is up to 18.7% has been obtained
Neutron flux measurement with 6Li and 7Li dual glass scintillators by γ compensation method
International Nuclear Information System (INIS)
Ji Changsong; Zhang Shulan; Zhang Shuheng
1998-01-01
Based on the characteristics of 6 Li glass scintillator which is sensitive to both neutron and gamma rays, and 7 Li glass scintillator which is sensitive to gamma rays only, a new method of detecting weak neutron flux under interference of strong gamma radiation has been investigated by mans of 6 Li- 7 Li dual glass scintillator gamma compensation method. The result of neutron flux measurement by above-mentioned method with an error of about 1% when the gamma ray interference is up to 18.7% has been obtained
DEFF Research Database (Denmark)
Hansen, P. E.; Johansson, Torben; Nevald, Rolf
1975-01-01
Single crystals of LiErF4 and LiHoF4 have been grown and their magnetic properties measured from 1.3 K to 300 K. LiHoF4 turned out to be a nearly ideal Ising ferromagnet with TC=1.30±0.05 K and a saturation magnetization along the crystalline c axis of (6.98±0.02)μB. In LiErF4 no ordering...... was observed, but extrapolation indicates that below 0.5 K it will be ferromagnetic with the magnetic moments in the crytalline ab plane. From the susceptibilities the crystal-field parameters Bnm with (n, m)=(2, 0), (4, 0), (4, 4), (6, 0), (6, 4) have been extracted giving for Er3+ in LiErF4: 430., -985......., 1185., -5., 740.+i135. (cm-1) and for Ho3+ in LiHoF4: 470., -825., 1050., -10., 760.+i150 (cm-1). The exchange constants were found to be small compared to the dipole interactions. Furthermore the 7Li NMR spectra have been obtained in these materials as well as in LiTbF4 thereby determining the second...
Li-adsorption on doped Mo2C monolayer: A novel electrode material for Li-ion batteries
Mehta, Veenu; Tankeshwar, K.; Saini, Hardev S.
2018-04-01
A first principle calculation has been used to study the electronic and magnetic properties of pristine and N/Mn-doped Mo2C with and without Li-adsorption. The pseudopotential method implemented in SIESTA code based on density functional theory with generalized gradient approximation (GGA) as exchange-correlation (XC) potential has been employed. Our calculated results revealed that the Li gets favorably adsorbed on the hexagonal centre in pristine Mo2C and at the top of C-atom in case of N/Mn-doped Mo2C. The doping of Mn and N atom increases the adsorption of Li in Mo2C monolayer which may results in enhancement of storage capacity in Li-ion batteries. The metallic nature of Li-adsorbed pristine and N/Mn-doped Mo2C monolayer implies a good electronic conduction which is crucial for anode materials for its applications in rechargeable batteries. Also, the open circuit voltage for single Li-adsorption in doped Mo2C monolayer comes in the range of 0.4-1.0 eV which is the optimal range for any material to be used as an anode material. Our result emphasized the enhanced performance of doped Mo2C as an anode material in Li-ion batteries.
Electrochemical Investigations of the Interface at Li/Li+ Ion Conducting Channel
2006-10-04
range of applications.1 Presently, these molecules are of particular interest in non-linear optics, as liquid crystals, as Langmuir - Blodgett films, for...cathode material in non-aqueous liquid electrolyte medium Since Li2Pc is a mixed ionic and electronic conductor, and some metal phthalocyanines are...14. ABSTRACT Dilithium phthalocyanine (Li2Pc) possesses mixed electronic- ionic conductivity due to overlap of - orbitals (electronic
The MHD intermediate shock interaction with an intermediate wave: Are intermediate shocks physical?
International Nuclear Information System (INIS)
Wu, C.C.
1988-01-01
Contrary to the usual belief that MHD intermediate shocks are extraneous, the authors have recently shown by numerical solutions of dissipative MHD equations that intermediate shocks are admissible and can be formed through nonlinear steepening from a continuous wave. In this paper, he clarifies the differences between the conventional view and the results by studying the interaction of an MHD intermediate shock with an intermediate wave. The study reaffirms his results. In addition, the study shows that there exists a larger class of shocklike solutions in the time-dependent dissiaptive MHD equations than are given by the MHD Rankine-Hugoniot relations. it also suggests a mechanism for forming rotational discontinuities through the interaction of an intermediate shock with an intermediate wave. The results are of importance not only to the MHD shock theory but also to studies such as magnetic field reconnection models
Meini, Stefano; Elazari, Ran; Rosenman, Ariel; Garsuch, Arnd; Aurbach, Doron
2014-03-06
The development of Li2S electrodes is a crucial step toward industrial manufacturing of Li-S batteries, a promising alternative to Li-ion batteries due to their projected two times higher specific capacity. However, the high voltages needed to activate Li2S electrodes, and the consequent electrolyte solution degradation, represent the main challenge. We present a novel concept that could make feasible the widespread application of Li2S electrodes for Li-S cell assembly. In this concept, the addition of redox mediators as additives to the standard electrolyte solution allows us to recover most of Li2S theoretical capacity in the activation cycle at potentials as low as 2.9 VLi, substantially lower than the typical potentials >4 VLi needed with standard electrolyte solution. Those novel additives permit us to preserve the electrolyte solution from being degraded, allowing us to achieve capacity as high as 500 mAhg(-1)Li2S after 150 cycles with no major structural optimization of the electrodes.
Performance of LiAlloy/Ag(2)CrO(4) Couples in Molten CsBr-LiBr-KBr Eutectic
International Nuclear Information System (INIS)
GUIDOTTI, RONALD A.; REINHARDT, FREDERICK W.
1999-01-01
The performance of Li-alloy/CsBr-LiBr-KBr/Ag(sub 2)CrO(sub 4) systems was studied over a temperature range of 250 C to 300 C, for possible use as a power source for geothermal borehole applications. Single cells were discharged at current densities of 15.8 and 32.6 mA/cm(sup 2) using Li-Si and Li-Al anodes. When tested in 5-cell batteries, the Li-Si/CsBr-LiBr-KBr/Ag(sub 2)CrO(sub 4) system exhibited thermal runaway. Thermal analytical tests showed that the Ag(sub 2)CrO(sub 4) cathode reacted exothermically with the electrolyte on activation. Consequently, this system would not be practical for the envisioned geothermal borehole applications
A study on the electrolytic reduction of uranium oxide in a LiCl-Li2O molten salt
International Nuclear Information System (INIS)
Su, J. S.; Hu, J. M.; Hong, S. S.; Jang, D. S.; Park, S. W.
2003-01-01
New electrolytic reduction technology was proposed that is based on the integration of metallization of uranium oxide and Li 2 O electrowinning. In this electrolytic reduction reaction, electrolytically reduced Li deposits on cathode and simultaneously reacts with uranium oxides to produce uranium metal showing more than 99% conversion. For the verification of process feasibility, the experiments to obtain basic data on the metallization of uranium oxide, investigation of reaction mechanism, the characteristics of closed recycle of Li 2 O and mass transfer were carried out. This evolutionary electrolytic reduction technology would give benefits over the conventional Li-reduction process improving economic viability such as: avoidance of handling of chemically active Li-LiCl molten salt, increase of metallization yield, and simplification of process
International Nuclear Information System (INIS)
Mosymow, E.; Glaum, R.; Kremer, R.K.
2014-01-01
The two new phosphates LiCr II 4 (PO 4 ) 3 and Li 5 Cr II 2 Cr III (PO 4 ) 4 are discovered as equilibrium phases (ϑ=800 °C) in the quarternary system Li/Cr/P/O. Their crystal structures have been determined from single-crystal X-ray diffraction data (LiCr II 4 (PO 4 ) 3 : violet-blue, Pnma (no. 62), Z=4, a=6.175(1) Å, b=14.316(3) Å, c=10.277(2) Å, 100 parameters, R 1 =0.028, wR 2 =0.08, 2060 unique reflections with F o >4σ(F o ); Li 5 Cr II 2 Cr III (PO 4 ) 4 : greyish-green, P1 ¯ (no. 2), Z=1, a=4.9379(7) Å, b=7.917(2) Å, c=8.426(2) Å, α=109.98(2)°, β=90.71(1)°, γ=104.91(1)°, 131 parameters, R 1 =0.022, wR 2 =0.067, 1594 unique reflections with F o >4σ(F o )). Li 5 Cr II 2 Cr III (PO 4 ) 4 adopts an hitherto unknown structure type. The crystal structure of LiCr II 4 (PO 4 ) 3 is isotypic to that of NaCd II 4 (PO 4 ) 3 and related to that of the mineral silicocarnotite Ca 5 (PO 4 ) 2 (SiO 4 ). Significant disorder between Li + and Cr 2+ is observed for both crystal structures. The oxidation states assigned to chromium in these two phosphates are in agreement with UV/vis/NIR absorption spectra and magnetic susceptibility data recorded for both compounds. Instead of “LiCr II PO 4 ” mixtures of LiCr II 4 (PO 4 ) 3 , Li 5 Cr II 2 Cr III (PO 4 ) 4 , Cr 2 O 3 , and CrP are observed at equilibrium. Instead of “Li 2 Cr II P 2 O 7 ” four-phase mixtures consisting of Li 9 Cr III 3 (P 2 O 7 ) 3 (PO 4 ) 2 , Li 3 Cr III 2 (PO 4 ) 3 , LiCrP 2 O 7 , and CrP were obtained. - Graphical abstract: Investigations on the equilibrium relations in the system Li/Cr/P/O revealed the two hitherto unknown phosphates Li 5 Cr II 2 Cr III (PO 4 ) 4 and LiCr II 4 (PO 4 ) 3 . They form instead of “LiCr II PO 4 ”. The crystal structures, magnetic behavior and optical spectra of these phosphates are reported. - Highlights: • The two new phosphates Li 5 Cr II 2 Cr III (PO 4 ) 4 and LiCr II 4 (PO 4 ) 3 have been characterized. • Optical spectra and paramagnetism of
The Septic Shock 3.0 Definition and Trials: A Vasopressin and Septic Shock Trial Experience.
Russell, James A; Lee, Terry; Singer, Joel; Boyd, John H; Walley, Keith R
2017-06-01
The Septic Shock 3.0 definition could alter treatment comparisons in randomized controlled trials in septic shock. Our first hypothesis was that the vasopressin versus norepinephrine comparison and 28-day mortality of patients with Septic Shock 3.0 definition (lactate > 2 mmol/L) differ from vasopressin versus norepinephrine and mortality in Vasopressin and Septic Shock Trial. Our second hypothesis was that there are differences in plasma cytokine levels in Vasopressin and Septic Shock Trial for lactate less than or equal to 2 versus greater than 2 mmol/L. Retrospective analysis of randomized controlled trial. Multicenter ICUs. We compared vasopressin-to-norepinephrine group 28- and 90-day mortality in Vasopressin and Septic Shock Trial in lactate subgroups. We measured 39 cytokines to compare patients with lactate less than or equal to 2 versus greater than 2 mmol/L. Patients with septic shock with lactate greater than 2 mmol/L or less than or equal to 2 mmol/L, randomized to vasopressin or norepinephrine. Concealed vasopressin (0.03 U/min.) or norepinephrine infusions. The Septic Shock 3.0 definition would have decreased sample size by about half. The 28- and 90-day mortality rates were 10-12 % higher than the original Vasopressin and Septic Shock Trial mortality. There was a significantly (p = 0.028) lower mortality with vasopressin versus norepinephrine in lactate less than or equal to 2 mmol/L but no difference between treatment groups in lactate greater than 2 mmol/L. Nearly all cytokine levels were significantly higher in patients with lactate greater than 2 versus less than or equal to 2 mmol/L. The Septic Shock 3.0 definition decreased sample size by half and increased 28-day mortality rates by about 10%. Vasopressin lowered mortality versus norepinephrine if lactate was less than or equal to 2 mmol/L. Patients had higher plasma cytokines in lactate greater than 2 versus less than or equal to 2 mmol/L, a brisker cytokine response to infection. The Septic
Motion of shocks through interplanetary streams
International Nuclear Information System (INIS)
Burlaga, L.F.; Scudder, J.D.
1975-01-01
A model for the motion of flare-generated shocks through interplanetary streams is presented, illustrating the effects of a stream-shock interaction on the shock strength and geometry. It is a gas dynamic calculation based on Whitham's method and on an empirical approximation for the relevant characteristics of streams. The results show that the Mach number of a shock can decrease appreciably to near unity in the interaction region ahead of streams and that the interaction of a spherically symmetric shock with a spiral-shaped corotating stream can cause significant distortions of the initial shock front geometry. The geometry of the February 15--16, 1967, shock discussed by Lepping and Chao (1972) is qualitatively explained by this model
Ionic conductivity and Raman spectra of Na--Li, K--Li, and K--Sn β-Al2O3
International Nuclear Information System (INIS)
Kaneda, T.; Bates, J.B.; Wang, J.C.; Engstrom, H.
1979-01-01
The ionic conductivity and Raman spectra of Na, Na--Li, K, K--Li, and K--Sn β-Al 2 O 3 were measured in order to understand the mechanisms of mixed-ion conduction. It was observed that at 300 0 K, for example, the conductivity of a crystal with composition Na 0 . 82 Li 0 . 18 β-Al 2 O 3 was about one-fifth that of pure Na cyrstals, while the conductivity of K 0 . 80 Li 0 . 20 β-Al 2 O 3 was more than three orders of magnitude lower than that of pure K compounds. The results of a model calculation indicated that the Li + ions are the main carrier species in the Na--Li and K--Li mixed compounds. Features observed in the Raman spectra were attributed to paired- and single-ion vibrations. It is concluded that the K + ions which contribute to a band at 69 cm -1 in K β-Al 2 O 3 are the effective carriers for conduction
Sha, Jian; Liu, Min; Wang, Dong; Swaney, Dennis P; Wang, Yuqiu
2013-07-30
Models and related analytical methods are critical tools for use in modern watershed management. A modeling approach for quantifying the source apportionment of dissolved nitrogen (DN) and associated tools for examining the sensitivity and uncertainty of the model estimates were assessed for the Sha He River (SHR) watershed in China. The Regional Nutrient Management model (ReNuMa) was used to infer the primary sources of DN in the SHR watershed. This model is based on the Generalized Watershed Loading Functions (GWLF) and the Net Anthropogenic Nutrient Input (NANI) framework, modified to improve the characterization of subsurface hydrology and septic system loads. Hydrochemical processes of the SHR watershed, including streamflow, DN load fluxes, and corresponding DN concentration responses, were simulated following calibrations against observations of streamflow and DN fluxes. Uncertainty analyses were conducted with a Monte Carlo analysis to vary model parameters for assessing the associated variations in model outputs. The model performed accurately at the watershed scale and provided estimates of monthly streamflows and nutrient loads as well as DN source apportionments. The simulations identified the dominant contribution of agricultural land use and significant monthly variations. These results provide valuable support for science-based watershed management decisions and indicate the utility of ReNuMa for such applications. Copyright © 2013 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Zhao Mingshu; Zheng Qingyang; Wang Fei; Dai Weimin; Song Xiaoping
2011-01-01
Research highlights: → In this paper, the electrochemical performance of aqueous rechargeable lithium battery with LiV 3 O 8 and LiMn 2 O 4 in saturated LiNO 3 electrolyte is studied. → The electrochemical performance tests show that the specific capacity of LiMn 2 O 4 using as the cathode of ARLB is similar to that of ordinary lithium-ion battery with organic electrolyte, which works much better than the formerly reported. → In addition, the cell systems exhibit good cycling performance. Therefore, it has great potential comparing with other batteries such as lead acid batteries and alkaline manganese batteries. - Abstract: The electrochemical performance of aqueous rechargeable lithium battery (ARLB) with LiV 3 O 8 and LiMn 2 O 4 in saturated LiNO 3 electrolyte is studied. The results indicate that these two electrode materials are stable in the aqueous solution and no hydrogen or oxygen produced, moreover, intercalation/de-intercalation of lithium ions occurred within the range of electrochemical stability of water. The electrochemical performance tests show that the specific capacity of LiMn 2 O 4 using as the cathode of ARLB is similar to that of ordinary lithium-ion battery with organic electrolyte, which works much better than the formerly reported. In addition, the cell systems exhibit good cycling performance. Therefore, it has great potential comparing with other batteries such as lead acid batteries and alkaline manganese batteries.
The sup 8 Li(n,. gamma. ) sup 9 Li reaction and primordial nucleosynthesis
Energy Technology Data Exchange (ETDEWEB)
Mao, Z Q; Champagne, A E [Princeton Univ., NJ (USA). Dept. of Physics
1991-01-01
Shell-model calculations, using both p-shell and spd-shell interactions, have been used to predict the spectroscopic properties of low-lying states in {sup 9}Li. From this information, we have obtained new estimates for the rate of the {sup 8}Li(n,{gamma}){sup 9}Li reaction, which may act to limit the production of heavy elements during an inhomogeneous big bang. The two calculations produce reaction rates which differ by about a factor of 2 at the temperatures of interest, demonstrating the uncertainties in this approach. However, the spd calculation appears to be the more reliable of the two. (orig.).
International Nuclear Information System (INIS)
Nishikawa, K.; Fukunaka, Y.; Sakka, T.; Ogata, Y.H.; Selman, J.R.
2007-01-01
Li metal was galvanostatically electrodeposited on a horizontally positioned, downward-facing Li metal cathode in 0.5 M LiClO 4 -PC electrolyte. The refractive index profile corresponding to the transient Li + ion concentration profile formed in the electrolyte solution upon applying a current step was measured in-situ by holographic interferometry. The configuration of the electrolytic cell was such that mass transfer was governed only by transient diffusion and migration, in the absence of convection. Between the moment of closing the current circuit and the time at which the interference fringes started to shift, an incubation period was observed. Such an incubation period had earlier been observed in lithium electrodeposition at a vertical planar Li metal cathode. The incubation period for the horizontal Li cathode was roughly half that for a vertical one. To study the effect of the electrode material on the incubation period, interferometry measurements were also made at an electrodeposited Ni-Sn alloy electrode. The concentration profile formed near the Ni-Sn alloy electrode during lithiation (alloying or intercalation of Li + into the electrode) agrees well with predictions made by means of the one-dimensional diffusion equation. Only very short incubation period was detected, but the magnitude was negligibly smaller than that of Li metal electrodeposition. The incubation period therefore appears to be characteristic for Li metal electrode only
Ngene, Peter; Verkuijlen, Margriet H. W.; Barre, Charlotte; Kentgens, Arno P. M.; de Jongh, Petra E.
Intercalation and de-intercalation of lithium into graphene layers is a well-established phenomenon in Li-ion battery technology. Here we show how this phenomenon can be exploited to destabilize, and alter the hydrogen sorption behaviour of Li-based metal hydrides (LiBH4 and LiAlH4), thereby
Grain destruction in interstellar shocks
International Nuclear Information System (INIS)
Seab, C.G.; Shull, J.M.
1984-01-01
One of the principal methods for removing grains from the Interstellar Medium is to destroy them in shock waves. Previous theoretical studies of shock destruction have generally assumed only a single size and type of grain; most do not account for the effect of the grain destruction on the structure of the shock. Earlier calculations have been improved in three ways: first, by using a ''complete'' grain model including a distribution of sizes and types of grains; second, by using a self-consistent shock structure that incorporates the changing elemental depletions as the grains are destroyed; and third, by calculating the shock-processed ultraviolet extinction curves for comparison with observations. (author)
Using 13X, LiX, and LiPdAgX zeolites for CO_2 capture from post-combustion flue gas
International Nuclear Information System (INIS)
Chen, S.J.; Zhu, M.; Fu, Y.; Huang, Y.X.; Tao, Z.C.; Li, W.L.
2017-01-01
Highlights: • We synthesized a novel adsorbent named LiPdAgX zeolite. • CCS was proposed from microstructure, selectivity and separation factor of zeolite. • The static and flowing adsorption using CO_2/N_2 mixture on X zeolites were studied. • LiPdAgX zeolite required less energy for regeneration compared to 13X and MEA. • LiPdAgX zeolite can effectively capture CO_2 from post-combustion flue gas. - Abstract: This work investigates the application of X zeolites for capturing CO_2 from post-combustion flue gas. LiX and LiPdAgX zeolites were prepared by an ion-exchange method using 13X zeolite. X-ray diffraction analysis showed that all samples exhibited characteristic peaks of X zeolites, where the peak intensities increased in the order: LiPdAgX > LiX > 13X. The enhanced intensity of the diffraction peaks can increase the activity of the X zeolites and improve their adsorption performance. Scanning electron microscopy imaging showed that the intergranular pore canals of LiPdAgX zeolite were more concentrated. Pore structure analysis indicated that addition of Li"+ to the 13X zeolite enhanced the specific surface areas and pore volumes of the zeolites. Among the 13X, LiX, and LiPdAgX zeolites, LiPdAgX showed the highest CO_2/N_2selectivity, where the difference in the CO_2 adsorption capacity was due to differences in the number of adsorption sites and thermal conductivities of the X zeolites. The CO_2 breakthrough time increased in succession for the 13X, LiX, and LiPdAgX zeolites. The CO_2/N_2 separation factor of the LiPdAgX zeolite was twice that of the 13X zeolite at a CO_2 concentration of 20 vol.%. The temperature variations during the adsorption process were used to determine the regeneration energy and adsorption capacity of the X zeolites. LiPdAgX zeolite required less energy for regeneration than 13X zeolite and MEA. After regeneration, the separation factor of LiPdAgX zeolite remained at 6.38 for 20 vol.% CO_2 in the flue gas. Therefore, Li
The cosmic 6Li and 7Li problems and BBN with long-lived charged massive particles
International Nuclear Information System (INIS)
Karsten, Jedamzik
2007-01-01
Charged massive particles (CHAMPs), when present during the Big Bang nucleosynthesis (BBN) era, may significantly alter the synthesis of light elements when compared to a standard BBN scenario. This is due to the formation of bound states with nuclei. This paper presents a detailed numerical and analytical analysis of such CHAMP BBN. All reactions important for predicting light-element yields are calculated within the Born approximation. Three prior neglected effects are treated in detail: (a) photo destruction of bound states due to electromagnetic cascades induced by the CHAMP decay, (b) late-time efficient destruction/production of H 2 , Li 6 , and Li 7 due to reactions on charge Z = 1 nuclei bound to CHAMPs, and (c) CHAMP exchange between nuclei. Each of these effects may induce orders-of-magnitude changes in the final abundance yields. The study focusses on the impact of CHAMPs on a possible simultaneous solution of the Li 6 and Li 7 problems. It is shown that a prior suggested simultaneous solution of the Li 6 and Li 7 problems for a relic decaying at τ x ∼ 1000 s is only very weakly dependent on the relic being neutral or charged, unless its hadronic branching ratio is B h -4 very small. By use of a Monte-Carlo analysis it is shown that within CHAMP BBN the existence of further parameter space for a simultaneous solution of the Li 6 and Li 7 problem for long decay times τ x ≥ 10 6 s seems possible but fairly unlikely. (author)
Yang, Zhongwei; Lu, Quanming; Liu, Ying D.; Wang, Rui
2018-04-01
Electron dynamics at low-Mach-number collisionless shocks are investigated by using two-dimensional electromagnetic particle-in-cell simulations with various shock normal angles. We found: (1) The reflected ions and incident electrons at the shock front provide an effective mechanism for the quasi-electrostatic wave generation due to the charge-separation. A fraction of incident electrons can be effectively trapped and accelerated at the leading edge of the shock foot. (2) At quasi-perpendicular shocks, the electron trapping and reflection is nonuniform due to the shock rippling along the shock surface and is more likely to take place at some locations accompanied by intense reflected ion-beams. The electron trapping process has a periodical evolution over time due to the shock front self-reformation, which is controlled by ion dynamics. Thus, this is a cross-scale coupling phenomenon. (3) At quasi-parallel shocks, reflected ions can travel far back upstream. Consequently, quasi-electrostatic waves can be excited in the shock transition and the foreshock region. The electron trajectory analysis shows these waves can trap electrons at the foot region and reflect a fraction of them far back upstream. Simulation runs in this paper indicate that the micro-turbulence at the shock foot can provide a possible scenario for producing the reflected electron beam, which is a basic condition for the type II radio burst emission at low-Mach-number interplanetary shocks driven by Coronal Mass Ejections (CMEs).
A Stable, Magnetic, and Metallic Li3O4 Compound as a Discharge Product in a Li-Air Battery.
Yang, Guochun; Wang, Yanchao; Ma, Yanming
2014-08-07
The Li-air battery with the specific energy exceeding that of a Li ion battery has been aimed as the next-generation battery. The improvement of the performance of the Li-air battery needs a full resolution of the actual discharge products. Li2O2 has been long recognized as the main discharge product, with which, however, there are obvious failures on the understanding of various experimental observations (e.g., magnetism, oxygen K-edge spectrum, etc.) on discharge products. There is a possibility of the existence of other Li-O compounds unknown thus far. Here, a hitherto unknown Li3O4 compound as a discharge product of the Li-air battery was predicted through first-principles swarm structure searching calculations. The new compound has a unique structure featuring the mixture of superoxide O2(-) and peroxide O2(2-), the first such example in the Li-O system. The existence of superoxide O2(-) creates magnetism and hole-doped metallicity. Findings of Li3O4 gave rise to direct explanations of the unresolved experimental magnetism, triple peaks of oxygen K-edge spectra, and the Raman peak at 1125 cm(-1) of the discharge products. Our work enables an opportunity for the performance of capacity, charge overpotential, and round-trip efficiency of the Li-air battery.
International Nuclear Information System (INIS)
Fu, Xiaoning; Chang, Zhaorong; Chang, Kun; Li, Bao; Tang, Hongwei; Shangguan, Enbo; Yuan, Xiao-Zi; Wang, Haijiang
2015-01-01
Graphical abstract: Nano-sized hollow spindle LiMnPO_4 with a well-developed olivine-type structure exhibits a high specific capacity and cycling performance. - Highlights: • A pure and well-crystallized LiMnPO_4 are synthesized via a solution-phase method. • The LiMnPO_4/C composite constitutes highly and uniformly distributed hollow spindles. • The LiMnPO_4/C composite exhibits a high specific capacity and cycling performance. • The growth process of the hollow spindle LiMnPO_4 particles is revealed. - Abstract: Nano-sized hollow spindle LiMnPO_4 with a well-developed olivine-type structure was synthesized with the assistance of glucose in dimethyl sulfoxide (DMSO)/H_2O under ambient pressure and 108 °C. The scanning electron microscopy (SEM) and transmission electron microscope (TEM) images show that the LiMnPO_4 particles consist of hollow spindles with a mean width of 200 nm, length of 500-700 nm, and wall thickness of about 30-60 nm. The LiMnPO_4/C nanocomposite was obtained by sintering nano-sized LiMnPO_4 with glucose at 650 °C under an inert atmosphere for 4 h. With a coated carbon thickness of about 10 nm, the obtained composite maintained the morphology and size of the hollow spindle. The electrochemical tests show the specific capacity of LiMnPO_4/C nanocomposite is 161.8 mAh g"−"1 at 0.05C, 137.7 mAh g"−"1 at 0.1C and 110.8 mAh g"−"1 at 0.2 C. The retention of discharge capacity maintains 92% after 100 cycles at 0.2 C. After different rate cycles the high capacity of the LiMnPO_4/C nanocomposite can be recovered. This high performance is attributed to the composite material's hollow spindle structure, which facilitates the electrolyte infiltration, resulting in an increased solid-liquid interface. The carbon layer covering the hollow spindle also contributes to the high performance of the LiMnPO_4/C material as the carbon layer improves its electronic conductivity and the nano-scaled wall thickness decreases the paths of Li
Dai, Li; Su, Yan-Qing; Wu, Shi-Ping; Guo, Jing-Jie; Xu, Chao; Xu, Yu-Heng
2011-04-01
A series of Zn: In: Fe: LiNbO3 crystals are grown by the Czochralski technique with various ratios of Li/Nb = 0.94, 1.05, 1.20 and 1.38 in the melt. The Zn, In, Fe, Nb and Li concentrations in the crystals are analyzed by inductively coupled plasma (ICP) spectrometry. The results indicate that with increasing the [Li]/[Nb] ratio in melt, [Li]/[Nb] ratio increases and goes up continuously in the crystal, the segregation coefficients of both Zn and In ions decrease. The absorption spectra measurement and two-wave coupling experiment are employed to study the effect of [Li]/[Nb] ratio on photorefractive properties of Zn: In: Fe: LiNbO3 crystals. It is found that the [Li]/[Nb] ratio increases, the write time is shortened and the photorefractive sensitivity is improved.
Parallel implementation of geometrical shock dynamics for two dimensional converging shock waves
Qiu, Shi; Liu, Kuang; Eliasson, Veronica
2016-10-01
Geometrical shock dynamics (GSD) theory is an appealing method to predict the shock motion in the sense that it is more computationally efficient than solving the traditional Euler equations, especially for converging shock waves. However, to solve and optimize large scale configurations, the main bottleneck is the computational cost. Among the existing numerical GSD schemes, there is only one that has been implemented on parallel computers, with the purpose to analyze detonation waves. To extend the computational advantage of the GSD theory to more general applications such as converging shock waves, a numerical implementation using a spatial decomposition method has been coupled with a front tracking approach on parallel computers. In addition, an efficient tridiagonal system solver for massively parallel computers has been applied to resolve the most expensive function in this implementation, resulting in an efficiency of 0.93 while using 32 HPCC cores. Moreover, symmetric boundary conditions have been developed to further reduce the computational cost, achieving a speedup of 19.26 for a 12-sided polygonal converging shock.
Cures for the shock instability: Development of a shock-stable Roe scheme
Kim, S S; Rho, O H; Kyu-Hong, S
2003-01-01
This paper deals with the development of an improved Roe scheme that is free from the shock instability and still preserves the accuracy and efficiency of the original Roe's Flux Difference Splitting (FDS). Roe's FDS is known to possess good accuracy but to suffer from the shock instability, such as the carbuncle phenomenon. As the first step towards a shock-stable scheme, Roe's FDS is compared with the HLLE scheme to identify the source of the shock instability. Through a linear perturbation analysis on the odd-even decoupling problem, damping characteristic is examined and Mach number-based functions f and g are introduced to balance damping and feeding rates, which leads to a shock-stable Roe scheme. In order to satisfy the conservation of total enthalpy, which is crucial in predicting surface heat transfer rate in high-speed steady flows, an analysis of dissipation mechanism in the energy equation is carried out to find out the error source and to make the proposed scheme preserve total enthalpy. By modif...
Shock dynamics in layered periodic media
Ketcheson, David I.
2012-01-01
Solutions of constant-coeffcient nonlinear hyperbolic PDEs generically develop shocks, even if the initial data is smooth. Solutions of hyperbolic PDEs with variable coeffcients can behave very differently. We investigate formation and stability of shock waves in a one-dimensional periodic layered medium by a computational study of time-reversibility and entropy evolution. We find that periodic layered media tend to inhibit shock formation. For small initial conditions and large impedance variation, no shock formation is detected even after times much greater than the time of shock formation in a homogeneous medium. Furthermore, weak shocks are observed to be dynamically unstable in the sense that they do not lead to significant long-term entropy decay. We propose a characteristic condition for admissibility of shocks in heterogeneous media that generalizes the classical Lax entropy condition and accurately predicts the formation or absence of shocks in these media.
Role of LiNO3 in rechargeable lithium/sulfur battery
International Nuclear Information System (INIS)
Zhang, Sheng S.
2012-01-01
Highlights: ► Effect of LiNO 3 on the Li anode and cathode of Li/S battery is studied, respectively. ► LiNO 3 participates in the formation of a stable passivation film on the Li anode surface. ► LiNO 3 may be reduced irreversibly on the cathode, affecting Li/S battery performance. ► Discharge mechanism of Li/S battery is explained from the viewpoint of phase transition. - Abstract: In this work we study the effect of LiNO 3 on the Li anode and sulfur cathode, respectively, of Li/S battery by using a Li/Li symmetric cell and a liquid Li/Li 2 S 9 cell. On the Li anode, LiNO 3 participates in the formation of a stable passivation film, and the resulting passivation film grows infinitely with the consumption of LiNO 3 . The passivation film formed with LiNO 3 is known to effectively suppress the redox shuttle of the dissolved lithium polysulfides on Li anode. On the cathode, LiNO 3 undergoes a large and irreversible reduction starting at 1.6 V in the first discharge, and the irreversible reduction disappears in the subsequent cycles. Moreover, the insoluble reduction products of LiNO 3 on the cathode adversely affect the redox reversibility of sulfur cathode. These results indicate that both the Li anode and sulfur cathode consume LiNO 3 , and that the best benefit of LiNO 3 to Li/S battery occurs at the potentials higher than 1.6 V. By limiting the irreversible reduction of LiNO 3 on the cathode, we have shown that the Li/S cell with a 0.2 m LiNO 3 as the co-salt can provide a stable capacity of ∼500 mAh g −1 .
Timoshevskii, Vladimir; Feng, Zimin; Bevan, Kirk H; Zaghib, Karim
2015-08-26
The atomic and electronic structures of the LiFePO4 (LFP) surface, both bare and reconstructed upon possible oxygenation, are theoretically studied by ab initio methods. On the basis of total energy calculations, the atomic structure of the oxygenated surface is proposed, and the effect of surface reconstruction on the electronic properties of the surface is clarified. While bare LFP(010) surface is insulating, adsorption of oxygen leads to the emergence of semimetallic behavior by inducing the conducting states in the band gap of the system. The physical origin of these conducting states is investigated. We further demonstrate that deposition of Li2S layers on top of oxygenated LFP(010) surface leads to the formation of additional conducting hole states in the first layer of Li2S surface because of the charge transfer from sulfur p-states to the gap states of LFP surface. This demonstrates that oxygenated LFP surface not only provides conducting layers itself, but also induces conducting channels in the top layer of Li2S. These results help to achieve further understanding of potential role of LFP particles in improving the performance of Li-S batteries through emergent interface conductivity.
Solid state opto-impedance of LiNiVO{sub 4} and LiMn{sub 2}O{sub 4}
Energy Technology Data Exchange (ETDEWEB)
Kalyani, P; Sivasubramanian, S; Prabhu, S Naveen; Ragavendran, K; Kalaiselvi, N; Ranganathan, N G; Madhu, S; SundaraRaj, A; Manoharan, S P; Jagannathan, R [Central Electrochemical Research Institute, Karaikudi-630006, Tamil Nadu (India)
2005-04-07
Spinel type LiMn{sub 2}O{sub 4} and inverse spinel LiNiVO{sub 4} systems serve as standard cathode materials or potential cathode systems for application in high energy density lithium-ion batteries. Upon photo-excitation using UV radiation of energy {approx}5 eV, the LiNiVO{sub 4} system shows significant modification in the solid state impedance pattern while the LiMn{sub 2}O{sub 4} system does not. This study has revealed a significant difference in the opto-impedance pattern for LiNiVO{sub 4} with respect to LiMn{sub 2}O{sub 4}, which may be due to the different electronic processes involved. An attempt has been made to study this behaviour from the solid-state viewpoint.
Experimental Shock Transformation of Gypsum to Anhydrite: A New Low Pressure Regime Shock Indicator
Bell, Mary S.; Zolensky, Michael E.
2011-01-01
The shock behavior of gypsum is important in understanding the Cretaceous/Paleogene event and other terrestrial impacts that contain evaporite sediments in their targets (e.g., Mars Exploration Rover Spirit detected sulfate at Gusev crater, [1]). Most interest focuses on issues of devolatilization to quantify the production of SO2 to better understand its role in generating a temporary atmosphere and its effects on climate and biota [2,3]. Kondo and Ahrens [4] measured induced radiation emitted from single crystal gypsum shocked to 30 and 40 GPa. They observed greybody emission spectra corresponding to temperatures in the range of 3,000 to 4,000 K that are a factor of 2 to 10 times greater than calculated pressure-density energy equation of state temperatures (Hugoniot) and are high enough to melt gypsum. Chen et al. [5] reported results of shock experiments on anhydrite, gypsum, and mixtures of these phases with silica. Their observations indicated little or no devolatilization of anhydrite shocked to 42 GPa and that the fraction of sulfur, by mass, that degassed is approx.10(exp -2) of theoretical prediction. In another report of shock experiments on calcite, anhydrite, and gypsum, Badjukov et al. [6] observed only intensive plastic deformation in anhydrite shock loaded at 63 GPa, and gypsum converted to anhydrite when shock loaded at 56 GPa but have not experimentally shocked gypsum in a step-wise manner to constrain possible incipient transformation effects. Schmitt and Hornemann [7] shock loaded anhydrite and quartz to a peak pressure of 60 GPa and report the platy anhydrite grains were completely pseudomorphed by small crystallized anhydrite grains. However, no evidence of interaction between the two phases could be observed and they suggested that recrystallization of anhydrite grains is the result of a solid-state transformation. They concluded that significant decomposition of anhydrite requires shock pressures higher than 60 GPa. Gupta et al. [8
Shock-induced chemistry in organic materials
Energy Technology Data Exchange (ETDEWEB)
Dattelbaum, Dana M [Los Alamos National Laboratory; Sheffield, Steve [Los Alamos National Laboratory; Engelke, Ray [Los Alamos National Laboratory; Manner, Virginia [Los Alamos National Laboratory; Chellappa, Raja [Los Alamos National Laboratory; Yoo, Choong - Shik [WASHINGTON STATE UNIV
2011-01-20
The combined 'extreme' environments of high pressure, temperature, and strain rates, encountered under shock loading, offer enormous potential for the discovery of new paradigms in chemical reactivity not possible under more benign conditions. All organic materials are expected to react under these conditions, yet we currently understand very little about the first bond-breaking steps behind the shock front, such as in the shock initiation of explosives, or shock-induced reactivity of other relevant materials. Here, I will present recent experimental results of shock-induced chemistry in a variety of organic materials under sustained shock conditions. A comparison between the reactivity of different structures is given, and a perspective on the kinetics of reaction completion under shock drives.
Study of the 6Li(p,π+)7Li reaction at 600 MeV
International Nuclear Information System (INIS)
Bauer, T.; Beurtey, R.; Boudard, A.; Bruge, G.; Chaumeaux, A.; Couvert, P.; Duhm, H.H.; Garreta, D.; Matoba, M.; Terrein, Y.; Aslanides, E.; Bertini, R.; Brochard, F.; Gorodetzky, Ph.; Hibou, F.; Bimbot, L.; Le Bornec, Y.; Tatischeff, B.; Dillig, M.
1977-01-01
The positive pion production through the 6 Li(p,π + ) reaction at 600 MeV has been studied using the high-resolution magnetic spectrometer SPES I. Differential cross sections have been measured from 5 0 to 35 0 sub(lab). The 6 Li(p,π + ) reaction feeds preferentially the 4.63 MeV 7/2 - level of 7 Li. The results of a calculation based on two- and three-nucleon diagrams with π and rho exchange between the projectile and a bound nucleon are also presented. (Auth.)
Formation and control of zinc nitride in a molten LiCl-KCl-Li3N system
International Nuclear Information System (INIS)
Goto, Takuya; Toyoura, Kazuaki; Tsujimura, Hiroyuki; Ito, Yasuhiko
2004-01-01
We investigated a possibility of electrochemical formation and control of zinc nitride in a molten LiCl-KCl-Li 3 N system at 673 K. Zinc nitride films were obtained by means of potentiostatic electrolysis of zinc electrodes in the melt. From XRD analysis, it was confirmed that obtained films consisted of Zn 3 N 2 and LiZnN and that the composition of each film was effected by the applied potential value. In the potential range from 0.75 to 1.6 V (versus Li + /Li), the ratio of Zn 3 N 2 increased as the applied potential was more positive. Based on the result, we achieved the formation of Zn 3 N 2 film (3-5 μm) in anti-scandium oxide structure (a = 0.977 nm) by means of potentiostatic electrolysis at 1.6 V for 3 h
Vitelli, Vincenzo
2012-02-01
Non-linear sound is an extreme phenomenon typically observed in solids after violent explosions. But granular media are different. Right when they unjam, these fragile and disordered solids exhibit vanishing elastic moduli and sound speed, so that even tiny mechanical perturbations form supersonic shocks. Here, we perform simulations in which two-dimensional jammed granular packings are continuously compressed, and demonstrate that the resulting excitations are strongly nonlinear shocks, rather than linear waves. We capture the full dependence of the shock speed on pressure and compression speed by a surprisingly simple analytical model. We also treat shear shocks within a simplified viscoelastic model of nearly-isostatic random networks comprised of harmonic springs. In this case, anharmonicity does not originate locally from nonlinear interactions between particles, as in granular media; instead, it emerges from the global architecture of the network. As a result, the diverging width of the shear shocks bears a nonlinear signature of the diverging isostatic length associated with the loss of rigidity in these floppy networks.
Energetic ion acceleration at collisionless shocks
Decker, R. B.; Vlahos, L.
1985-01-01
An example is presented from a test particle simulation designed to study ion acceleration at oblique turbulent shocks. For conditions appropriate at interplanetary shocks near 1 AU, it is found that a shock with theta sub B n = 60 deg is capable of producing an energy spectrum extending from 10 keV to approx. 1 MeV in approx 1 hour. In this case total energy gains result primarily from several separate episodes of shock drift acceleration, each of which occurs when particles are scattered back to the shock by magnetic fluctuations in the shock vicinity.
Energetic ion acceleration at collisionless shocks
International Nuclear Information System (INIS)
Decker, R.B.; Vlahos, L.
1985-01-01
An example is presented from a test particle simulation designed to study ion acceleration at oblique turbulent shocks. For conditions appropriate at interplanetary shocks near 1 AU, it is found that a shock with theta sub B n = 60 deg is capable of producing an energy spectrum extending from 10 keV to approx 1 MeV in approx 1 hour. In this case total energy gains result primarily from several separate episodes of shock drift acceleration, each of which occurs when particles are scattered back to the shock by magnetic fluctuations in the shock vicinity
Spectral fitting, shock layer modeling, and production of nitrogen oxides and excited nitrogen
Blackwell, H. E.
1991-01-01
An analysis was made of N2 emission from 8.72 MJ/kg shock layer at 2.54, 1.91, and 1.27 cm positions and vibrational state distributions, temperatures, and relative electronic state populations was obtained from data sets. Other recorded arc jet N2 and air spectral data were reviewed and NO emission characteristics were studied. A review of operational procedures of the DSMC code was made. Information on other appropriate codes and modifications, including ionization, were made as well as a determination of the applicability of codes reviewed to task requirement. A review was also made of computational procedures used in CFD codes of Li and other codes on JSC computers. An analysis was made of problems associated with integration of specific chemical kinetics applicable to task into CFD codes.
Particle Acceleration in Two Converging Shocks
Energy Technology Data Exchange (ETDEWEB)
Wang, Xin; Wang, Na; Shan, Hao [Xinjiang Astronomical Observatory, Chinese Academy of Sciences, Urumqi 830011 (China); Giacalone, Joe [Lunar and Planetary Laboratory, University of Arizona, Tucson AZ 85721 (United States); Yan, Yihua [CAS Key Laboratory of Solar Activity, National Astronomical Observatories, Beijing 100012 (China); Ding, Mingde, E-mail: wangxin@xao.ac.cn [Key Laboratory of Modern Astronomy and Astrophysics (Nanjing University) Ministry of Education, Nanjing 210093 (China)
2017-06-20
Observations by spacecraft such as ACE , STEREO , and others show that there are proton spectral “breaks” with energy E {sub br} at 1–10 MeV in some large CME-driven shocks. Generally, a single shock with the diffusive acceleration mechanism would not predict the “broken” energy spectrum. The present paper focuses on two converging shocks to identify this energy spectral feature. In this case, the converging shocks comprise one forward CME-driven shock on 2006 December 13 and another backward Earth bow shock. We simulate the detailed particle acceleration processes in the region of the converging shocks using the Monte Carlo method. As a result, we not only obtain an extended energy spectrum with an energy “tail” up to a few 10 MeV higher than that in previous single shock model, but also we find an energy spectral “break” occurring on ∼5.5 MeV. The predicted energy spectral shape is consistent with observations from multiple spacecraft. The spectral “break,” then, in this case is caused by the interaction between the CME shock and Earth’s bow shock, and otherwise would not be present if Earth were not in the path of the CME.
Dehydriding and rehydriding reactions of LiBH4
International Nuclear Information System (INIS)
Orimo, S.; Nakamori, Y.; Kitahara, G.; Miwa, K.; Ohba, N.; Towata, S.; Zuettel, A.
2005-01-01
Structural differences in LiBH 4 before and after the melting reaction at approximately 550-bar K were investigated to clarify the experimental method for the confirmation of reversible dehydriding and rehydriding reactions. Since the long-range order of LiBH 4 begins to disappear after the melting reaction was achieved, investigation of the atomistic vibrations of the [BH 4 ]-anion in LiBH 4 was found to be effective for the confirmation of the reversibility. In the present study, LiBH 4 was successively dehydrided (decomposed) into LiH and B under 1-bar MPa of hydrogen at 873-bar K, and then rehydrided (recombined) into LiBH 4 under 35-bar MPa of hydrogen at the same temperature (873-bar K). The temperatures at the beginning and ending of the dehydriding reaction are lowered, by approximately 30-bar K, for LiBH 4 substituted (or mixed) with Mg (atomic ratio of Li:Mg=9:1) as compared to those for LiBH 4 alone. This is similar to the tendency exhibited by LiNH 2
Li, Liuxia; Qian, Dun; Zou, Xiaobing; Wang, Xinxin
2018-05-01
The shock waves generated by an underwater electrical wire explosion were investigated. A microsecond time-scale pulsed current source was used to trigger the electrical explosion of copper wires with a length of 5 cm and a diameter of 200 μm. The energy-storage capacitor was charged to a relatively low energy so that the energy deposited onto the wire was not large enough to fully vaporize the whole wire. Two shock waves were recorded with a piezoelectric gauge that was located at a position of 100 mm from the exploding wire. The first and weak shock wave was confirmed to be the contribution from wire melting, while the second and stronger shock wave was the contribution from wire vaporization. The phenomenon whereby the first shock wave generated by melting being overtaken by the shock wave due to vaporization was observed.
2015 Puget Sound LiDAR Consortium (PSLC) LiDAR: WA DNR Lands (P1)
National Oceanic and Atmospheric Administration, Department of Commerce — In June 2014, WSI, a Quantum Spatial Inc. (QSI) company, was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...
2014 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Willapa Valley (Delivery 1)
National Oceanic and Atmospheric Administration, Department of Commerce — In January, 2014 WSI, a Quantum Spatial (QSI) company, was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR) data...
2015 Puget Sound LiDAR Consortium (PSLC) LiDAR: WA DNR Lands (P2)
National Oceanic and Atmospheric Administration, Department of Commerce — In June 2014, WSI, a Quantum Spatial Inc. (QSI) company, was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...
INTERFERENCE OF COUNTERPROPAGATING SHOCK WAVES
Directory of Open Access Journals (Sweden)
P. V. Bulat
2015-03-01
Full Text Available The subject of study. We examined the interaction of counterpropagating shock waves. The necessity of counterpropagating shock waves studying occurs at designing of high Mach number modern internal compression air intakes, Ramjets with subsonic and supersonic combustion, in asymmetrical supersonic nozzles and in some other cases. In a sense, this problem is a generalization of the case of an oblique shock reflection from the wall or from the plane of symmetry. With the renewed vigor, the interest to this problem emerged at the end of the 90s. This was due to the start of the programs for flight study at hypersonic speeds. The first experiments performed with air intakes, which realized the interaction of counterpropagating shock waves have shown that the change in flow velocity is accompanied by abrupt alteration of shock-wave structure, the occurrence of nonstationary and oscillatory phenomena. With an increase of flow velocity these phenomena undesirable for aircraft structure became more marked. The reason is that there are two fundamentally different modes of interaction of counterpropagating shock waves: a four-wave regular and a five-wave irregular. The transition from one mode to another can be nonstationary abrupt or gradual, it can also be accompanied by hysteresis. Main results. Criteria for the transition from regular reflection of counterpropagating shock waves to irregular are described: the criterion of von Neumann and the stationary Mach configuration criterion. We described areas in which the transition from one reflection type to another is possible only in abrupt way, as well as areas of possible gradual transition. Intensity dependences of the reflected shock waves from the intensity of interacting counterpropagating shocks were given. Qualitative pictures of shock-wave structures arising from the interaction of counterpropagating shock waves were shown. Calculation results of the intensity of outgoing gas
On the reduction of generalized polylogarithms to Li_n and Li_2_,_2 and on the evaluation thereof
International Nuclear Information System (INIS)
Frellesvig, Hjalte; Tommasini, Damiano; Wever, Christopher
2016-01-01
We give expressions for all generalized polylogarithms up to weight four in terms of the functions log, Li_n, and Li_2_,_2, valid for arbitrary complex variables. Furthermore we provide algorithms for manipulation and numerical evaluation of Li_n and Li_2_,_2, and add codes in Mathematica and C++ implementing the results. With these results we calculate a number of previously unknown integrals, which we add in appendix C.
Controllable synthesis of porous LiFePO4 for tunable electrochemical Li-insertion performance
International Nuclear Information System (INIS)
Tian, Xiaohui; Zhou, Yingke; Wu, Guan; Wang, Pengcheng; Chen, Jian
2017-01-01
Highlights: • A templated freeze-drying method is developed to prepare the porous LiFePO 4 . • The pore size and porosity can be controlled by adjusting the conditions. • The effects of the porous properties on the Li-insertion performances are studied. • The optimized composite presents excellent specific capacity and rate capability. - Abstract: A templated freeze-drying method is developed to prepare the porous LiFePO 4 materials with the controlled pore size and porosity, by conveniently adjusting the size and content of the template in the precursor solution. The morphology and structure of the porous LiFePO 4 materials are characterized and the relavant electrochemical lithium-insertion performances are systematically studied. It’s found that the porous characteristics play a critical role in the lithium-ion intercalation processes and significantly affect the power capability of LiFePO 4 . The optimized porous LiFePO 4 material presents remarkable specific capacity (167 mAh g −1 at 0.1 C), rate capability (151 mAh g −1 at 1 C and 110 mAh g −1 at 10 C) and cycling stability (99.3% retention after 300 cycles at 1 C). These findings demonstrate that the electrochemical performance of the electrode material can be purposely tuned and remarkably improved by the rational design and introduction of the suitable pores, which open up new strategies for the synthesis of advanced porous materials for the lithium-ion power battery applications.
International Nuclear Information System (INIS)
Jauch, U.; Karcher, V.; Schulz, B.
1986-01-01
Li(17)Pb(83) and LiPb were prepared from the pure elements in amounts of several hundred grams. The resolidified samples were characterized by melting points (eutectic temperature), chemical analysis and metallography. Using differential thermal analysis the heats of fusion were determined and the behaviour of the intermetallic phase LiPb in vacuum and high purified He was studied. The results from these investigations were applied to characterize Li(17)Pb(83) prepared in high amounts for technical application as a potential liquid breeder material. (orig.)
"Driverless" Shocks in the Interplanetary Medium
Gopalswamy, N.; Kaiser, M. L.; Lara, A.
1999-01-01
Many interplanetary shocks have been detected without an obvious driver behind them. These shocks have been thought to be either blast waves from solar flares or shocks due to sudden increase in solar wind speed caused by interactions between large scale open and closed field lines of the Sun. We investigated this problem using a set of interplanetary shock detected {\\it in situ} by the Wind space craft and tracing their solar origins using low frequency radio data obtained by the Wind/WAVES experiment. For each of these "driverless shocks" we could find a unique coronal mass ejections (CME) event observed by the SOHO (Solar and Heliospheric Observatory) coronagraphs. We also found that these CMEs were ejected at large angles from the Sun-Earth line. It appears that the "driverless shocks" are actually driver shocks, but the drivers were not intercepted by the spacecraft. We conclude that the interplanetary shocks are much more extended than the driving CMEs.
Inferior vena cava obstruction and shock
Directory of Open Access Journals (Sweden)
Megri Mohammed
2018-01-01
Full Text Available Shock is one of the most challenging life-threatening conditions with high mortality and morbidity; the outcomes are highly dependent on the early detection and management of the condition. Septic shock is the most common type of shock in the Intensive Care Unit. While not as common as other subsets of shock, obstructive shock is a significant subtype due to well defined mechanical and pathological causes, including tension pneumothorax, massive pulmonary embolism, and cardiac tamponade. We are presenting a patient with obstructive shock due to inferior vena cava obstruction secondary to extensive deep venous thrombosis. Chance of survival from obstructive shock in our patient was small; however, there was complete and immediate recovery after treatment of the obstruction on recognizing the affected vessels. This case alerts the practicing intensivist and the emergency medicine physician to consider occlusion of the great vessels other than the pulmonary artery or aorta as causes of obstructive shock.
International Nuclear Information System (INIS)
Thatcher, G.; Davidson, D. F.
1984-01-01
A hydraulic shock absorber of the dash pot kind for use with electrically conducting liquid such as sodium, has magnet means for electro magnetically braking a stream of liquid discharged from the cylinder. The shock absorber finds use in a liquid metal cooled nuclear reactor for arresting control rods
Study of Moessbauer effect on LiFe5-x Alx O8, LiFe 5-x Gax O8 and LiGa5-x Fex O8 systems
International Nuclear Information System (INIS)
Barthem, V.M.T.S.
1982-01-01
The measures obtained by Moessbauer spectroscopy from LiFe 5-x Ga x O 8 and LiFe 5-x Al x O 8 systems are presented. A comparative study of the influences of dopant diamagnetic ions on magnetic structures of lithium ferrite was performed. The LiGa 5-x Fe x O 8 systems were analysed based on the existing data from LiAl 5-x Fe x O 8 systems, otaining informations about the iron ion behaviour in both matrices. (M.C.K.) [pt
LiFAP-based PVdF-HFP microporous membranes by phase-inversion technique with Li/LiFePO{sub 4} cell
Energy Technology Data Exchange (ETDEWEB)
Aravindan, V.; Vickraman, P. [Gandhigram Rural University, Department of Physics, Gandhigram (India); Sivashanmugam, A.; Thirunakaran, R.; Gopukumar, S. [Central Electrochemical Research Institute, Electrochemical Energy Systems Division, Karaikudi (India)
2009-12-15
Polyvinylidenefluoride-hexafluoropropylene-based (PVdF-HFP-based) gel and composite microporous membranes (GPMs and CPMs) were prepared by phase-inversion technique in the presence 10 wt% of AlO(OH){sub n} nanoparticles. The prepared membranes were gelled with 0.5-M LiPF{sub 3}(CF{sub 2}CF{sub 3}){sub 3} (lithium fluoroalkylphosphate, LiFAP) in EC:DEC (1:1 v/v) and subjected to various characterizations; the AC impedance study shows that CPMs exhibit higher conductivity than GPMs. Mechanical stability measurements on these systems reveal that CPMs exhibit Young's modulus higher than that of bare and GPMs and addition of nanoparticles drastically improves the elongation break was also noted. Transition of the host from {alpha} to {beta} phase after the loading of nanosized filler was confirmed by XRD and Raman studies. Physico-chemical properties, like liquid uptake, porosity, surface area, and activation energy, of the membranes were calculated and results are summarized. Cycling performance of Li/CPM/LiFePO{sub 4} coin cell was fabricated and evaluated at C/10 rate and delivered a discharge capacity of 157 and 148 mAh g {sup -1} respectively for first and tenth cycles. (orig.)
International Nuclear Information System (INIS)
Sastry, S.M.L.; Oneal, J.E.
1984-01-01
The deformation behavior at 25-300 C of rapidly solidified Al-3Li-0.6Co and Al-3Li-0.3Zr alloys was studied by tensile property measurements and transmission electron microscopic examination of dislocation substructures. In binary Al-3Li and Al-3Li-Co alloys, the modulus normalized yield stress increases with an increase in temperature up to 150 C and then decreases. The yield stress at 25 C of Al-3Li-0.3Zr alloys is 180-200 MPa higher than that of Al-3Li alloys. However, the yield stress of the Zr-containing alloy decreases drastically with increasing temperatures above 75 C. The short-term yield stresses at 100-200 C of the Al-3Li-based alloys are higher than that of the conventional high-temperature Al alloys. The temperature dependences of the flow stresses of the alloys were analyzed in terms of the magnitudes and temperature dependences of the various strengthening contributions in the two alloys. The dislocation substructures at 25-300 C were correlated with mechanical properties. 19 references
The optical potential for 6Li-6Li elastic scattering at 156 MeV
International Nuclear Information System (INIS)
Micek, S.; Majka, Z.; Klewe-Nebenius, H.; Rebel, H.; Gils, H.J.
1984-10-01
Elastic scattering of 6 Li from 6 Li has been studied for the beam energy of 156 MeV. The experimental differential cross section has been analysed on the basis of the optical model using various phenomenological forms. The spin-orbit interaction proves to be less significant. A semi-microscopic double-folding cluster model which generates the real part of the optical potential by an antisymmetrized d-α cluster wave function of 6 Li and α-α, d-d and d-α interactions is well able to describe the experimental data. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Sanna, G.; Tomassetti, G. [L`Aquila Univ. (Italy). Dipt. di Fisica
1998-02-01
The discontinuities in the flow fields (both tangential and shocks) are considered and the equations for the quantities conserved across them are written. The post-shock flow variables are expressed by the Mach number of the incident supersonic flow and its deflection angle operated by rigid wall. Normal and oblique shocks are considered and graphs and polar diagrams are introduced. Then the reflections of a shock wave operated by a rigid wall and by the boundary between a jet and a stagnating gas are analyzed. Finally, the interactions between two distinct shock waves are considered. [Italiano] Vengono considerate le discontinuita` (tangenziali e shocks) nei campi di flusso e sono scritte le equazioni per le quantita` che si conservano attraverso di esse. Le variabili del flusso oltre lo shock sono espresse in funzione del numero di Mach del flusso supersonico incidente e dell`angolo di deflessione di questo operato da una parete rigida. I casi di shock normale, obliquo e distaccato sono considerati e sono introdotti grafici vari e rappresentazioni polari. Sono quindi considerate le riflessioni di un fronte di shock da una parete rigida e dalla frontiera tra un gas in moto ed uno stagnante. Sono infine considerate le diverse interazioni tra due shock distinti.
Synthesis and characterization of PVA blended LiClO4 as electrolyte material for battery Li-ion
Gunawan, I.; Deswita; Sugeng, B.; Sudaryanto
2017-07-01
It have been synthesized the materials for Li ion battery electrolytes, namely PVA with the addition of LiClO4 salt were varied 0, 5, 10, 15 and 20% by weight respectively. The objective of this study is to control the ionic conductivity in traditional polymer electrolytes, to improve ionic conductivity with the addition of lithium perchlorat (LiClO4). These electrolyte materials prepared by PVA powder was dissolved into distilled water and added LiClO4 salt were varied. After drying the solution, PVA sheet blended LiClO4 salt as electrolyte material for Li ion battery obtained. PVA blended LiClO4 salt crystallite form was confirmed using X-Ray Difraction (XRD) equipment. Observation of the morphology done by using Scanning Electron Microscope (SEM). While the electrical conductivity of the material is measured using LCR meter. The results of XRD pattern of LiClO4 shows intense peaks at angles 2θ = 23.2, 32.99, and 36.58°, which represent the crystalline nature of the salt. Particles morphology of the sample revealed by scanning electron microscopy are irregular in shape and agglomerated, with mean size 200-300 nm. It can be concluded that polycrystalline particles are composed of large number of crystallites. The study of conductivity by using LCR meter shows that all the graphs represent the DC and AC conductivity phenomena.
Probing the failure mechanism of nanoscale LiFePO{sub 4} for Li-ion batteries
Energy Technology Data Exchange (ETDEWEB)
Gu, Meng; Yan, Pengfei; Wang, Chongmin, E-mail: chongmin.wang@pnnl.gov [Environmental Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland, Washington 99352 (United States); Shi, Wei [Energy and Environmental Directorate, Pacific Northwest National Laboratory, 902 Battelle Boulevard, Richland, Washington 99352 (United States); National Active Distribution Network Technology Research Center, School of Electrical Engineering, Beijing Jiaotong University, 3 Shangyuancun Street, Haidian District, Beijing 100044 (China); Zheng, Jianming; Zhang, Ji-guang [Energy and Environmental Directorate, Pacific Northwest National Laboratory, 902 Battelle Boulevard, Richland, Washington 99352 (United States)
2015-05-18
LiFePO{sub 4} is a high power rate cathode material for lithium ion battery and shows remarkable capacity retention, featuring a 91% capacity retention after 3300 cycles. In this work, we use high-resolution transmission electron microscopy and electron energy loss spectroscopy to study the gradual capacity fading mechanism of LiFePO{sub 4} materials. We found that upon prolonged electrochemical cycling of the battery, the LiFePO{sub 4} cathode shows surface amorphization and loss of oxygen species, which directly contribute to the gradual capacity fading of the battery. The finding can guide the design and improvement of LiFePO{sub 4} cathode for high-energy and high-power rechargeable battery for electric transportation.
Energy Technology Data Exchange (ETDEWEB)
Ye, Fangmin; Noh, Hyungjun; Lee, Jin Hong; Lee, Hongkyung; Kim, Hee-Tak
2018-03-12
Carbothermal conversion of Li2SO4 provides a cost-effective strategy to fabricate high-capacity Li2S cathodes, however, Li2S cathodes derived from Li2SO4 at high temperatures (> 800 oC), having high crystallinity and large crystal size, result in a low utilization of Li2S. Here, we report a Li2SO4/poly(vinyl alcohol)-derived Li2S/Carbon nanocomposite (Li2S@C) strips at a record low temperature of 635 oC. These Li2S@C nanocomposite strips as a cathode shows a low initial activation potential (2.63 V), a high initial discharge capacity (805 mAh g-1 Li2S) and a high cycling stability (0.2 C and 1 C). These improvedresults could be ascribed to the nano-sized Li2S particles as well as their low crystallinity due to the PVA-induced carbon network and the low conversion temperature, respectively. An XPS analysis reveals that the C=C and C=O bonds derived from the carbonization of PVA can promote the conversion of Li2SO4 at the low temperature.
MHD intermediate shock discontinuities: Pt. 1
International Nuclear Information System (INIS)
Kennel, C.F.; Blandford, R.D.; Coppi, P.
1989-01-01
Recent numerical investigations have focused attention once more on the role of intermediate shocks in MHD. Four types of intermediate shock are identified using a graphical representation of the MHD Rankine-Hugoniot conditions. This same representation can be used to exhibit the close relationship of intermediate shocks to switch-on shocks and rotational discontinuities. The conditions under which intermediate discontinuities can be found are elucidated. The variations in velocity, pressure, entropy and magnetic-field jumps with upstream parameters in intermediate shocks are exhibited graphically. The evolutionary arguments traditionally advanced against intermediate shocks may fail because the equations of classical MHD are not strictly hyperbolic. (author)
Nuclear charge radius of {sup 11}Li
Energy Technology Data Exchange (ETDEWEB)
Sanchez, Rodolfo, E-mail: R.Sanchez@GSI.de; Noertershaeuser, Wilfried [Gesellschaft fuer Schwerionenforschung (Germany); Dax, Andreas [CERN(Switzerland); Ewald, Guido; Goette, Stefan; Kirchner, Reinhard; Kluge, H.-Juergen; Kuehl, Thomas [Gesellschaft fuer Schwerionenforschung (Germany); Wojtaszek, Agnieszka [Swietokrzyska Academy, Institute of Physics (Poland); Bushaw, Bruce A. [Pacific Northwest National Laboratory (United States); Drake, Gordon W. F. [University of Windsor, Department of Physics (Canada); Yan Zongchao [University of New Brunswick, Department of Physics (Canada); Zimmermann, Claus [Physikalisches Institut, Eberhard Karls Universitaet Tuebingen (Germany); Albers, Daniel; Behr, John; Bricault, Pierre; Dilling, Jens; Dombsky, Marik; Lassen, Jens; Phil Levy, C. D. [Tri-University Meson Facility (Canada)
2006-07-15
We have determined the nuclear charge radius of {sup 11}Li by high-precision laser spectroscopy. The experiment was performed at the TRIUMF-ISAC facility where the {sup 7}Li-{sup 11}Li isotope shift (IS) was measured in the 2s{yields}3s electronic transition using Doppler-free two-photon spectroscopy with a relative accuracy better than 10{sup -5}. The accuracy for the IS of the other lithium isotopes was also improved. IS's are mainly caused by differences in nuclear mass, but changes in proton distribution also give small contributions. Comparing experimentally measured IS with advanced atomic calculation of purely mass-based shifts, including QED and relativistic effects, allows derivation of the nuclear charge radii. The radii are found to decrease monotonically from {sup 6}Li to {sup 9}Li, and then increase with {sup 11}Li about 11% larger than {sup 9}Li. These results are a benchmark for the open question as to whether nuclear core excitation by halo neutrons is necessary to explain the large nuclear matter radius of {sup 11}Li; thus, the results are compared with a number of nuclear structure models.
Perpendicular relativistic shocks in magnetized pair plasma
Plotnikov, Illya; Grassi, Anna; Grech, Mickael
2018-04-01
Perpendicular relativistic (γ0 = 10) shocks in magnetized pair plasmas are investigated using two dimensional Particle-in-Cell simulations. A systematic survey, from unmagnetized to strongly magnetized shocks, is presented accurately capturing the transition from Weibel-mediated to magnetic-reflection-shaped shocks. This transition is found to occur for upstream flow magnetizations 10-3 10-2, it leaves place to a purely electromagnetic precursor following from the strong emission of electromagnetic waves at the shock front. Particle acceleration is found to be efficient in weakly magnetized perpendicular shocks in agreement with previous works, and is fully suppressed for σ > 10-2. Diffusive Shock Acceleration is observed only in weakly magnetized shocks, while a dominant contribution of Shock Drift Acceleration is evidenced at intermediate magnetizations. The spatial diffusion coefficients are extracted from the simulations allowing for a deeper insight into the self-consistent particle kinematics and scale with the square of the particle energy in weakly magnetized shocks. These results have implications for particle acceleration in the internal shocks of AGN jets and in the termination shocks of Pulsar Wind Nebulae.
International Nuclear Information System (INIS)
Park, Sung Bin; Seo, Jung Seok; Kang, Dae Seung; Kwon, Sun Kil; Park, Seong Won
2004-01-01
Interest of electrolytic reduction of uranium oxide is increasing in treatment of spent metal fuels. Argonne National Laboratory (ANL) has reported the experimental results of electrochemical reduction of uranium oxide fuel in bench-scale apparatus with cyclic voltammetry, and has designed high-capacity reduction (HCR) cells and conducted three kg-scale UO 2 reduction runs. From the cyclic voltammograms, the mechanism of electrolytic reduction of metal oxides is analyzed. The uranium oxide in LiCl-Li 2 O is converted to uranium metal according to the two mechanism; direct and indirect electrolytic reduction. In this study, cyclic voltammograms for LiCl-3wt% Li 2 O system and U 3 O 8 -LiCl-3wt% Li 2 O system using the 325-mesh stainless steel screen in cathode assembly have been obtained. Direct electrolytic reduction of uranium oxide in LiCl-3wt% Li 2 O molten salt has been conducted
Electron velocity distributions near collisionless shocks
International Nuclear Information System (INIS)
Feldman, W.C.
1984-01-01
Recent studies of the amount of electron heating and of the shapes of electron velocity distributions across shocks near the earth are reviewed. It is found that electron heating increases with increasing shock strength but is always less than the ion heating. The scale length of electron heating is also less than that for the ions. Electron velocity distributions show characteristic shapes which depend on the strength of the shocks. At the weaker shocks, electron heating is mostly perpendicular to the ambient magnetic field, bar B, and results in Gaussian-shaped velocity distributions at low-to-moderate energies. At the stronger shocks, parallel heating predominates resulting in flat-topped velocity distributions. A reasonable interpretation of these results indicates that at the weaker shocks electron heating is dominated by a tendency toward conservation of the magnetic moment. At the stronger fast-mode shocks, this heating is thought to be dominated by an acceleration parallel to bar B produced by the macroscopic shock electric field followed by beam driven plasma instabilities. Some contribution to the heating at the stronger shocks from conservation of the magnetic moment and cross-field current-driven instabilities cannot be ruled out. Although the heating at slow-mode shocks is also dominated by instabilities driven by magnetic field-aligned electron beams, their acceleration mechanism is not yet established
Comparison of LiVPO4F to Li4Ti5O12 as anode materials for lithium-ion batteries.
Ma, Rui; Shao, Lianyi; Wu, Kaiqiang; Shui, Miao; Wang, Dongjie; Pan, Jianguo; Long, Nengbing; Ren, Yuanlong; Shu, Jie
2013-09-11
In this paper, we reported on a comparison of LiVPO4F to Li4Ti5O12 as anode materials for lithium-ion batteries. Combined with powder X-ray diffraction, scanning electron microscopy, high-resolution transmission electron microscopy, galvanostatic discharge/charge tests and in situ X-ray diffraction technologies, we explore and compare the insertion/extraction mechanisms of LiVPO4F based on the V3+/V2+/V+ redox couples and Li4Ti5O12 based on the Ti4+/Ti3+ redox couple cycled in 1.0-3.0 V and 0.0-3.0 V. The electrochemical results indicate that both LiVPO4F and Li4Ti5O12 are solid electrolyte interphase free materials in 1.0-3.0 V. The insertion/extraction mechanisms of LiVPO4F and Li4Ti5O12 are similar with each other in 1.0-3.0 V as proved by in situ X-ray diffraction. It also demonstrates that both samples possess stable structure in 0.0-3.0 V. Additionally, the electrochemical performance tests of LiVPO4F and Li4Ti5O12 indicate that both samples cycled in 0.0-3.0 V exhibit much higher capacities than those cycled in 1.0-3.0 V but display worse cycle performance. The rate performance of Li4Ti5O12 far exceeds that of LiVPO4F in the same electrochemical potential window. In particular, the capacity retention of Li4Ti5O12 cycled in 1.0-3.0 V is as high as 98.2% after 20 cycles. By contrast, Li4Ti5O12 is expected to be a candidate anode material considering its high working potential, structural zero-strain property, and excellent cycle stability and rate performance.
Revision of the Li13Si4 structure.
Zeilinger, Michael; Fässler, Thomas F
2013-11-06
Besides Li17Si4, Li16.42Si4, and Li15Si4, another lithium-rich representative in the Li-Si system is the phase Li13Si4 (trideca-lithium tetra-silicide), the structure of which has been determined previously [Frank et al. (1975 ▶). Z. Naturforsch. Teil B, 30, 10-13]. A careful analysis of X-ray diffraction patterns of Li13Si4 revealed discrepancies between experimentally observed and calculated Bragg positions. Therefore, we redetermined the structure of Li13Si4 on the basis of single-crystal X-ray diffraction data. Compared to the previous structure report, decisive differences are (i) the introduction of a split position for one Li site [occupancy ratio 0.838 (7):0.162 (7)], (ii) the anisotropic refinement of atomic displacement parameters for all atoms, and (iii) a high accuracy of atom positions and unit-cell parameters. The asymmetric unit of Li13Si4 contains two Si and seven Li atoms. Except for one Li atom situated on a site with symmetry 2/m, all other atoms are on mirror planes. The structure consists of isolated Si atoms as well as Si-Si dumbbells surrounded by Li atoms. Each Si atom is either 12- or 13-coordinated. The isolated Si atoms are situated in the ab plane at z = 0 and are strictly separated from the Si-Si dumbbells at z = 0.5.
A Study on the Electrolytic Reduction Mechanism of Uranium Oxide in a LiCl-Li2O Molten Salt
International Nuclear Information System (INIS)
Oh, Seung Chul; Hur, Jin Mok; Seo, Chung Seok; Park, Seong Won
2003-01-01
This study proposed a new electrolytic reduction technology that is based on the integration of simultaneous uranium oxide metallization and Li 2 O electrowinning. In this electrolytic reduction reaction, electrolytically reduced Li deposits on cathode and simultaneously reacts with uranium oxides to produce uranium metal showing more than 99% conversion. For the verification of process feasibility, the experiments to obtain basic data on the metallization of uranium oxide, investigation of reaction mechanism, the characteristics of closed recycle of Li 2 O and mass transfer were carried out. This evolutionary electrolytic reduction technology would give benefits over the conventional Li-reduction process improving economic viability such as: avoidance of handling of chemically active Li-LiCl molten salt increase of metallization yield, and simplification of process.
International Nuclear Information System (INIS)
Housman, J.J.
1978-01-01
A shock absorber is described for use in a hostile environment at the end of a blind passage for absorbing impact loads. The shock absorber includes at least one element which occupies the passage and which is comprised of a porous brittle material which is substantially non-degradable in the hostile environment. A void volume is provided in the element to enable the element to absorb a predetermined level of energy upon being crushed due to impact loading
INJECTION TO RAPID DIFFUSIVE SHOCK ACCELERATION AT PERPENDICULAR SHOCKS IN PARTIALLY IONIZED PLASMAS
Energy Technology Data Exchange (ETDEWEB)
Ohira, Yutaka, E-mail: ohira@phys.aoyama.ac.jp [Department of Physics and Mathematics, Aoyama Gakuin University, 5-10-1 Fuchinobe, Sagamihara 252-5258 (Japan)
2016-08-10
We present a three-dimensional hybrid simulation of a collisionless perpendicular shock in a partially ionized plasma for the first time. In this simulation, the shock velocity and upstream ionization fraction are v {sub sh} ≈ 1333 km s{sup −1} and f {sub i} ∼ 0.5, which are typical values for isolated young supernova remnants (SNRs) in the interstellar medium. We confirm previous two-dimensional simulation results showing that downstream hydrogen atoms leak into the upstream region and are accelerated by the pickup process in the upstream region, and large magnetic field fluctuations are generated both in the upstream and downstream regions. In addition, we find that the magnetic field fluctuations have three-dimensional structures and the leaking hydrogen atoms are injected into the diffusive shock acceleration (DSA) at the perpendicular shock after the pickup process. The observed DSA can be interpreted as shock drift acceleration with scattering. In this simulation, particles are accelerated to v ∼ 100 v {sub sh} ∼ 0.3 c within ∼100 gyroperiods. The acceleration timescale is faster than that of DSA in parallel shocks. Our simulation results suggest that SNRs can accelerate cosmic rays to 10{sup 15.5} eV (the knee) during the Sedov phase.
Sutter, B.; Ming, D. W.; Clearfield, A.; Hossner, L. R.
2003-01-01
The National Aeronautics and Space Administration's (NASA) Advanced Life Support (ALS) Program is evaluating the use of Fe-, Mn-, and Cu-containing synthetic hydroxyapatite (SHA) as a slow release fertilizer for crops that might be grown on the International Space Station or at Lunar and Martian outposts. Separate Fe-, Mn-, and Cu-containing SHA materials along with a transition-metal free SHA (pure-SHA) were synthesized using a precipitation method. Chemical and mineralogical analyses determined if and how Fe, Mn, and Cu were incorporated into the SHA structure. X-ray diffraction (XRD), Rietveld refinement, and transmission electron microscopy (TEM) confirmed that SHA materials with the apatite structure were produced. Chemical analyses indicated that the metal containing SHA materials were deficient in Ca relative to pure-SHA. The shift in the infrared PO4-mu 3 vibrations, smaller unit cell parameters, smaller particle size, and greater structural strain for Fe-, Mn-, and Cu-containing SHA compared with pure-SHA suggested that Fe, Mn, and Cu were incorporated into SHA structure. Rietveld analyses revealed that Fe, Mn, and Cu substituted into the Ca2 site of SHA. An Fe-rich phase was detected by TEM analyses and backscattered electron microscopy in the Fe-containing SHA material with the greatest Fe content. The substitution of metals into SHA suggests that metal-SHA materials are potential slow-release sources of micronutrients for plant uptake in addition to Ca and P.
Czenko, M.R.; Etalle, Sandro
2007-01-01
We propose CoreTuLiP - the core of a trust management language based on Logic Programming. CoreTuLiP is based on a subset of moded logic programming, but enjoys the features of TM languages such as RT; in particular clauses are issued by different authorities and stored in a distributed manner. We
Fan, Xiaofeng; Zheng, W T; Kuo, Jer-Lai; Singh, David J
2013-08-28
We analyzed the adsorption of Li on graphene in the context of anodes for lithium-ion batteries (LIBs) using first-principles methods including van der Waals interactions. We found that although Li can reside on the surface of defect-free graphene under favorable conditions, the binding is much weaker than to graphite and the concentration on a graphene surface is not higher than in graphite. At low concentration, Li ions spread out on graphene because of Coulomb repulsion. With increased Li content, we found that small Li clusters can be formed on graphene. Although this result suggests that graphene nanosheets can conceivably have a higher ultimate Li capacity than graphite, it should be noted that such nanoclusters can potentially nucleate Li dendrites, leading to failure. The implications for nanostructured carbon anodes in batteries are discussed.
The "7Li(d, p)"8Li reaction in inverse kinematics at 5.44 MeV/u
International Nuclear Information System (INIS)
Pakou, A.; Aslanoglou, X.; Sgouros, O.; Soukeras, V.; Keeley, N.; Cappuzzello, F.; Acosta, L.; Agodi, C.; Calabrese, S.; Carbone, D.; Cavallaro, M.; Foti, A.; Marquinez-Duran, G.; Martel, I.; Mazzocco, M.; Strano, E.; Parascandolo, C.; Pierroutsakou, D.; Rusek, K.; Zagatto, V.A.B.
2017-01-01
New data are presented for the "7Li(d, p)"8Li stripping reaction which, together with previously reported elastic scattering data taken in the same experiment, provide a coherent set. These data, plus existing measurements of the elastic scattering and stripping at 6 MeV/u were analysed within the same coupled reaction channels scheme. Good descriptions of the stripping data to the 0.0 MeV 2"+ and 0.98 MeV 1"+ states of "8Li were obtained using a set of left angle "8Li vertical stroke "7Li + n right angle overlaps taken from the literature, provided that the elastic scattering was also well described. Multi-step reaction paths made significant contributions to the description of the larger angle data. The asymptotic normalisation coefficients are compared with previous determinations. (orig.)
Shock compression of diamond crystal
Kondo, Ken-ichi; Ahrens, Thomas J.
1983-01-01
Two shock wave experiments employing inclined mirrors have been carried out to determine the Hugoniot elastic limit (HEL), final shock state at 191 and 217 GPa, and the post-shock state of diamond crystal, which is shock-compressed along the intermediate direction between the and crystallographic axes. The HEL wave has a velocity of 19.9 ± 0.3 mm/µsec and an amplitude of 63 ± 28 GPa. An alternate interpretation of the inclined wedge mirror streak record suggests a ramp precursor wave and th...
Electron transport and shock ignition
Energy Technology Data Exchange (ETDEWEB)
Bell, A R; Tzoufras, M, E-mail: t.bell1@physics.ox.ac.uk [Clarendon Laboratory, University of Oxford, Parks Road, Oxford OX1 3PU (United Kingdom)
2011-04-15
Inertial fusion energy (IFE) offers one possible route to commercial energy generation. In the proposed 'shock ignition' route to fusion, the target is compressed at a relatively low temperature and then ignited using high intensity laser irradiation which drives a strong converging shock into the centre of the fuel. With a series of idealized calculations we analyse the electron transport of energy into the target, which produces the pressure responsible for driving the shock. We show that transport in shock ignition lies near the boundary between ablative and heat front regimes. Moreover, simulations indicate that non-local effects are significant in the heat front regime and might lead to increased efficiency by driving the shock more effectively and reducing heat losses to the plasma corona.
Üliõpilasteatrid - teistmoodi teater / Kalev Kudu
Kudu, Kalev, 1961-
2007-01-01
Üliõpilasteatrite VI maailmakongressist 21. - 26. juulini Urbinos Itaalias. Autor oma ettekandest teemal "Üliõpilasteater kui mäss. Üliõpilasteatrite eriline missioon globaliseeruvas maailmas". Lühiintervjuu Liege'i ülikooli professori, üliõpilasteatri kunstilise juhi ja Rahvusvahelise Üliõpilasteatrite Liidu (AITU) esimehe Robert Germayga. Etendustest: "Shahrazad - neitsi Bagdadist" (Bologna ülikool, Itaalia"), "Mbomo-mvet" (Yaounde ülikool, Kamerun), "The Believed Dead" (Brescia Katoliiklik Ülikool, Itaalia), "Teenrid" (Teatro Verga, Milano ülikool, Itaalia), "Antigone" (Ateena ülikool, Kreeka), "Tilt!" (Teatro Aenigma, Urbino ülikool, Itaalia), "Paroodia" (Milano ja Urbino ülikoolide üliõpilased), "Erose tiivad" (Saloniki ülikool, Kreeka), "Kolmas laps" (Long Islandi ülikool, USA), "Lee-Oki lugu" (Hoseo ülikool, Lõuna-Korea), "Ülikond" (Vilniuse Tehnikaülikool, Leedu)
Takayama, Kazuyoshi
1993-05-01
This paper describes a summary of a research project for the development of extracorporeal shock wave lithotripsy (ESWL), which has been carried out, under close collaboration between the Shock Wave Research Center of Tohoku University and the School of Medicine, Tohoku University. The ESWL is a noninvasive clinical treatment of disintegrating human calculi and one of the most peaceful applications of shock waves. Underwater spherical shock waves were generated by explosion of microexplosives. Characteristics of the underwater shock waves and of ultrasound focusing were studied by means of holographic interferometric flow visualization and polyvinyliden-difluoride (PVDF) pressure transducers. These focused pressures, when applied to clinical treatments, could effectively and noninvasively disintegrate urinary tract stones or gallbladder stones. However, despite clincal success, tissue damage occurs during ESWL treatments, and the possible mechanism of tissue damage is briefly described.
Shock dynamics of weak imploding cylindrical and spherical shock waves with non-ideal gas effects
International Nuclear Information System (INIS)
Anand, R K
2013-01-01
The author (Anand 2012 Astrophys. Space Sci. 342 377–88) recently obtained jump relations across a shock front in non-ideal gas flow taking into consideration the equation of state for a non-ideal gas as given by Landau and Lifshitz. In this paper an analytical solution for one-dimensional adiabatic flow behind weak converging shock waves propagating in a non-ideal gas is obtained by using Whitham's (1974 Linear and Nonlinear Waves (New York: Wiley)) geometrical shock dynamics approach. The effects of an increase in (i) the propagation distance from the centre of convergence, (ii) the non-idealness parameter and (iii) the adiabatic index of the gas, on the shock velocity, pressure, density, particle velocity, adiabatic compressibility and the change in entropy across the shock front, are analyzed. The results provided a clear picture of whether and how the non-idealness parameter and the adiabatic index affect the flow field behind the imploding shock front. (paper)
A Li+-conductive microporous carbon–sulfur composite for Li-S batteries
International Nuclear Information System (INIS)
Zhang, Wenhua; Qiao, Dan; Pan, Jiaxin; Cao, Yuliang; Yang, Hanxi; Ai, Xinping
2013-01-01
Highlights: ► A carbon–sulfur composite was prepared by vaporizing sulfur into the nanopores of Li + -conductive carbon microspheres. ► The redox reaction of S 8 molecules embedded in the nanopores of carbon microspheres proceeds through a solid–solid mechanism at the S/C interfaces. ► The carbon–sulfur composite exhibits a stable cycling performance and a superior high coulombic efficiency of 100%. - Abstract: In this paper, we propose a new strategy to develop high performance sulfur electrode by impregnating sulfur into the micropores of a Li + -insertable carbon matrix with the simultaneous use of a carbonate electrolyte, which does not dissolve polysulfides, to restrain the solution of the reaction intermediates of sulfur. To proof this concept, we prepared a Li + -insertable microporous carbon–sulfur composite by vaporizing sulfur into the micropores of the nanofiber-wired carbon microspheres. The experimental results demonstrate that, in the carbonate electrolyte of 1 M LiPF 6 /PC-EC-DEC, such S/C composite electrode exhibits not only stable cycling performance with a reversible capacity of 720 mAh g −1 after 100 cycles, but also superior high coulombic efficiency of ∼100% upon extended cycling (except the first three cycles). The structural and electrochemical analysis indicates that the improved electrochemical behaviors of the S/C composite arise from a new reaction mechanism, in which Li + ions and electrons transport through the carbon matrix into the interior of the cathode and then react with the embedded sulfur in the S/C solid–solid interfaces, avoiding the solution of the intermediates into the bulk electrolyte. More significantly, the structural design and working mechanism of such a sulfur cathode could be extended to a variety of poorly conductive and easily soluble redox-active materials for battery applications.
Measurement of Li target thickness in the EVEDA Li Test Loop
Energy Technology Data Exchange (ETDEWEB)
Kanemura, Takuji, E-mail: kanemura.takuji@jaea.go.jp [Japan Atomic Energy Agency, 4002 Narita, O-arai, Higashi-Ibaraki-gun, Ibaraki 311-1393 (Japan); Kondo, Hiroo; Furukawa, Tomohiro; Hirakawa, Yasushi [Japan Atomic Energy Agency, 4002 Narita, O-arai, Higashi-Ibaraki-gun, Ibaraki 311-1393 (Japan); Hoashi, Eiji; Yoshihashi, Sachiko; Horiike, Hiroshi [Osaka University, 2-1 Yamada-oka, Suita, Osaka 565-0871 (Japan); Wakai, Eiichi [Japan Atomic Energy Agency, 4002 Narita, O-arai, Higashi-Ibaraki-gun, Ibaraki 311-1393 (Japan)
2015-10-15
Highlights: • The objective is to validate stability of the IFMIF liquid Li target flowing at 15 m/s. • Design requirement of target thickness fluctuation is ±1 mm. • Mean and maximum wave amplitude are 0.26 and 1.46 mm, respectively. • Average thickness can be well predicted with developed analytical model. • Li target was adequately stable and satisfied design requirement. - Abstract: A high-speed (nominal: 15 m/s, range: 10–16 m/s) liquid lithium wall jet is planned to serve as the target for two 40 MeV and 125 mA deuteron beams in the International Fusion Materials Irradiation Facility (IFMIF). The design requirement of target thickness stability is 25 ± 1 mm under a vacuum of 10{sup −3} Pa. This paper presents the results of the target thickness measurement conducted in the EVEDA Li Test Loop under a wide range of conditions including the IFMIF condition (target speed of 10, 15, and 20 m/s; vacuum pressure of 10{sup −3} Pa; and Li temperature of 250 °C). For measurement, we use a laser probe method that we developed in advance; this method generates statistical measurements method using a laser distance meter. The measurement results obtained under the IFMIF nominal condition (15 m/s, 10{sup −3} Pa, 250 °C) at the IFMIF beam center are as follows: average target thickness = 26.08 ± 0.09 mm (2σ), mean wave amplitude = 0.26 ± 0.01 mm (2σ), and maximum wave amplitude = 1.46 ± 0.25 mm (2σ). Of the total wave components, 99.7% are within the design requirement. The analytically predicted target thickness is in excellent agreement with the experimental data, resulting in successful characterization of the Li target thickness.
Are lithium niobate (LiNbO{sub 3}) and lithium tantalate (LiTaO{sub 3}) ferroelectrics bioactive?
Energy Technology Data Exchange (ETDEWEB)
Vilarinho, Paula Maria, E-mail: paula.vilarinho@ua.pt; Barroca, Nathalie; Zlotnik, Sebastian; Félix, Pedro; Fernandes, Maria Helena
2014-06-01
The use of functional materials, such as ferroelectrics, as platforms for tissue growth in situ or ex situ, is new and holds great promise. But the usage of materials in any bioapplication requires information on biocompatibility and desirably on bioactive behavior when bone tissue engineering is envisaged. Both requirements are currently unknown for many ferroelectrics. Herein the bioactivity of LiNbO{sub 3} and LiTaO{sub 3} is reported. The formation of apatite-like structures on the surface of LiNbO{sub 3} and LiTaO{sub 3} powders after immersion in simulated body fluid (SBF) for different soaking periods indicates their bioactive potential. The mechanism of apatite formation is suggested. In addition, the significant release of lithium ions from the ferroelectric powders in the very first minutes of soaking in SBF is examined and ways to overcome this likely hurdle addressed. - Highlights: • LiNbO{sub 3} and LiTaO{sub 3} are bioactive ferroelectrics. • Cauliflower apatite type structures indicative of in-vitro bioactivity of LiNbO{sub 3} and LiTaO{sub 3.} • Negative surface charges anchor Ca{sup 2+} to which PO{sub 4}{sup 3−} attracts forming apatite structure nuclei. • Use of ferroelectrics as platforms for tissue growth in situ or ex situ is new and holds great promise.
Nanostructural evolution and behavior of H and Li in ion-implanted γ-LiAlO 2
Energy Technology Data Exchange (ETDEWEB)
Jiang, Weilin; Zhang, Jiandong; Edwards, Danny J.; Overman, Nicole R.; Zhu, Zihua; Price, Lloyd; Gigax, Jonathan; Castanon, Elizabeth; Shao, Lin; Senor, David J.
2017-10-01
In-situ He+ ion irradiation is performed under a helium ion microscope to study nanostructural evolution in polycrystalline gamma-LiAlO2 pellets. Various locations within a grain, across grain boundaries and at a cavity are selected. The results exhibit He bubble formation, grain-boundary cracking, nanoparticle agglomeration, increasing surface brightness with dose, and material loss from the surface. Similar brightening effects at grain boundaries are also observed under a scanning electron microscope. Li diffusion and loss from polycrystalline gamma-LiAlO2 is faster than its monocrystalline counterpart during H2+ ion implantation at elevated temperatures. There is also more significant H diffusion and release from polycrystalline pellets during thermal annealing of 300 K implanted samples. Grain boundaries and cavities could provide a faster pathway for H and Li diffusion. H release is slightly faster from the 573 K implanted monocrystalline gamma-LiAlO2 during annealing at 773 K. Metal hydrides could be formed preferentially along the grain boundaries to immobilize hydrogen.
Electrochemical formation of AlN in molten LiCl-KCl-Li{sub 3}N systems
Energy Technology Data Exchange (ETDEWEB)
Goto, Takuya [Department of Fundamental Energy Science, Graduate School of Energy Science, Kyoto University, Sakyo, Kyoto 606-8501 (Japan)]. E-mail: goto@energy.kyoto-u.ac.jp; Iwaki, Takayuki [Department of Fundamental Energy Science, Graduate School of Energy Science, Kyoto University, Sakyo, Kyoto 606-8501 (Japan); Ito, Yasuhiko [Department of Fundamental Energy Science, Graduate School of Energy Science, Kyoto University, Sakyo, Kyoto 606-8501 (Japan)
2005-01-30
Electrochemical formation of aluminum nitride was investigated in molten LiCl-KCl-Li{sub 3}N systems at 723 K. When Al was anodically polarized at 1.0 V (versus Li{sup +}/Li), oxidation of nitride ions proceeded to form adsorbed nitrogen atoms, which reacted with the surface to form AlN film. The obtained nitrided film had a thickness of sub-micron order. The obtained nitrided layer consisted of two regions; the outer layer involving AlN and aluminum oxynitride and the inner layer involving metallic Al and AlN. When Al electrode was anodically polarized at 2.0 V, anodic dissolution of Al electrode occurred to give aluminum ions, which reacted with nitride ions in the melt to produce AlN particles (1-5 {mu}m of diameter) of wurtzite structure.
Li+ transport properties of W substituted Li7La3Zr2O12 cubic lithium garnets
Directory of Open Access Journals (Sweden)
L. Dhivya
2013-08-01
Full Text Available Lithium garnet Li7La3Zr2O12 (LLZ sintered at 1230 °C has received considerable importance in recent times as result of its high total (bulk + grain boundary ionic conductivity of 5 × 10−4 S cm−1 at room temperature. In this work we report Li+ transport process of Li7−2xLa3Zr2−xWxO12 (x = 0.3, 0.5 cubic lithium garnets. Among the investigated compounds, Li6.4La3Zr1.7W0.3O12 sintered relatively at lower temperature 1100 °C exhibits highest room temperature (30 °C total (bulk + grain boundary ionic conductivity of 7.89 × 10−4 S cm−1. The temperature dependencies of the bulk conductivity and relaxation frequency in the bulk are governed by the same activation energy. Scaling the conductivity spectra for both Li6.4La3Zr1.7W0.3O12 and Li6La3Zr1.5W0.5O12 sample at different temperatures merges on a single curve, which implies that the relaxation dynamics of charge carriers is independent of temperature. The shape of the imaginary part of the modulus spectra suggests that the relaxation processes are non-Debye in nature. The present studies supports the prediction of optimum Li+ concentration required for the highest room temperature Li+ conductivity in LixLa3M2O12 is around x = 6.4 ± 0.1.
Energy Technology Data Exchange (ETDEWEB)
Choi, Daiwon; Wang, Donghai; Viswanathan, Vish V.; Wang, Wei; Nie, Zimin; Zhang, Ji-Guang; Graff, Gordon L.; Liu, Jun; Yang, Zhenguo [Pacific Northwest National Laboratory, 902 Battelle Boulevard, P.O. Box 999, Richland, WA 99352 (United States); Bae, In-Tae [Small Scale Systems Integration and Packaging Center, State University of New York at Binghamton, P.O. Box 6000, Binghamton, NY 13902 (United States); Duong, Tien [US Departments of Energy, 1000 Independence Ave., Washington, DC 20858 (United States)
2010-03-15
Li-ion batteries made from LiFePO{sub 4} cathode and anatase TiO{sub 2}/graphene composite anode were investigated for potential application in stationary energy storage. Fine-structured LiFePO{sub 4} was synthesized by a novel molten surfactant approach whereas anatase TiO{sub 2}/graphene nanocomposite was prepared via self-assembly method. The full cell that operated at 1.6 V demonstrated negligible fade even after more than 700 cycles at measured 1 C rate. While with relative lower energy density than traditional Li-ion chemistries interested for vehicle applications, the Li-ion batteries based on LiFePO{sub 4}/TiO{sub 2} combination potentially offers long life and low cost, along with safety, all which are critical to the stationary applications. (author)
Shock wave interaction with turbulence: Pseudospectral simulations
International Nuclear Information System (INIS)
Buckingham, A.C.
1986-01-01
Shock waves amplify pre-existing turbulence. Shock tube and shock wave boundary layer interaction experiments provide qualitative confirmation. However, shock pressure, temperature, and rapid transit complicate direct measurement. Computational simulations supplement the experimental data base and help isolate the mechanisms responsible. Simulations and experiments, particularly under reflected shock wave conditions, significantly influence material mixing. In these pseudospectral Navier-Stokes simulations the shock wave is treated as either a moving (tracked or fitted) domain boundary. The simulations assist development of code mix models. Shock Mach number and pre-existing turbulence intensity initially emerge as key parameters. 20 refs., 8 figs
Converging shocks in elastic-plastic solids.
Ortega, A López; Lombardini, M; Hill, D J
2011-11-01
We present an approximate description of the behavior of an elastic-plastic material processed by a cylindrically or spherically symmetric converging shock, following Whitham's shock dynamics theory. Originally applied with success to various gas dynamics problems, this theory is presently derived for solid media, in both elastic and plastic regimes. The exact solutions of the shock dynamics equations obtained reproduce well the results obtained by high-resolution numerical simulations. The examined constitutive laws share a compressible neo-Hookean structure for the internal energy e=e(s)(I(1))+e(h)(ρ,ς), where e(s) accounts for shear through the first invariant of the Cauchy-Green tensor, and e(h) represents the hydrostatic contribution as a function of the density ρ and entropy ς. In the strong-shock limit, reached as the shock approaches the axis or origin r=0, we show that compression effects are dominant over shear deformations. For an isothermal constitutive law, i.e., e(h)=e(h)(ρ), with a power-law dependence e(h) is proportional to ρ(α), shock dynamics predicts that for a converging shock located at r=R(t) at time t, the Mach number increases as M is proportional to [log(1/R)](α), independently of the space index s, where s=2 in cylindrical geometry and 3 in spherical geometry. An alternative isothermal constitutive law with p(ρ) of the arctanh type, which enforces a finite density in the strong-shock limit, leads to M is proportional to R(-(s-1)) for strong shocks. A nonisothermal constitutive law, whose hydrostatic part e(h) is that of an ideal gas, is also tested, recovering the strong-shock limit M is proportional to R(-(s-1)/n(γ)) originally derived by Whitham for perfect gases, where γ is inherently related to the maximum compression ratio that the material can reach, (γ+1)/(γ-1). From these strong-shock limits, we also estimate analytically the density, radial velocity, pressure, and sound speed immediately behind the shock. While the
Experimental methods of shock wave research
Seiler, Friedrich
2016-01-01
This comprehensive and carefully edited volume presents a variety of experimental methods used in Shock Waves research. In 14 self contained chapters this 9th volume of the “Shock Wave Science and Technology Reference Library” presents the experimental methods used in Shock Tubes, Shock Tunnels and Expansion Tubes facilities. Also described is their set-up and operation. The uses of an arc heated wind tunnel and a gun tunnel are also contained in this volume. Whenever possible, in addition to the technical description some typical scientific results obtained using such facilities are described. Additionally, this authoritative book includes techniques for measuring physical properties of blast waves and laser generated shock waves. Information about active shock wave laboratories at different locations around the world that are not described in the chapters herein is given in the Appendix, making this book useful for every researcher involved in shock/blast wave phenomena.
Exploratory laser-driven shock wave studies
International Nuclear Information System (INIS)
Solem, J.C.; Veeser, L.R.
1977-11-01
We show the results of a feasibility study for investigating shock structure and for measuring equation-of-state parameters using high-energy, short-pulse lasers. We discuss the temporal and spatial structure of the luminosity from laser-driven shock unloading in aluminum foils. We demonstrate that shock velocity can be measured by observing the time interval between shock emergence across two thicknesses and show data for shocks of 1.3 and 2.1 Mbar. The fact that we observe shock fronts cleanly breaking through steps as small as 3 μm indicates that the shock front thickness is very small in the few megabar region; this is the first experimental verification that these fronts are not more than a few micrometers thick. We present approximate measurements of free-surface velocity. Finally, we speculate on the use of these techniques to obtain detailed equation-of-state data
Developing New Electrolytes for Advanced Li-ion Batteries
McOwen, Dennis Wayne
The use of renewable energy sources is on the rise, as new energy generating technologies continue to become more efficient and economical. Furthermore, the advantages of an energy infrastructure which relies more on sustainable and renewable energy sources are becoming increasingly apparent. The most readily available of these renewable energy sources, wind and solar energy in particular, are naturally intermittent. Thus, to enable the continued expansion and widespread adoption of renewable energy generating technology, a cost-effective energy storage system is essential. Additionally, the market for electric/hybrid electric vehicles, which both require efficient energy storage, continues to grow as more consumers seek to reduce their consumption of gasoline. These vehicles, however, remain quite expensive, due primarily to costs associated with storing the electrical energy. High-voltage and thermally stable Li-ion battery technology is a promising solution for both grid-level and electric vehicle energy storage. Current limitations in materials, however, limit the energy density and safe operating temperature window of the battery. Specifically, the state-of-the-art electrolyte used in Li-ion batteries is not compatible with recently developed high-voltage positive electrodes, which are one of the most effectual ways of increasing the energy density. The electrolyte is also thermally unstable above 50 °C, and prone to thermal runaway reaction if exposed to prolonged heating. The lithium salt used in such electrolytes, LiPF6, is a primary contributor to both of these issues. Unfortunately, an improved lithium salt which meets the myriad property requirements for Li-ion battery electrolytes has eluded researchers for decades. In this study, a renewed effort to find such a lithium salt was begun, using a recently developed methodology to rapidly screen for desirable properties. Four new lithium salts and one relatively new but uncharacterized lithium salt were
Wu, Zhongzhen; Ji, Shunping; Liu, Tongchao; Duan, Yandong; Xiao, Shu; Lin, Yuan; Xu, Kang; Pan, Feng
2016-10-12
Layered transition-metal oxides (Li[Ni x Mn y Co z ]O 2 , NMC, or NMCxyz) due to their poor stability when cycled at a high operating voltage (>4.5 V) have limited their practical applications in industry. Earlier researches have identified Mn(II)-dissolution and some parasitic reactions between NMC surface and electrolyte, especially when NMC is charged to a high potential, as primarily factors responsible for the fading. In our previous work, we have achieved a capacity of NMC active material close to theoretical value and optimized its cycling performance by a depolarized carbon nanotubes (CNTs) network and an unique "pre-lithiation process" that generates an in situ organic coating (∼40 nm) to prevent Mn(II) dissolution and minimize the parasitic reactions. Unfortunately, this organic coating is not durable enough during a long-term cycling when the cathode operates at a high potential (>4.5 V). This work attempts to improve the surface protection of the NMC532 particles by applying an active inorganic coating consisting of nanosized- and crystal-orientated LiFePO 4 (LFP) (about 50 nm, exposed (010) face) to generate a core-shell nanostructure of Li(Ni x Mn y Co z )O 2 @LiFePO 4 . Transmission electron microscopy (TEM) and etching X-ray photoelectron spectroscopy have confirmed an intimate contact coating (about 50 nm) between the original structure of NMC and LFP single-particle with atomic interdiffusion at the core-shell interface, and an array of interconnected aligned Li + tunnels are observed at the interface by cross-sectional high-resolution TEM, which were formed by ball-milling and then strictly controlling the temperature below 100 °C. Batteries based on this modified NMC cathode material show a high reversible capacity when cycled between 3.0 and 4.6 V during a long-term cycling.
Nuclear reaction rates and primordial 6Li
International Nuclear Information System (INIS)
Nollett, K.M.; Schramm, D.N.; Lemoine, M.; Schramm, D.N.; Lemoine, M.; Schramm, D.N.
1997-01-01
We examine the possibility that big-bang nucleosynthesis (BBN) may produce nontrivial amounts of 6 Li. If a primordial component of this isotope could be observed, it would provide a new fundamental test of big-bang cosmology, as well as new constraints on the baryon density of the universe. At present, however, theoretical predictions of the primordial 6 Li abundance are extremely uncertain due to difficulties in both theoretical estimates and experimental determinations of the 2 H(α,γ) 6 Li radiative capture reaction cross section. We also argue that present observational capabilities do not yet allow the detection of primeval 6 Li in very metal-poor stars of the galactic halo. However, if the critical cross section is very high in its plausible range and the baryon density is relatively low, then improvements in 6 Li detection capabilities may allow the establishment of 6 Li as another product of BBN. It is also noted that a primordial 6 Li detection could help resolve current concerns about the extragalactic D/H determination. copyright 1997 The American Physical Society
Inappropriate shocks in the subcutaneous ICD
DEFF Research Database (Denmark)
Olde Nordkamp, Louise R A; Brouwer, Tom F; Barr, Craig
2015-01-01
shocks have been reported. METHODS: We analyzed the incidence, predictors and management of inappropriate shocks in the EFFORTLESS S-ICD Registry, which collects S-ICD implantation information and follow-up data from clinical centers in Europe and New Zealand. RESULTS: During a follow-up of 21 ± 13...... xyphoid to V6) reduced the risk. Reprogramming or optimization of SVT treatment after the first clinical event of inappropriate shock was successful in preventing further inappropriate shocks for cardiac oversensing and SVT events. CONCLUSIONS: Inappropriate shocks, mainly due to cardiac oversensing...
Transfer of 6Li break-up fragments at 6Li projectile energies far above the coulomb barrier
International Nuclear Information System (INIS)
Neumann, B.; Buschmann, J.; Rebel, H.; Gils, H.J.; Klewe-Nebenius, H.
1979-05-01
Transfer of beam-velocity fragments has been experimentally investigated in 6 Li induced reactions on 208 Pb and 209 Bi in the energy range Esub(Li) = 60-156 MeV. The experimental techniques involve the observation of the target residues and measurements of the recoil ranges of heavy residual nuclei produced by charged particle bombardment. The determination of the recoil energy enables the discrimination of different reaction paths leading to the same residual nuclei. ( 6 Li, xn+p) excitation functions prove to be very similar to (α,(x-1)n) reactions at Esub(α) approximately 2/3 x Esub(Li). The results present experimental evidence for a particular reaction type indicated in previous experiments: Dissociation of the 6 Li projectile with capture of the beam-velocity alpha particle indicating an (α,xn) reaction ('internal break-up'). (orig.) [de
International Nuclear Information System (INIS)
Xu, Guigui; Zhong, Kehua; Zhang, Jian-Min; Huang, Zhigao
2014-01-01
We present a first-principles calculation for the electronic and Li-ion diffusion properties of the LiFePO 4 (010) surface modified by sulfur. The calculated formation energy indicates that the sulfur adsorption on the (010) surface of the LiFePO 4 is energetically favored. Sulfur is found to form Fe-S bond with iron. A much narrower band gap (0.67 eV) of the sulfur surface-modified LiFePO 4 [S-LiFePO 4 (010)] is obtained, indicating the better electronic conductive properties. By the nudged elastic band method, our calculations show that the activation energy of Li ions diffusion along the one-dimensional channel on the surface can be effectively reduced by sulfur surface modification. In addition, the surface diffusion coefficient of S-LiFePO 4 (010) is estimated to be about 10 −11 (cm 2 /s) at room temperature, which implies that sulfur modification will give rise to a higher Li ion carrier mobility and enhanced electrochemical performance
DEFF Research Database (Denmark)
Plerdsranoy, Praohatsorn; Javadian-Deylami, Seyd Payam; Jensen, Nicholai Daugaard
2017-01-01
To enhance volumetric hydrogen capacity for on-board fuel cells, compaction of LiAlH4-LiBH4 nanoconfined in activated carbon nanofibers (ACNF) is for the first time proposed. Loose powders of milled and nanoconfined LiAlH4-LiBH4 samples are compacted under 976 MPa to obtain the pellet samples...... with thickness and diameter of ∼1.20–1.30 and 8.0 mm, respectively. Dehydrogenation temperature of milled LiAlH4-LiBH4 increases from 415 to 434 °C due to compaction, while those of both compacted and loose powder samples of nanoconfined LiAlH4-LiBH4 are lower at comparable temperature of 330–335 °C. Hydrogen...
2014 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Cedar River Watershed (Delivery 2)
National Oceanic and Atmospheric Administration, Department of Commerce — In September 2013, WSI, a Quantum Spatial company (QSI), was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...
2014 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Cedar River Watershed (Delivery 1)
National Oceanic and Atmospheric Administration, Department of Commerce — In September 2013, WSI, a Quantum Spatial company (QSI), was contracted by the Puget Sound LiDAR Consortium (PSLC) to collect Light Detection and Ranging (LiDAR)...
Oscillating nonlinear acoustic shock waves
DEFF Research Database (Denmark)
Gaididei, Yuri; Rasmussen, Anders Rønne; Christiansen, Peter Leth
2016-01-01
We investigate oscillating shock waves in a tube using a higher order weakly nonlinear acoustic model. The model includes thermoviscous effects and is non isentropic. The oscillating shock waves are generated at one end of the tube by a sinusoidal driver. Numerical simulations show that at resona......We investigate oscillating shock waves in a tube using a higher order weakly nonlinear acoustic model. The model includes thermoviscous effects and is non isentropic. The oscillating shock waves are generated at one end of the tube by a sinusoidal driver. Numerical simulations show...... polynomial in the space and time variables, we find analytical approximations to the observed single shock waves in an infinitely long tube. Using perturbation theory for the driven acoustic system approximative analytical solutions for the off resonant case are determined....
Overexpression of human SOD1 improves survival of mice susceptible to endotoxic shock
Directory of Open Access Journals (Sweden)
Charchaflieh J
2012-07-01
Full Text Available Jean Charchaflieh,1,2 Georges I Labaze,1 Pulsar Li,1 Holly Van Remmen,3 Haekyung Lee,1 Helen Stutz,1 Arlan Richardson,3 Asher Emanuel,1 Ming Zhang1,41Department of Anesthesiology, State University of New York (SUNY Downstate Medical Center, New York, NY, USA; 2Department of Anesthesiology, Yale University School of Medicine, New Haven, CT, USA; 3Barshop Center for Longevity and Aging Studies, University of Texas Health Science Center at San Antonio, San Antonio, TX, USA; 4Department of Cell Biology, State University of New York (SUNY Downstate Medical Center, New York, NY, USABackground: Protective effects of the antioxidant enzyme Cu-Zn superoxide dismutase (SOD1 against endotoxic shock have not been demonstrated in animal models. We used a murine model to investigate whether overexpression of SOD1 protects against endotoxic shock, and whether the genetic background of SOD1 affects its effective protective effects and susceptibility to endotoxic shock.Methods: Transgenic (tg mice overexpressing human SOD1 and control mice were divided into four groups based on their genetic background: (1 tg mice with mixed genetic background (tg-JAX; (2 wild-type (WT littermates of tg-JAX strain (WT-JAX; (3 tg mice with C57BL/6J background (tg-TX; (4 WT littermates of tg-TX strain (WT-TX. Activity of SOD1 in the intestine, heart, and liver of tg and control mice was confirmed using a polyacrylamide activity gel. Endotoxic shock was induced by intraperitoneal injection of lipopolysaccharide. Survival rates over 120 hours (mean, 95% confidence interval were analyzed using Kaplan–Meier survival curves.Results: Human SOD1 enzymatic activities were significantly higher in the intestine, heart, and liver of both tg strains (tg-JAX and tg-TX compared with their WT littermates (WT-JAX and WT-TX, respectively. Interestingly, the endogenous SOD1 activities in tg-JAX mice were decreased compared with their WT littermates (WT-JAX, but such aberrant changes were not
International Nuclear Information System (INIS)
Bershader, D.; Hanson, R.
1986-01-01
A detailed survey is presented of shock tube experiments, theoretical developments, and applications being carried out worldwide. The discussions explore shock tube physics and the related chemical, physical and biological science and technology. Extensive attention is devoted to shock wave phenomena in dusty gases and other multiphase and heterogeneous systems, including chemically reactive mixtures. Consideration is given to techniques for measuring, visualizing and theoretically modeling flowfield, shock wave and rarefaction wave characteristics. Numerical modeling is explored in terms of the application of computational fluid dynamics techniques to describing flowfields in shock tubes. Shock interactions and propagation, in both solids, fluids, gases and mixed media are investigated, along with the behavior of shocks in condensed matter. Finally, chemical reactions that are initiated as the result of passage of a shock wave are discussed, together with methods of controlling the evolution of laminar separated flows at concave corners on advanced reentry vehicles
Revision of the Li13Si4 structure
Directory of Open Access Journals (Sweden)
Thomas F. Fässler
2013-12-01
Full Text Available Besides Li17Si4, Li16.42Si4, and Li15Si4, another lithium-rich representative in the Li–Si system is the phase Li13Si4 (tridecalithium tetrasilicide, the structure of which has been determined previously [Frank et al. (1975. Z. Naturforsch. Teil B, 30, 10–13]. A careful analysis of X-ray diffraction patterns of Li13Si4 revealed discrepancies between experimentally observed and calculated Bragg positions. Therefore, we redetermined the structure of Li13Si4 on the basis of single-crystal X-ray diffraction data. Compared to the previous structure report, decisive differences are (i the introduction of a split position for one Li site [occupancy ratio 0.838 (7:0.162 (7], (ii the anisotropic refinement of atomic displacement parameters for all atoms, and (iii a high accuracy of atom positions and unit-cell parameters. The asymmetric unit of Li13Si4 contains two Si and seven Li atoms. Except for one Li atom situated on a site with symmetry 2/m, all other atoms are on mirror planes. The structure consists of isolated Si atoms as well as Si–Si dumbbells surrounded by Li atoms. Each Si atom is either 12- or 13-coordinated. The isolated Si atoms are situated in the ab plane at z = 0 and are strictly separated from the Si–Si dumbbells at z = 0.5.
Initial conditions of radiative shock experiments
International Nuclear Information System (INIS)
Kuranz, C. C.; Drake, R. P.; Krauland, C. M.; Marion, D. C.; Grosskopf, M. J.; Rutter, E.; Torralva, B.; Holloway, J. P.; Bingham, D.; Goh, J.; Boehly, T. R.; Sorce, A. T.
2013-01-01
We performed experiments at the Omega Laser Facility to characterize the initial, laser-driven state of a radiative shock experiment. These experiments aimed to measure the shock breakout time from a thin, laser-irradiated Be disk. The data are then used to inform a range of valid model parameters, such as electron flux limiter and polytropic γ, used when simulating radiative shock experiments using radiation hydrodynamics codes. The characterization experiment and the radiative shock experiment use a laser irradiance of ∼7 × 10 14 W cm −2 to launch a shock in the Be disk. A velocity interferometer and a streaked optical pyrometer were used to infer the amount of time for the shock to move through the Be disk. The experimental results were compared with simulation results from the Hyades code, which can be used to model the initial conditions of a radiative shock system using the CRASH code
National Oceanic and Atmospheric Administration, Department of Commerce — TASK NAME:(NRCS) Saginaw Bay, MI LiDAR LiDAR Data Acquisition and Processing Production Task USGS Contract No. G10PC00057 Task Order No. G11PD01254 Woolpert Order...
Zeilinger, Michael; Fässler, Thomas F
2014-10-28
A reinvestigation of the lithium-rich section of the Li-Ge phase diagram reveals the existence of two new phases, Li17Ge4 and Li4.10Ge (Li16.38Ge4). Their structures are determined by X-ray diffraction experiments of large single crystals obtained from equilibrated melts with compositions Li95Ge5 and Li85Ge15. Excess melt is subsequently removed through isothermal centrifugation at 400 °C and 530 °C, respectively. Li17Ge4 crystallizes in the space group F4[combining macron]3m (a = 18.8521(3) Å, V = 6700.1(2) Å(3), Z = 20, T = 298 K) and Li4.10Ge (Li16.38Ge4) in Cmcm (a = 4.5511(2) Å, b = 22.0862(7) Å, c = 13.2751(4) Å, V = 1334.37(8) Å(3), Z = 16, T = 123 K). Both phases are isotypic with their Si counterparts and are further representative of the Li17Pb4 and Li4.11Si structure types. Additionally, the solid solutions Li17Si4-xGex follows Vegard's law. A comparison of the GeLin coordination polyhedra shows that isolated Ge atoms are 13- and 14-coordinated in Li17Ge4, whereas in Li16.38Ge4 the Ge atoms possess coordination numbers 12 and 13. Regarding the thermodynamic stability, Li16.38Ge4 is assigned a high-temperature phase existing between ∼400 °C and 627 °C, whereas Li17Ge4 decomposes peritectically at 520-522 °C. Additionally, the decomposition of Li16.38Ge4 below ∼400 °C was found to be very sluggish. These findings are manifested by differential scanning calorimetry, long-term annealing experiments and the results from melt equilibration experiments. Interestingly, the thermodynamic properties of the lithium-rich tetrelides Li17Tt4 and Li4.1Tt (Li16.4Tt4) are very similar (Tt = Si, Ge). Besides Li15Tt4, Li14Tt6, Li12Tt7, and LiTt, the title compounds are further examples of isotypic tetrelides in the systems Li-Tt.
Li+-Permeable Film on Lithium Anode for Lithium Sulfur Battery.
Yang, Yan-Bo; Liu, Yun-Xia; Song, Zhiping; Zhou, Yun-Hong; Zhan, Hui
2017-11-08
Lithium-sulfur (Li-S) battery is an important candidate for next-generation energy storage. However, the reaction between polysulfide and lithium (Li) anode brings poor cycling stability, low Coulombic efficiency, and Li corrosion. Herein, we report a Li protection technology. Li metal was treated in crown ether containing electrolyte, and thus, treated Li was further used as the anode in Li-S cell. Due to the coordination between Li + and crown ether, a Li + -permeable film can be formed on Li, and the film is proved to be able to block the detrimental reaction between Li anode and polysulfide. By using the Li anode pretreated in 2 wt % B15C5-containing electrolyte, Li-S cell exhibits significantly improved cycling stability, such as∼900 mAh g -1 after 100 cycles, and high Coulombic efficiency of>93%. In addition, such effect is also notable when high S loading condition is applied.
Enhanced cycling stability of microsized LiCoO2 cathode by Li4Ti5O12 coating for lithium ion battery
International Nuclear Information System (INIS)
Yi, Ting-Feng; Shu, J.; Yue, Cai-Bo; Zhu, Xiao-Dong; Zhou, An-Na; Zhu, Yan-Rong; Zhu, Rong-Sun
2010-01-01
The effect of Li 4 Ti 5 O 12 (LTO) coating amount on the electrochemical cycling behavior of the LiCoO 2 cathode was investigated at the high upper voltage limit of 4.5 V. Li 4 Ti 5 O 12 (≤5 wt.%) is not incorporated into the host structure and leads to formation of uniform coating. The cycling performance of LiCoO 2 cathode is related with the amount of Li 4 Ti 5 O 12 coating. The initial capacity of the LTO-coated LiCoO 2 decreased with increasing Li 4 Ti 5 O 12 coating amount but showed enhanced cycling properties, compared to those of pristine material. The 3 wt.% LTO-coated LiCoO 2 has the best electrochemical performance, showing capacity retention of 97.3% between 2.5 V and 4.3 V and 85.1% between 2.5 V and 4.5 V after 40 cycles. The coulomb efficiency shows that the surface coating of Li 4 Ti 5 O 12 is beneficial to the reversible intercalation/de-intercalation of Li + . LTO-coated LiCoO 2 provides good prospects for practical application of lithium secondary batteries free from safety issues.
Collisionless Electrostatic Shock Modeling and Simulation
2016-10-21
equations with piston -like boundary conditions gives a solution for the shock behavior. • Assumes cold upstream ions, therefore neglecting shock...temperature ratio (>10) – Wave Train Wavelength – Shock-Front Mach Number – Reflected Ion Beam Velocity Gathering Experiment Data – Double Plasma Device...experimental shock data. • Inconsistencies in published 1969 double -plasma device data hampered validation. Future Work: Extension to Moderately
Experimental investigation of shock wave - bubble interaction
Energy Technology Data Exchange (ETDEWEB)
Alizadeh, Mohsen
2010-04-09
In this work, the dynamics of laser-generated single cavitation bubbles exposed to lithotripter shock waves has been investigated experimentally. The energy of the impinging shock wave is varied in several steps. High-speed photography and pressure field measurements simultaneously with image acquisition provide the possibility of capturing the fast bubble dynamics under the effect of the shock wave impact. The pressure measurement is performed using a fiber optic probe hydrophone (FOPH) which operates based on optical diagnostics of the shock wave propagating medium. After a short introduction in chapter 1 an overview of the previous studies in chapter 2 is presented. The reported literatures include theoretical and experimental investigations of several configurations of physical problems in the field of bubble dynamics. In chapter 3 a theoretical description of propagation of a shock wave in a liquid like water has been discussed. Different kinds of reflection of a shock wave at an interface are taken into account. Undisturbed bubble dynamics as well as interaction between a planar shock wave and an initially spherical bubble are explored theoretically. Some physical parameters which are important in this issue such as the velocity of the shock-induced liquid jet, Kelvin impulse and kinetic energy are explained. The shock waves are generated in a water filled container by a focusing piezoelectric generator. The shock wave profile has a positive part with pulse duration of ∼1 μs followed by a longer tension tail (i.e. ∼3 μs). In chapter 4 high-speed images depict the propagation of a shock wave in the water filled tank. The maximum pressure is also derived for different intensity levels of the shock wave generator. The measurement is performed in the free field (i.e. in the absence of laser-generated single bubbles). In chapter 5 the interaction between lithotripter shock waves and laserinduced single cavitation bubbles is investigated experimentally. An
Fast neutron measurements with 7Li and 6Li enriched CLYC scintillators
International Nuclear Information System (INIS)
Giaz, A.; Blasi, N.; Boiano, C.; Brambilla, S.; Camera, F.; Cattadori, C.; Ceruti, S.; Gramegna, F.; Marchi, T.; Mattei, I.; Mentana, A.; Million, B.; Pellegri, L.; Rebai, M.; Riboldi, S.; Salamida, F.; Tardocchi, M.
2016-01-01
The recently developed Cs 2 LiYCl 6 :Ce (CLYC) crystals are interesting scintillation detectors not only for their gamma energy resolution (<5% at 662 keV) but also for their capability to identify and measure the energy of both gamma rays and fast/thermal neutrons. The thermal neutrons were detected by the 6 Li(n,α)t reaction while for the fast neutrons the 35 Cl(n,p) 35 S and 35 Cl(n,α) 32 P neutron-capture reactions were exploited. The energy of the outgoing proton or α particle scales linearly with the incident neutron energy. The kinetic energy of the fast neutrons can be measured using both the Time Of Flight (TOF) technique and using the CLYC energy signal. In this work, the response to monochromatic fast neutrons (1.9–3.8 MeV) of two CLYC 1″×1″ crystals was measured using both the TOF and the energy signal. The observables were combined to identify fast neutrons, to subtract the thermal neutron background and to identify different fast neutron-capture reactions on 35 Cl, in other words to understand if the detected particle is an α or a proton. We performed a dedicated measurement at the CN accelerator facility of the INFN Legnaro National Laboratories (Italy), where the fast neutrons were produced by impinging a proton beam (4.5, 5.0 and 5.5 MeV) on a 7 LiF target. We tested a CLYC detector 6 Li-enriched at about 95%, which is ideal for thermal neutron measurements, in parallel with another CLYC detector 7 Li-enriched at more than 99%, which is suitable for fast neutron measurements.
Mazumdar, Sumit; Mazumdar, Papiya Guha; Kanjilal, Barun; Singh, Prashant Kumar
2014-01-01
Based on a household survey in Indian Sundarbans hit by tropical cyclone Aila in May 2009, this study tests for evidence and argues that health and climatic shocks are essentially linked forming a continuum and with exposure to a marginal one, coping mechanisms and welfare outcomes triggered in the response is significantly affected. The data for this study is based on a cross-sectional household survey carried out during June 2010. The survey was aimed to assess the impact of cyclone Aila on households and consequent coping mechanisms in three of the worst-affected blocks (a sub-district administrative unit), viz. Hingalganj, Gosaba and Patharpratima. The survey covered 809 individuals from 179 households, cross cutting age and gender. A separate module on health-seeking behaviour serves as the information source of health shocks defined as illness episodes (ambulatory or hospitalized) experienced by household members. Finding reveals that over half of the households (54%) consider that Aila has dealt a high, damaging impact on their household assets. Result further shows deterioration of health status in the period following the incidence of Aila. Finding suggests having suffered multiple shocks increases the number of adverse welfare outcomes by 55%. Whereas, suffering either from the climatic shock (33%) or the health shock (25%) alone increases such risks by a much lesser extent. The multiple-shock households face a significantly higher degree of difficulty to finance expenses arising out of health shocks, as opposed to their counterparts facing only the health shock. Further, these households are more likely to finance the expenses through informal loans and credit from acquaintances or moneylenders. This paper presented empirical evidence on how natural and health shocks mutually reinforce their resultant impact, making coping increasingly difficult and present significant risks of welfare loss, having short as well as long-run development manifestations.
Health shocks and risk aversion.
Decker, Simon; Schmitz, Hendrik
2016-12-01
We empirically assess whether a health shock influences individual risk aversion. We use grip strength data to obtain an objective health shock indicator. In order to account for the non-random nature of our data regression-adjusted matching is employed. Risk preferences are traditionally assumed to be constant. However, we find that a health shock increases individual risk aversion. The finding is robust to a series of sensitivity analyses and persists for at least four years after the shock. Income changes do not seem to be the driving mechanism. Copyright © 2016 Elsevier B.V. All rights reserved.
Shock in the emergency department
DEFF Research Database (Denmark)
Holler, Jon Gitz; Henriksen, Daniel Pilsgaard; Mikkelsen, Søren
2016-01-01
BACKGROUND: The knowledge of the frequency and associated mortality of shock in the emergency department (ED) is limited. The aim of this study was to describe the incidence, all-cause mortality and factors associated with death among patients suffering shock in the ED. METHODS: Population...... failures. Outcomes were annual incidence per 100,000 person-years at risk (pyar), all-cause mortality at 0-7, and 8-90 days and risk factors associated with death. RESULTS: We identified 1646 of 438,191 (0.4 %) ED patients with shock at arrival. Incidence of shock increased from 53.8 to 80.6 cases per 100...
Energy Technology Data Exchange (ETDEWEB)
Frommen, Christoph; Heere, Michael [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway); Riktor, Marit D. [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway); SINTEF Materials and Chemistry, Forskningsveien 1, NO-0314 Oslo (Norway); Sørby, Magnus H. [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway); Hauback, Bjørn C., E-mail: bjorn.hauback@ife.no [Institute for Energy Technology, Physics Department, P.O. Box 40, NO-2027 Kjeller (Norway)
2015-10-05
Highlights: • 6LiBH{sub 4}–RECl{sub 3}–3LiH composites (RE = La, Er) studied for the first time. • Drastically reduced decomposition temperature (300 {sup o}C) compared to LiBH{sub 4} (>400 °C). • Partial reversibility for 6LiBH{sub 4}–LaCl{sub 3}–3LiH: (19% at 340 °C, 10 MPa). • Excellent reversibility for 6LiBH{sub 4}–ErCl{sub 3}–3LiH: (80% at 340 °C, 10 MPa). • Reversibility comparable to that obtained for pure LiBH{sub 4} (76% at 600 °C and 15.5 MPa). - Abstract: Mixtures of 6LiBH{sub 4}–RECl{sub 3}–3LiH (RE = La, Er) have been produced by mechanochemical milling and their structure, thermal decomposition and reversibility have been studied. Hydrogen desorption starts around 300 °C in both composites. Heating to 400 °C yields LaB{sub 6}, ErB{sub 4} and REH{sub 2+δ} as major decomposition products. LiBH{sub 4} is destabilized by REH{sub 2+δ} formed through decomposition of the parent borohydrides LiLa(BH{sub 4}){sub 3}Cl and Er(BH{sub 4}){sub 3}, respectively, and its hydrogen release temperature is reduced by 100 °C as compared to pure ball-milled LiBH{sub 4}. The lanthanum-containing composite releases 4.2 wt.% H between 300 and 350 °C and shows a limited reversibility of ∼20% (340 °C, 10 MPa) probably due to hydrogen uptake by some amorphous boron-containing phases. For 6LiBH{sub 4}–ErCl{sub 3}–3LiH about 3 wt.% H is evolved up to 400 °C. Desorption against 0.5 MPa backpressure results in an increased reversibility (∼80%) as compared to vacuum (∼66%). Rehydrogenation (340 °C, 10 MPa) shows the formation of ErH{sub 3} and LiBH{sub 4} at drastically reduced conditions compared to pure LiBH{sub 4} (>400 °C, >10 MPa)
Formation and control of zinc nitride in a molten LiCl-KCl-Li{sub 3}N system
Energy Technology Data Exchange (ETDEWEB)
Goto, Takuya; Toyoura, Kazuaki; Tsujimura, Hiroyuki; Ito, Yasuhiko
2004-08-25
We investigated a possibility of electrochemical formation and control of zinc nitride in a molten LiCl-KCl-Li{sub 3}N system at 673 K. Zinc nitride films were obtained by means of potentiostatic electrolysis of zinc electrodes in the melt. From XRD analysis, it was confirmed that obtained films consisted of Zn{sub 3}N{sub 2} and LiZnN and that the composition of each film was effected by the applied potential value. In the potential range from 0.75 to 1.6 V (versus Li{sup +}/Li), the ratio of Zn{sub 3}N{sub 2} increased as the applied potential was more positive. Based on the result, we achieved the formation of Zn{sub 3}N{sub 2} film (3-5 {mu}m) in anti-scandium oxide structure (a = 0.977 nm) by means of potentiostatic electrolysis at 1.6 V for 3 h.
The source of real and nominal exchange rate fluctuations in Thailand: Real shock or nominal shock
Le Thanh, Binh
2015-01-01
This paper examines the source of exchange rate fluctuations in Thailand. We employed a structural vector auto-regression (SVAR) model with the long-run neutrality restriction of Blanchard and Quah (1989) to investigate the changes in real and nominal exchange rates from 1994 to 2015. In this paper, we assume that there are two types of shocks which related to exchange rate movements: real shocks and nominal shocks. The empirical analysis indicates that real shocks are the fundamental compon...
Remote shock sensing and notification system
Muralidharan, Govindarajan; Britton, Charles L.; Pearce, James; Jagadish, Usha; Sikka, Vinod K.
2008-11-11
A low-power shock sensing system includes at least one shock sensor physically coupled to a chemical storage tank to be monitored for impacts, and an RF transmitter which is in a low-power idle state in the absence of a triggering signal. The system includes interference circuitry including or activated by the shock sensor, wherein an output of the interface circuitry is coupled to an input of the RF transmitter. The interface circuitry triggers the RF transmitting with the triggering signal to transmit an alarm message to at least one remote location when the sensor senses a shock greater than a predetermined threshold. In one embodiment the shock sensor is a shock switch which provides an open and a closed state, the open state being a low power idle state.
Lv, Long-Xian; Hu, Xin-Jun; Qian, Gui-Rong; Zhang, Hua; Lu, Hai-Feng; Zheng, Bei-Wen; Jiang, Li; Li, Lan-Juan
2014-06-01
This work investigated the effect of the intragastric administration of five lactic acid bacteria from healthy people on acute liver failure in rats. Sprague-Dawley rats were given intragastric supplements of Lactobacillus salivarius LI01, Lactobacillus salivarius LI02, Lactobacillus paracasei LI03, Lactobacillus plantarum LI04, or Pediococcus pentosaceus LI05 for 8 days. Acute liver injury was induced on the eighth day by intraperitoneal injection of 1.1 g/kg body weight D-galactosamine (D-GalN). After 24 h, samples were collected to determine the level of liver enzymes, liver function, histology of the terminal ileum and liver, serum levels of inflammatory cytokines, bacterial translocation, and composition of the gut microbiome. The results indicated that pretreatment with L. salivarius LI01 or P. pentosaceus LI05 significantly reduced elevated alanine aminotransferase and aspartate aminotransferase levels, prevented the increase in total bilirubin, reduced the histological abnormalities of both the liver and the terminal ileum, decreased bacterial translocation, increased the serum level of interleukin 10 and/or interferon-γ, and resulted in a cecal microbiome that differed from that of the liver injury control. Pretreatment with L. plantarum LI04 or L. salivarius LI02 demonstrated no significant effects during this process, and pretreatment with L. paracasei LI03 aggravated liver injury. To the best of our knowledge, the effects of the three species-L. paracasei, L. salivarius, and P. pentosaceus-on D-GalN-induced liver injury have not been previously studied. The excellent characteristics of L. salivarius LI01 and P. pentosaceus LI05 enable them to serve as potential probiotics in the prevention or treatment of acute liver failure.
Curtis, Marah A; Corman, Hope; Noonan, Kelly; Reichman, Nancy E
2013-12-01
We exploited an exogenous health shock-namely, the birth of a child with a severe health condition-to investigate the effect of a life shock on homelessness in large cities in the United States as well as the interactive effects of the shock with housing market characteristics. We considered a traditional measure of homelessness, two measures of housing instability thought to be precursors to homelessness, and a combined measure that approximates the broadened conceptualization of homelessness under the 2009 Homeless Emergency Assistance and Rapid Transition to Housing Act (2010). We found that the shock substantially increases the likelihood of family homelessness, particularly in cities with high housing costs. The findings are consistent with the economic theory of homelessness, which posits that homelessness results from a conjunction of adverse circumstances in which housing markets and individual characteristics collide.
Directory of Open Access Journals (Sweden)
Akram La Kilo
2011-11-01
Full Text Available ABSTRAK Fasa Li2Sc3(PO43 merupakan material konduktor superionik yang dapat diaplikasikan sebagai baterai yang dapat diisi ulang (rechargeable. Ion Li+ dalam struktur Li2Sc3(PO4 dapat mengalami migrasi dari posisi terisi ke posisi kosong. Penelitian ini telah memodelkan migrasi ion Li+ dalam struktur Li2Sc3(PO4 dengan menggunakan metode bond valence sum (BVS. Metode ini dapat memprediksi bilangan oksidasi suatu atom berdasarkan jarak dengan atom-atom tetangga. Source code berbasis BVS yang digunakan adalah JUMPITER yang mensimulasi efek gaya listrik eksternal yang bertindak pada ion litium sehingga nilai BVS litium dapat dipetakan terhadap jarak. Hasil simulasi menunjukkan bahwa konduksi ion Li+ dapat terjadi pada arah [010], [101], dan [120]. Namun, lintasan konduksi ion Li+ lebih mudah terjadi pada arah [120] atau bidang ab dengan nilai maksimum BVS adalah 0,982. ABSTRACT g-phase of Li2Sc3(PO43 is a lithium super ionic conductor which can be applied as a rechargeable lithium battery. Lithium ions of g-Li2Sc3(PO43 can migrate from occupied site to vacant site. In this research, simulation of Li+ ions migration in the structure of g-Li2Sc3(PO43 carried out using bond valence sum (BVS to predict the oxidation state of Li+ion based on the distance of the ion to neighboring atoms. BVS-based code used JUMPITER to simulate the effect of external electrical force acting on the lithium ions to produce the lithium BVS value which can be mapped to the distance. The simulation results shows that Li+ ion conduction can be occurred on [010], [101], and [120] directions. However, the Li ion conduction pathway occur more easily in the direction of [120] or ab plane with the BVS maximum value is 0.982.
Intermittent microwave heating synthesized high performance spherical LiFePO4/C for Li-ion batteries
International Nuclear Information System (INIS)
Zou, Hongli; Zhang, Guanghui; Shen, Pei Kang
2010-01-01
An intermittent microwave heating method was used to synthesize spherical LiFePO 4 /C in the presence of glucose as reductive agent and carbon source without the use of the inert gas in the oven processes. The FePO 4 was used as iron precursor to reduce the cost and three lithium salts of Li 2 CO 3 , LiOH and CH 3 COOLi were chosen for comparison of the resulting materials. The materials can be alternatively heated by this method at a temperature controllable mode for crystallization and phase transformation and to provide relaxation time for protecting particles growth. The X-ray diffraction and scanning electron microscope measurements confirmed that the LiFePO 4 /C is olivine structured with the average particle size of 50-100 nm. The spherical LiFePO 4 /C as cathode material showed better electrochemical performance in terms of the specific capacity and the cycling stability, which might be attributed to the highly crystallized phase, small particle distribution and improved conductivity by carbon connection.
International Nuclear Information System (INIS)
Elitzur, M.
1983-01-01
It is shown that shocks propagating in dense molecular regions will lead to a decrease in HCO + relative abundance, in agreement with previous results by Iglesias and Silk. The shock enhancement of HCO + detected in the supernova remnant IC 443 by Dickenson et al. is due to enhanced ionization in the shocked material. This is the result of the material penetrating the remnant cavity where it becomes exposed to the trapped cosmic rays. A similar enhancement appears to have been detected by Wootten in W28 and is explained by the same model
Summary of mechanical properties data and correlations for Li2O, Li4SiO4, LiAlO2, and Be
International Nuclear Information System (INIS)
Billone, M.C.; Grayhack, W.T.
1988-04-01
The data base for thermal expansion, elastic constants, compressive and tensile failure strengths and secondary thermal creep of leading solid-breeder (Li 2 O, Li 4 SiO 4 , and LiAlO 2 ) and multiplier (Be) materials is reviewed, porosity, grain size, and stress (for thermal creep). Because the data base is rather sparse in some areas, general properties of ceramics and metals are used to help guide the formulation of the correlations. The primary purpose of the data base summary and correlation development is to pave the way for stress analysis sensitivity studies. These studies will help determine which properties are important enough to structural lifetime and deformation assessments to require more data. 18 refs., 5 figs., 20 tabs
Aletti, Federico; Conti, Costanza; Ferrario, Manuela; Ribas, Vicent; Bollen Pinto, Bernardo; Herpain, Antoine; Post, Emiel; Romay Medina, Eduardo; Barlassina, Cristina; de Oliveira, Eliandre; Pastorelli, Roberta; Tedeschi, Gabriella; Ristagno, Giuseppe; Taccone, Fabio S; Schmid-Schönbein, Geert W; Ferrer, Ricard; De Backer, Daniel; Bendjelid, Karim; Baselli, Giuseppe
2016-01-28
The ShockOmics study (ClinicalTrials.gov identifier NCT02141607) is a multicenter prospective observational trial aimed at identifying new biomarkers of acute heart failure in circulatory shock, by means of a multiscale analysis of blood samples and hemodynamic data from subjects with circulatory shock. Ninety septic shock and cardiogenic shock patients will be recruited in three intensive care units (ICU) (Hôpital Erasme, Université Libre de Bruxelles, Belgium; Hospital Universitari Mutua Terrassa, Spain; Hôpitaux Universitaires de Genève, Switzerland). Hemodynamic signals will be recorded every day for up to seven days from shock diagnosis (time T0). Clinical data and blood samples will be collected for analysis at: i) T1 5 and lactate levels ≥ 2 mmol/L. The exclusion criteria are: expected death within 24 h since ICU admission; > 4 units of red blood cells or >1 fresh frozen plasma transfused; active hematological malignancy; metastatic cancer; chronic immunodepression; pre-existing end stage renal disease requiring renal replacement therapy; recent cardiac surgery; Child-Pugh C cirrhosis; terminal illness. Enrollment will be preceded by the signature of the Informed Consent by the patient or his/her relatives and by the physician in charge. Three non-shock control groups will be included in the study: a) healthy blood donors (n = 5); b) septic patients (n = 10); c) acute myocardial infarction or patients with prolonged acute arrhythmia (n = 10). The hemodynamic data will be downloaded from the ICU monitors by means of dedicated software. The blood samples will be utilized for transcriptomics, proteomics and metabolomics ("-omics") analyses. ShockOmics will provide new insights into the pathophysiological mechanisms underlying shock as well as new biomarkers for the timely diagnosis of cardiac dysfunction in shock and quantitative indices for assisting the therapeutic management of shock patients.
Electrochemical probings of Li1+xVS2
International Nuclear Information System (INIS)
Gupta, Asha; Mullins, C. Buddie; Goodenough, John B.
2012-01-01
Re-investigation of Li insertion into the layers of Li 1+x V 1−y M y S 2 (M = Cr, Ni and y = 0 and 0.1, x ≤ 0.8) reveals that the transformation of Li from octahedral to tetrahedral sites in Li 1+x VS 2 leads to a 1.0 V stabilization V(III)/V(II) plateau at 0.1C rate. Substitution of 10 mol% Ni for V to form Li 1+x V 0.9 Ni 0.1 S 2 increases the voltage on Li insertion by 0.1–0.2 V compared to nominal LiVS 2 , but it leads to an overall decrease in the capacity. An irreversible capacity loss on the initial charge/discharge cycle is the result of formation of an SEI layer at and below 1 V versus lithium. 10 mol% substitution of Cr for V (i.e. Li 1+x V 0.9 Cr 0.1 S 2 ) has no effect on the voltage, but it increases the capacity fade as the discharge/charge cycles progress.
International Nuclear Information System (INIS)
Hollenberg, G.W.; Liu, Y.Y.; Arthur, B.
1984-11-01
The tritium breeding material with the highest lithium atom density, Li 2 O has been observed to incur significant swelling (>4%) under fast reactor irradiation. Such swelling, if unrestrained leads to either unacceptable, induced-strains in adjacent structural material or undesirable design compromises. Fortunately, however, Li 2 O deforms at low temperatures so that swelling strains may be internally accommodated. Laboratory dilational creep experiments were conducted on unirradiated Li 2 O between 500 and 700 0 C in order to provide data for structural analysis of in-reactor experiments and blanket design studies. A densification model agreed with most of the available data
Particle acceleration at shocks in the inner heliosphere
Parker, Linda Neergaard
This dissertation describes a study of particle acceleration at shocks via the diffusive shock acceleration mechanism. Results for particle acceleration at both quasi-parallel and quasi-perpendicular shocks are presented to address the question of whether there are sufficient particles in the solar wind thermal core, modeled as either a Maxwellian or kappa- distribution, to account for the observed accelerated spectrum. Results of accelerating the theoretical upstream distribution are compared to energetic observations at 1 AU. It is shown that the particle distribution in the solar wind thermal core is sufficient to explain the accelerated particle spectrum downstream of the shock, although the shape of the downstream distribution in some cases does not follow completely the theory of diffusive shock acceleration, indicating possible additional processes at work in the shock for these cases. Results show good to excellent agreement between the theoretical and observed spectral index for one third to one half of both quasi-parallel and quasi-perpendicular shocks studied herein. Coronal mass ejections occurring during periods of high solar activity surrounding solar maximum can produce shocks in excess of 3-8 shocks per day. During solar minimum, diffusive shock acceleration at shocks can generally be understood on the basis of single independent shocks and no other shock necessarily influences the diffusive shock acceleration mechanism. In this sense, diffusive shock acceleration during solar minimum may be regarded as Markovian. By contrast, diffusive shock acceleration of particles at periods of high solar activity (e.g. solar maximum) see frequent, closely spaced shocks that include the effects of particle acceleration at preceding and following shocks. Therefore, diffusive shock acceleration of particles at solar maximum cannot be modeled on the basis of diffusive shock acceleration as a single, independent shock and the process is essentially non-Markovian. A
Melting under shock compression
International Nuclear Information System (INIS)
Bennett, B.I.
1980-10-01
A simple model, using experimentally measured shock and particle velocities, is applied to the Lindemann melting formula to predict the density, temperature, and pressure at which a material will melt when shocked from room temperature and zero pressure initial conditions
Sun, Xiaodong; Zhang, Le
2018-05-01
In this work, the MWCNTs-decorated LiFePO4 microspheres (LiFePO4@MWCNTs) with a 3D network structure have been synthesized by a facile and efficient spray-drying approach followed by solid-state reaction in a reduction atmosphere. In the as-prepared composite, the MWCNTs around LiFePO4 nanoparticles can provide 3D conductive networks which greatly facilitate the transport of Li+-ion and electron during the electrochemical reaction. Compared to the pure LiFePO4 material, the LiFePO4@MWCNTs composite as cathode for lithium-ion batteries exhibits significantly improved Li-storage performance in terms of rate capability and cyclic stability. Therefore, we can speculate that the spray-drying approach is a promising route to prepare the high-performance electrode materials with 3D network structure for electrochemical energy storage.
Mechanochemical transformations in Li(Na)AlH4-Li(Na)NH2 systems
International Nuclear Information System (INIS)
Dolotko, Oleksandr; Zhang Haiqiao; Ugurlu, Ozan; Wiench, Jerzy W.; Pruski, Marek; Scott Chumbley, L.; Pecharsky, Vitalij
2007-01-01
Mechanochemical transformations of tetrahydroaluminates and amides of lithium and sodium have been investigated using gas volumetric analysis, X-ray powder diffraction, solid-state nuclear magnetic resonance (NMR) and transmission electron microscopy. In a transformation of LiAlH 4 and LiNH 2 taken in an 1:1 molar ratio, the amount of released hydrogen (6.6 wt.% after 30 min ball milling) was higher than in any known one pot mechanochemical process involving a hydrogen-containing solid. A total of 4.3 wt.% of hydrogen is released by the NaAlH 4 -NaNH 2 system after 60 min ball milling; and 5.2 wt.% H 2 is released when LiAlH 4 and NaNH 2 or NaAlH 4 and LiNH 2 are ball milled for 90 min and 120 min, respectively. All transformations proceed at room temperature. The mechanism of the overall transformation MAlH 4 (s) + MNH 2 (s) → 2MH(s) + AlN(s) + 2H 2 (g) was identified based on detailed spectroscopic analysis of the intermediate (M 3 AlH 6 ) and final products of the ball milling process
Thermophysical properties of LiCoO₂-LiMn₂O₄ blended electrode materials for Li-ion batteries.
Gotcu, Petronela; Seifert, Hans J
2016-04-21
Thermophysical properties of two cathode types for lithium-ion batteries were measured by dependence on temperature. The cathode materials are commercial composite thick films containing LiCoO2 and LiMn2O4 blended active materials, mixed with additives (binder and carbon black) deposited on aluminium current collector foils. The thermal diffusivities of the cathode samples were measured by laser flash analysis up to 673 K. The specific heat data was determined based on measured composite specific heat, aluminium specific heat data and their corresponding measured mass fractions. The composite specific heat data was measured using two differential scanning calorimeters over the temperature range from 298 to 573 K. For a comprehensive understanding of the blended composite thermal behaviour, measurements of the heat capacity of an additional LiMn2O4 sample were performed, and are the first experimental data up to 700 K. Thermal conductivity of each cathode type and their corresponding blended composite layers were estimated from the measured thermal diffusivity, the specific heat capacity and the estimated density based on metallographic methods and structural investigations. Such data are highly relevant for simulation studies of thermal management and thermal runaway in lithium-ion batteries, in which the bulk properties are assumed, as a common approach, to be temperature independent.
Simple preparation of LiF:Mg,Ti phosphor
International Nuclear Information System (INIS)
Moharil, S.V.; Shahare, D.I.; Upaded, S.V.; Deshmukh, B.T.
1993-01-01
LiF-TLD 100 is a low-impedance (Z eff = 8.2) tissue equivalent material which is widely used in thermoluminescence (TL) dosimetry of ionizing radiations and personnel monitoring. Mg and Ti have been found to be the major impurities which impart the Tl characteristics. Recipes for the preparation of this phosphor, have not been found to be satisfactory for routine manufacture; there have always been problems associated with reproducibility and even with batch homogeneity. One of the reasons for this is that most procedures start either from readily available LiF or by melting the synthesized LiF, or both. The background impurities in the starting LiF powder can mask the intentional impurities, particularly Ti which has to be doped in rather small concentrations (10 p.p.m.). Melting LiF can again be tricky, as the LiF melt is volatile and highly corrosive. In this letter we report the preparation of LiF: Mg, Ti. The impurities were incorporated during the synthesis of LiF. The phosphor was prepared by heat treatments in ambient air without melting the compound. The characteristics of the prepared phosphors were studied and compared with those of LiF-TLD 100. (author)
Ma, Zhipeng; Fan, Yuqian; Shao, Guangjie; Wang, Guiling; Song, Jianjun; Liu, Tingting
2015-02-04
The low electronic conductivity and one-dimensional diffusion channel along the b axis for Li ions are two major obstacles to achieving high power density of LiFePO4 material. Coating carbon with excellent conductivity on the tailored LiFePO4 nanoparticles therefore plays an important role for efficient charge and mass transport within this material. We report here the in situ catalytic synthesis of high-graphitized carbon-coated LiFePO4 nanoplates with highly oriented (010) facets by introducing ferrocene as a catalyst during thermal treatment. The as-obtained material exhibits superior performances for Li-ion batteries at high rate (100 C) and low temperature (-20 °C), mainly because of fast electron transport through the graphitic carbon layer and efficient Li(+)-ion diffusion through the thin nanoplates.
29th International Symposium on Shock Waves
Ranjan, Devesh
2015-01-01
This proceedings present the results of the 29th International Symposium on Shock Waves (ISSW29) which was held in Madison, Wisconsin, U.S.A., from July 14 to July 19, 2013. It was organized by the Wisconsin Shock Tube Laboratory, which is part of the College of Engineering of the University of Wisconsin-Madison. The ISSW29 focused on the following areas: Blast Waves, Chemically Reactive Flows, Detonation and Combustion, Facilities, Flow Visualization, Hypersonic Flow, Ignition, Impact and Compaction, Industrial Applications, Magnetohydrodynamics, Medical and Biological Applications, Nozzle Flow, Numerical Methods, Plasmas, Propulsion, Richtmyer-Meshkov Instability, Shock-Boundary Layer Interaction, Shock Propagation and Reflection, Shock Vortex Interaction, Shock Waves in Condensed Matter, Shock Waves in Multiphase Flow, as well as Shock Waves in Rarefield Flow. The two Volumes contain the papers presented at the symposium and serve as a reference for the participants of the ISSW 29 and individuals interes...
Shock compression of synthetic opal
International Nuclear Information System (INIS)
Inoue, A; Okuno, M; Okudera, H; Mashimo, T; Omurzak, E; Katayama, S; Koyano, M
2010-01-01
Structural change of synthetic opal by shock-wave compression up to 38.1 GPa has been investigated by using SEM, X-ray diffraction method (XRD), Infrared (IR) and Raman spectroscopies. Obtained information may indicate that the dehydration and polymerization of surface silanole due to high shock and residual temperature are very important factors in the structural evolution of synthetic opal by shock compression. Synthetic opal loses opalescence by 10.9 and 18.4 GPa of shock pressures. At 18.4 GPa, dehydration and polymerization of surface silanole and transformation of network structure may occur simultaneously. The 4-membered ring of TO 4 tetrahedrons in as synthetic opal may be relaxed to larger ring such as 6-membered ring by high residual temperature. Therefore, the residual temperature may be significantly high at even 18.4 GPa of shock compression. At 23.9 GPa, opal sample recovered the opalescence. Origin of this opalescence may be its layer structure by shock compression. Finally, sample fuse by very high residual temperature at 38.1 GPa and the structure closes to that of fused SiO 2 glass. However, internal silanole groups still remain even at 38.1 GPa.
Giammarinaro, Bruno; Espíndola, David; Coulouvrat, François; Pinton, Gianmarco
2018-01-01
Focusing is a ubiquitous way to transform waves. Recently, a new type of shock wave has been observed experimentally with high-frame-rate ultrasound: shear shock waves in soft solids. These strongly nonlinear waves are characterized by a high Mach number, because the shear wave velocity is much slower, by 3 orders of magnitude, than the longitudinal wave velocity. Furthermore, these waves have a unique cubic nonlinearity which generates only odd harmonics. Unlike longitudinal waves for which only compressional shocks are possible, shear waves exhibit cubic nonlinearities which can generate positive and negative shocks. Here we present the experimental observation of shear shock wave focusing, generated by the vertical motion of a solid cylinder section embedded in a soft gelatin-graphite phantom to induce linearly vertically polarized motion. Raw ultrasound data from high-frame-rate (7692 images per second) acquisitions in combination with algorithms that are tuned to detect small displacements (approximately 1 μ m ) are used to generate quantitative movies of gel motion. The features of shear shock wave focusing are analyzed by comparing experimental observations with numerical simulations of a retarded-time elastodynamic equation with cubic nonlinearities and empirical attenuation laws for soft solids.
Computations of slowly moving shocks
International Nuclear Information System (INIS)
Karni, S.; Canic, S.
1997-01-01
Computations of slowly moving shocks by shock capturing schemes may generate oscillations are generated already by first-order schemes, but become more pronounced in higher-order schemes which seem to exhibit different behaviors: (i) the first-order upwind (UW) scheme which generates strong oscillations and (ii) the Lax-Friedrichs scheme which appears not to generate any disturbances at all. A key observation is that in the UW case, the numerical viscosity in the shock family vanishes inside the slow shock layer. Simple scaling arguments show the third-order effects on the solution may no longer be neglected. We derive the third-order modified equation for the UW scheme and regard the oscillatory solution as a traveling wave solution of the parabolic modified equation for the perturbation. We then look at the governing equation for the perturbation, which points to a plausible mechanism by which postshock oscillations are generated. It contains a third-order source term that becomes significant inside the shock layer, and a nonlinear coupling term which projects the perturbation on all characteristic fields, including those not associated with the shock family. 5 refs., 8 figs
Shock compression of synthetic opal
Inoue, A.; Okuno, M.; Okudera, H.; Mashimo, T.; Omurzak, E.; Katayama, S.; Koyano, M.
2010-03-01
Structural change of synthetic opal by shock-wave compression up to 38.1 GPa has been investigated by using SEM, X-ray diffraction method (XRD), Infrared (IR) and Raman spectroscopies. Obtained information may indicate that the dehydration and polymerization of surface silanole due to high shock and residual temperature are very important factors in the structural evolution of synthetic opal by shock compression. Synthetic opal loses opalescence by 10.9 and 18.4 GPa of shock pressures. At 18.4 GPa, dehydration and polymerization of surface silanole and transformation of network structure may occur simultaneously. The 4-membered ring of TO4 tetrahedrons in as synthetic opal may be relaxed to larger ring such as 6-membered ring by high residual temperature. Therefore, the residual temperature may be significantly high at even 18.4 GPa of shock compression. At 23.9 GPa, opal sample recovered the opalescence. Origin of this opalescence may be its layer structure by shock compression. Finally, sample fuse by very high residual temperature at 38.1 GPa and the structure closes to that of fused SiO2 glass. However, internal silanole groups still remain even at 38.1 GPa.
Shock compression of synthetic opal
Energy Technology Data Exchange (ETDEWEB)
Inoue, A; Okuno, M; Okudera, H [Department of Earth Sciences, Kanazawa University Kanazawa, Ishikawa, 920-1192 (Japan); Mashimo, T; Omurzak, E [Shock Wave and Condensed Matter Research Center, Kumamoto University, Kumamoto, 860-8555 (Japan); Katayama, S; Koyano, M, E-mail: okuno@kenroku.kanazawa-u.ac.j [JAIST, Nomi, Ishikawa, 923-1297 (Japan)
2010-03-01
Structural change of synthetic opal by shock-wave compression up to 38.1 GPa has been investigated by using SEM, X-ray diffraction method (XRD), Infrared (IR) and Raman spectroscopies. Obtained information may indicate that the dehydration and polymerization of surface silanole due to high shock and residual temperature are very important factors in the structural evolution of synthetic opal by shock compression. Synthetic opal loses opalescence by 10.9 and 18.4 GPa of shock pressures. At 18.4 GPa, dehydration and polymerization of surface silanole and transformation of network structure may occur simultaneously. The 4-membered ring of TO{sub 4} tetrahedrons in as synthetic opal may be relaxed to larger ring such as 6-membered ring by high residual temperature. Therefore, the residual temperature may be significantly high at even 18.4 GPa of shock compression. At 23.9 GPa, opal sample recovered the opalescence. Origin of this opalescence may be its layer structure by shock compression. Finally, sample fuse by very high residual temperature at 38.1 GPa and the structure closes to that of fused SiO{sub 2} glass. However, internal silanole groups still remain even at 38.1 GPa.
Do oil shocks predict economic policy uncertainty?
Rehman, Mobeen Ur
2018-05-01
Oil price fluctuations have influential role in global economic policies for developed as well as emerging countries. I investigate the role of international oil prices disintegrated into structural (i) oil supply shock, (ii) aggregate demand shock and (iii) oil market specific demand shocks, based on the work of Kilian (2009) using structural VAR framework on economic policies uncertainty of sampled markets. Economic policy uncertainty, due to its non-linear behavior is modeled in a regime switching framework with disintegrated structural oil shocks. Our results highlight that Indian, Spain and Japanese economic policy uncertainty responds to the global oil price shocks, however aggregate demand shocks fail to induce any change. Oil specific demand shocks are significant only for China and India in high volatility state.
Shock Wave Dynamics in Weakly Ionized Plasmas
Johnson, Joseph A., III
1999-01-01
An investigation of the dynamics of shock waves in weakly ionized argon plasmas has been performed using a pressure ruptured shock tube. The velocity of the shock is observed to increase when the shock traverses the plasma. The observed increases cannot be accounted for by thermal effects alone. Possible mechanisms that could explain the anomalous behavior include a vibrational/translational relaxation in the nonequilibrium plasma, electron diffusion across the shock front resulting from high electron mobility, and the propagation of ion-acoustic waves generated at the shock front. Using a turbulence model based on reduced kinetic theory, analysis of the observed results suggest a role for turbulence in anomalous shock dynamics in weakly ionized media and plasma-induced hypersonic drag reduction.
Data products of NASA Goddard's LiDAR, hyperspectral, and thermal airborne imager (G-LiHT)
Corp, Lawrence A.; Cook, Bruce D.; McCorkel, Joel; Middleton, Elizabeth M.
2015-06-01
Scientists in the Biospheric Sciences Laboratory at NASA's Goddard Space Flight Center have undertaken a unique instrument fusion effort for an airborne package that integrates commercial off the shelf LiDAR, Hyperspectral, and Thermal components. G-LiHT is a compact, lightweight and portable system that can be used on a wide range of airborne platforms to support a number of NASA Earth Science research projects and space-based missions. G-LiHT permits simultaneous and complementary measurements of surface reflectance, vegetation structure, and temperature, which provide an analytical framework for the development of new algorithms for mapping plant species composition, plant functional types, biodiversity, biomass, carbon stocks, and plant growth. G-LiHT and its supporting database are designed to give scientists open access to the data that are needed to understand the relationship between ecosystem form and function and to stimulate the advancement of synergistic algorithms. This system will enhance our ability to design new missions and produce data products related to biodiversity and climate change. G-LiHT has been operational since 2011 and has been used to collect data for a number of NASA and USFS sponsored studies, including NASA's Carbon Monitoring System (CMS) and the American ICESat/GLAS Assessment of Carbon (AMIGA-Carb). These acquisitions target a broad diversity of forest communities and ecoregions across the United States and Mexico. Here, we will discuss the components of G-LiHT, their calibration and performance characteristics, operational implementation, and data processing workflows. We will also provide examples of higher level data products that are currently available.
(Cu,C)Ba2Ca3Cu4Ox (LiF)y: addition of LiF—an effective way to synthesize overdoped superconductor
Badica, P.; Iyo, A.; Aldica, G.; Kito, H.; Crisan, A.; Tanaka, Y.
2004-03-01
(Cu,C)Ba2Ca3Cu4Ox superconductor with addition of y mol LiF has been synthesized by a high-pressure method. For the same synthesis conditions it was found that (almost) single-phase Cu, C-1234 samples can be synthesized for yLiF = 0-0.1 if the amount of z mol AgO oxidizer is increased linearly from zAgO = 0.45 to 0.73 and for yLiF = 0.1-0.2 if zAgO = 0.73 = constant. Transport measurements (rgr(T) and room-temperature Seebeck coefficient) have shown that these samples are overdoped: LiF is an effective addition for synthesis of overdoped Cu, C-1234 with a controlled level of carriers. LiF addition continuously decreases Tc. The critical point at yLiF = 0.1 is discussed as the solubility limit of LiF and/or the point where the doping mechanism changes. It is proposed that the reason is the reaction of extra Li with C and O to form Li2CO3, inducing a lower concentration of C in Cu, C-1234/LiF crystals, and at the same time a possible substitution of Li not only for the Cu site but also for the Ca site, resulting in formation of a higher amount of residual Ca0.828CuO2 (for yLiF>0.1). LiF induces the formation of a liquid phase and acts as a flux promoting the formation of Cu,C-12 (n-1)n with n \\ge 4 . LiF modifies to some degree the grain growth from a 3D to a 2D type (thinner platelike grains have been observed in the LiF added samples).
(Cu,C)Ba2Ca3Cu4Ox-(LiF)y: addition of LiF-an effective way to synthesize overdoped superconductor
International Nuclear Information System (INIS)
Badica, P; Iyo, A; Aldica, G; Kito, H; Crisan, A; Tanaka, Y
2004-01-01
(Cu,C)Ba 2 Ca 3 Cu 4 O x superconductor with addition of y mol LiF has been synthesized by a high-pressure method. For the same synthesis conditions it was found that (almost) single-phase Cu, C-1234 samples can be synthesized for y LiF = 0-0.1 if the amount of z mol AgO oxidizer is increased linearly from z AgO = 0.45 to 0.73 and for y LiF 0.1-0.2 if z AgO = 0.73 constant. Transport measurements (ρ(T) and room-temperature Seebeck coefficient) have shown that these samples are overdoped: LiF is an effective addition for synthesis of overdoped Cu, C-1234 with a controlled level of carriers. LiF addition continuously decreases T c . The critical point at y LiF = 0.1 is discussed as the solubility limit of LiF and/or the point where the doping mechanism changes. It is proposed that the reason is the reaction of extra Li with C and O to form Li 2 CO 3 , inducing a lower concentration of C in Cu, C-1234/LiF crystals, and at the same time a possible substitution of Li not only for the Cu site but also for the Ca site, resulting in formation of a higher amount of residual Ca 0.828 CuO 2 (for y LiF >0.1). LiF induces the formation of a liquid phase and acts as a flux promoting the formation of Cu,C-12 (n-1)n with n ≥ 4. LiF modifies to some degree the grain growth from a 3D to a 2D type (thinner platelike grains have been observed in the LiF added samples)
Shock waves in weakly compressed granular media.
van den Wildenberg, Siet; van Loo, Rogier; van Hecke, Martin
2013-11-22
We experimentally probe nonlinear wave propagation in weakly compressed granular media and observe a crossover from quasilinear sound waves at low impact to shock waves at high impact. We show that this crossover impact grows with the confining pressure P0, whereas the shock wave speed is independent of P0-two hallmarks of granular shocks predicted recently. The shocks exhibit surprising power law attenuation, which we model with a logarithmic law implying that shock dissipation is weak and qualitatively different from other granular dissipation mechanisms. We show that elastic and potential energy balance in the leading part of the shocks.
Role of Li2O2@Li2CO3 Interfaces on Charge Transport in Nonaqueous Li−Air Batteries
DEFF Research Database (Denmark)
Mekonnen, Yedilfana Setarge; García Lastra, Juan Maria; Hummelshøj, Jens S.
2015-01-01
The formation and oxidation of the main discharge product in nonaqueous secondary Li−O2 batteries, that is, Li2O2, has been studied intensively, but less attention has been given to the formation of cathode−electrolyte interfaces, which can significantly influence the performance of the Li−O2...... battery. Here we apply density functional theory with the Hubbard U correction (DFT+U) and nonequilibrium Green’s function (NEGF) methods to investigate the role of Li2O2@Li2CO3 interface layers on the ionic and electronic transport properties at the oxygen electrode. We show that, for example, lithium...... vacancies accumulate at the peroxide part of the interface during charge, reducing the coherent electron transport by two to three orders of magnitude compared with pristine Li2O2. During discharge, Li2O2@Li2CO3 interfaces may, however, provide an alternative in-plane channel for fast electron polaron...
The Technology of LiFi: A Brief Introduction
Ramadhani, E.; Mahardika, G. P.
2018-03-01
Light Fidelity (LiFi) is a Visible Light Communication (VLC) based technology that making a light as a media of communication replacing the cable wire communication. LiFi is evolve to overcome the rate speed in WiFi, while using LiFi the rate speed can reach until 14 Gbps. This paper presents an introduction of the LiFi technology including the architecture, modulation, performance, and the challenges. The result of this paper can be used as a reference and knowledge to develop some of the LiFi technology.
National Oceanic and Atmospheric Administration, Department of Commerce — Watershed Sciences, Inc. (WSI) collected Light Detection and Ranging (LiDAR) data on the Quinault watershed survey area for the Puget Sound LiDAR Consortium. This...
Calculation of the πsup(+)sup(7)Li → pesup(+)esup(-)sup(6)Li
International Nuclear Information System (INIS)
Avakov, G.V.; Blokhintsev, L.D.; Blokhintseva, T.D.
1985-01-01
The π +7 Li → p e + e -6 Li reaction have been considered in the framework of the nucleon cluster model and of the shell model. The cross section of this reaction have been calculated at the pion kinetic energy 380 MeV. The comparison with the available experimental data has been carried out
Self-assembled LiFePO4 nanowires with high rate capability for Li-ion batteries.
Peng, Lele; Zhao, Yu; Ding, Yu; Yu, Guihua
2014-08-28
Controlling the dimensions in the nanometer scale of olivine-type LiFePO4 has been regarded as one of the most effective strategies to improve its electrochemical performance for Li-ion batteries. In this communication, we demonstrate a novel LiFePO4 nanoarchitecture, which is composed of self-assembled single-crystalline nanowires and exhibits good rate capability with a reversible capacity of ∼110 mA h g(-1) at a current rate of 30 C, and a stable capacity retention of ∼86% after 1000 cycles at a current rate of 10 C.
Directory of Open Access Journals (Sweden)
Arun Kumar
2009-01-01
Full Text Available Pure lithium iron phosphate (LiFePO4 and carbon-coated LiFePO4 (C-LiFePO4 cathode materials were synthesized for Li-ion batteries. Structural and electrochemical properties of these materials were compared. X-ray diffraction revealed orthorhombic olivine structure. Micro-Raman scattering analysis indicates amorphous carbon, and TEM micrographs show carbon coating on LiFePO4 particles. Ex situ Raman spectrum of C-LiFePO4 at various stages of charging and discharging showed reversibility upon electrochemical cycling. The cyclic voltammograms of LiFePO4 and C-LiFePO4 showed only a pair of peaks corresponding to the anodic and cathodic reactions. The first discharge capacities were 63, 43, and 13 mAh/g for C/5, C/3, and C/2, respectively for LiFePO4 where as in case of C-LiFePO4 that were 163, 144, 118, and 70 mAh/g for C/5, C/3, C/2, and 1C, respectively. The capacity retention of pure LiFePO4 was 69% after 25 cycles where as that of C-LiFePO4 was around 97% after 50 cycles. These results indicate that the capacity and the rate capability improved significantly upon carbon coating.
Viswanathan, V; Thygesen, K S; Hummelshøj, J S; Nørskov, J K; Girishkumar, G; McCloskey, B D; Luntz, A C
2011-12-07
Non-aqueous Li-air or Li-O(2) cells show considerable promise as a very high energy density battery couple. Such cells, however, show sudden death at capacities far below their theoretical capacity and this, among other problems, limits their practicality. In this paper, we show that this sudden death arises from limited charge transport through the growing Li(2)O(2) film to the Li(2)O(2)-electrolyte interface, and this limitation defines a critical film thickness, above which it is not possible to support electrochemistry at the Li(2)O(2)-electrolyte interface. We report both electrochemical experiments using a reversible internal redox couple and a first principles metal-insulator-metal charge transport model to probe the electrical conductivity through Li(2)O(2) films produced during Li-O(2) discharge. Both experiment and theory show a "sudden death" in charge transport when film thickness is ~5 to 10 nm. The theoretical model shows that this occurs when the tunneling current through the film can no longer support the electrochemical current. Thus, engineering charge transport through Li(2)O(2) is a serious challenge if Li-O(2) batteries are ever to reach their potential. © 2011 American Institute of Physics
International Nuclear Information System (INIS)
Yang, Chun-Chen; Liao, Pin-Ci; Wu, Yi-Shiuan; Lue, Shingjiang Jessie
2017-01-01
Graphical abstract: Schematic diagram for Li-rich oxide (Li 1.2 Ni 0.2 Mn 0.60 O 2 ) coated with Li 0.75 La 0.42 TiO 3 (LLTO) solid ionic conductor. - Highlights: • Li 1.2 Ni 0.2 Mn 0.60 O 2 /C composite material was prepared by one-pot solid-state method. • 1D a-MnO 2 nanowires and microsphere hollow b-Ni(OH) 2 were prepared by a hydrothermal method. • 1 wt.%LLTO-coated composite showed the best performance among samples. • LLTO layer not only improves the ionic transport of Li-rich oxide material, but also prevent Li-rich material corrosion. - Abstract: Li-rich (spray-dried (SP)-Li 1.2 Ni 0.2 Mn 0.60 O 2 ) composite materials were prepared via two-step ball-mill and spray dry methods by using LiOH, α-MnO 2 , β-Ni(OH) 2 raw materials. Two raw materials of α-MnO 2 nanowires and microsphere β-Ni(OH) 2 were synthesized by a hydrothermal process. In addition, Li 0.75 La 0.42 TiO3 (LLTO) fast ionic conductor was coated on SP-Li 1.2 Ni 0.2 Mn 0.60 O 2 composite via a sol–gel method. The properties of the LLTO-coated SP-Li 1.2 Ni 0.2 Mn 0.60 O 2 composites were determined by X-ray diffraction, scanning electron microscopy, micro-Raman, XPS, and the AC impedance method. The discharge capacities of 1 wt.%-LLTO-coated SP-Li 1.2 Ni 0.2 Mn 0.60 O 2 composites were 256, 250, 231, 200, 158, and 114 mAh g −1 at rates of 0.1, 0.2, 0.5, 1, 3, and 5C, respectively, in the voltage range 2.0–4.8 V. The 1 wt.%-LLTO-coated Li-rich oxide composite showed the discharge capacities of up to 256 mAh g −1 in the first cycle at 0.1C. After 30 cycles, the discharge capacity of 244 mAh g −1 was obtained, which showed the capacity retention of 95.4%.
International Nuclear Information System (INIS)
Ma, Wen; Hou, Yong; Zhu, Wenjun
2013-01-01
Shock compressions of nanocrystalline (nc) metals Al and Cu with the same grain size and texture are studied by using molecular dynamics simulations. Results have revealed that the shock front of both Al and Cu can be divided into three stages: elastic, grain-boundary-mediated, and dislocation-mediated plastic deformation. The transition planes among these three stages are proven to be non-planar by two-dimensional shock response analysis, including local stress, shear, temperature, and atom configuration. The difference between shocked Al and Cu is that the rise rate of the elastic stage of Cu is slightly higher than that of Al, and that the shock-front width of Al is wider than Cu at the same loading conditions. For the plastic stage, the dislocation density of shocked Al is lower than Cu, and the contribution of grain-boundary-mediated plasticity to shock front and strain for nc Al is more pronounced than for nc Cu. These results are explained through intrinsic material properties and atomistic analysis of the plastic process. In the case of the shocked Al sample, partial dislocations, perfect dislocations, and twins are observed, but few evidence of perfect dislocations and twins are observed in the shocked Cu
Energy Technology Data Exchange (ETDEWEB)
Liu, Bin [Energy and Environment Directorate, Pacific Northwest National Laboratory, Richland WA 99354 USA; Xu, Wu [Energy and Environment Directorate, Pacific Northwest National Laboratory, Richland WA 99354 USA; Yan, Pengfei [Environmental and Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland WA 99354 USA; Kim, Sun Tai [Energy and Environment Directorate, Pacific Northwest National Laboratory, Richland WA 99354 USA; Department of Energy Engineering, School of Energy and Chemical Engineering, Ulsan National Institute of Science and Technology, Ulsan 689-798 South Korea; Engelhard, Mark H. [Environmental and Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland WA 99354 USA; Sun, Xiuliang [Physical and Computational Sciences Directorate, Pacific Northwest National Laboratory, Richland WA 99354 USA; Mei, Donghai [Physical and Computational Sciences Directorate, Pacific Northwest National Laboratory, Richland WA 99354 USA; Cho, Jaephil [Department of Energy Engineering, School of Energy and Chemical Engineering, Ulsan National Institute of Science and Technology, Ulsan 689-798 South Korea; Wang, Chong-Min [Environmental and Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland WA 99354 USA; Zhang, Ji-Guang [Energy and Environment Directorate, Pacific Northwest National Laboratory, Richland WA 99354 USA
2017-03-08
The conventional DMSO-based electrolyte (1 M lithium bis(trifluoromethanesulfonyl)imide (LiTFSI) in DMSO) is unstable against the Li metal anode and therefore cannot be used directly in practical Li-O2 batteries. Here, we demonstrate that a highly concentrated electrolyte based on LiTFSI in DMSO (with a molar ratio of 1:3) can greatly improve the stability of the Li metal anode against DMSO and significantly improve the cycling stability of Li-O2 batteries. This highly concentrated electrolyte contains no free DMSO solvent molecules, but only complexes of (TFSI–)a-Li+-(DMSO)b (where a + b = 4), and thus enhances their stability with Li metal anodes. In addition, such salt-solvent complexes have higher Gibbs activation energy barriers than the free DMSO solvent molecules, indicating improved stability of the electrolyte against the attack of superoxide radical anions. Therefore, the stability of this highly concentrated electrolyte at both Li metal anodes and carbon-based air electrodes has been greatly enhanced, resulting in improved cyclic stability of Li-O2 batteries. The fundamental stability of the electrolyte with free-solvent against the chemical and electrochemical reactions can also be used to enhance the stability of other electrochemical systems.
A novel type heterojunction photodiodes formed junctions of Au/LiZnSnO and LiZnSnO/p-Si in series
Energy Technology Data Exchange (ETDEWEB)
Aydin, H. [Department of Metallurgical and Materials Science, Faculty of Engineering, Tunceli University, Tunceli (Turkey); Tataroğlu, A. [Department of Physics, Faculty of Science, Gazi University, Ankara (Turkey); Al-Ghamdi, Ahmed A. [Department of Physics, Faculty of Science, King Abdulaziz University, Jeddah (Saudi Arabia); Yakuphanoglu, F., E-mail: fyhanoglu@firat.edu.tr [Department of Metallurgical and Materials Science, Faculty of Engineering, Tunceli University, Tunceli (Turkey); Department of Physics, Faculty of Science, King Abdulaziz University, Jeddah (Saudi Arabia); El-Tantawy, Farid [Department of Physics, Faculty of Science, Suez Canal University, Ismailia (Egypt); Farooq, W.A. [Physics and Astronomy Department, College of Science, King Saud University, Riyadh (Saudi Arabia)
2015-03-15
Highlights: • Lithium–zinc–tin–oxide thin films were prepared by sol gel method. • The Au/LiZnSnO/p-Si/Al photodiodes were fabricated using a LZTO layer grown on p-Si. • The photodiodes with Li-doped ZTO interfacial layer exhibited a better device performance. - Abstract: Lithium–zinc–tin–oxide thin films were prepared by sol gel method. The structural and optical properties of the films were investigated. The optical band gaps of the LiZnSnO films were found to be 3.78 eV for 0 at.% Li, 3.77 eV for 1 at.% Li, 3.87 eV for 3 at.% Li and 3.85 eV for 5 at.% Li, respectively. Au/LiZnSnO/p-Si/Al photodiodes were fabricated using a lithium–zinc–tin–oxide (LZTO, Li–Zn–Sn–O) layer grown on p-Si semiconductor. The electrical characteristics of the photodiodes were analyzed by current–voltage, capacitance–voltage and conductance–voltage measurements. The reverse current of the diodes increases with both the increasing illumination intensity and Li content. It was found that the Li-doped ZTO photodiodes exhibited a better device performance than those with an undoped ZTO.
Energy Technology Data Exchange (ETDEWEB)
Horopanitis, E.E.; Perentzis, G.; Papadimitriou, L. [Aristotle University of Thessaloniki, Department of Physics, Section of Solid State Physics, Thessaloniki (Greece)
2008-07-01
LiNbO{sub 3} thin films, deposited by e-gun evaporation, show lithium deficiency, which is cured by ''Li doping''. The ''Li doping'' of the films was achieved by preparing a structure of Li-Nb-O/Li/Li-Nb-O, which after annealing forms a homogenized LiNbO{sub 3} layer because of diffusion of Li in the two Li-Nb-O layers. The LiCoO{sub 2}/LiNbO{sub 3} bi-layers were prepared either on Stainless Steel/TiN or on Al{sub 2}O{sub 3}/Co/Pt substrates/ohmic-contacts by depositing first either the cathode LiCoO{sub 2} or the electrolyte LiNbO{sub 3}. The Nyquist plots of the AC impedance measurements of all structures showed that the interfaces prepared on Stainless-Steel/TiN consisted of two semicircles. The structures deposited on Al{sub 2}O{sub 3}/Co/Pt showed a third semicircle, which is probably due to the roughness of the substrate. It is important that the ionic properties of the bi-layers with the cathode material deposited first, a usual structure in a microbattery, are improved compared to the other structures. The quality of the LiNbO{sub 3} layer depends very much on the substrate. It can be evaluated from Arrhenius plots that the activation energy of this layer is considerably lower when the whole structure is deposited on Stainless Steel/TiN. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Shock wave dynamics derivatives and related topics
Emanuel, George
2012-01-01
"...this monograph develops an esoteric niche within shock wave theory. …treats shock waves from an analytical approach assuming perfect gas. Emanuel has made significant contributions to the theory of shock waves and has selected a number of topics that reflect those contributions."-Shock Waves, 2013.
Chondrule destruction in nebular shocks
Energy Technology Data Exchange (ETDEWEB)
Jacquet, Emmanuel; Thompson, Christopher, E-mail: ejacquet@mnhn.fr [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St George Street, Toronto, ON M5S 3H8 (Canada)
2014-12-10
Chondrules are millimeter-sized silicate spherules ubiquitous in primitive meteorites, but whose origin remains mysterious. One of the main proposed mechanisms for producing them is melting of solids in shock waves in the gaseous protoplanetary disk. However, evidence is mounting that chondrule-forming regions were enriched in solids well above solar abundances. Given the high velocities involved in shock models, destructive collisions would be expected between differently sized grains after passage of the shock front as a result of differential drag. We investigate the probability and outcome of collisions of particles behind a one-dimensional shock using analytic methods as well as a full integration of the coupled mass, momentum, energy, and radiation equations. Destruction of protochondrules seems unavoidable for solid/gas ratios ε ≳ 0.1, and possibly even for solar abundances because of 'sandblasting' by finer dust. A flow with ε ≳ 10 requires much smaller shock velocities (∼2 versus 8 km s{sup –1}) in order to achieve chondrule-melting temperatures, and radiation trapping allows slow cooling of the shocked fragments. Initial destruction would still be extensive; although re-assembly of millimeter-sized particles would naturally occur by grain sticking afterward, the compositional heterogeneity of chondrules may be difficult to reproduce. We finally note that solids passing through small-scale bow shocks around few kilometer-sized planetesimals might experience partial melting and yet escape fragmentation.
Directory of Open Access Journals (Sweden)
Ahmed A. EL-Nawawy
Full Text Available Abstract Objective: To evaluate the role of echocardiography in reducing shock reversal time in pediatric septic shock. Methods: A prospective study conducted in the pediatric intensive care unit of a tertiary care teaching hospital from September 2013 to May 2016. Ninety septic shock patients were randomized in a 1:1 ratio for comparing the serial echocardiography-guided therapy in the study group with the standard therapy in the control group regarding clinical course, timely treatment, and outcomes. Results: Shock reversal was significantly higher in the study group (89% vs. 67%, with significantly reduced shock reversal time (3.3 vs. 4.5 days. Pediatric intensive care unit stay in the study group was significantly shorter (8 ± 3 vs. 14 ± 10 days. Mortality due to unresolved shock was significantly lower in the study group. Fluid overload was significantly lower in the study group (11% vs. 44%. In the study group, inotropes were used more frequently (89% vs. 67% and initiated earlier (12[0.5-24] vs. 24[6-72] h with lower maximum vasopressor inotrope score (120[30-325] vs. 170[80-395], revealing predominant use of milrinone (62% vs. 22%. Conclusion: Serial echocardiography provided crucial data for early recognition of septic myocardial dysfunction and hypovolemia that was not apparent on clinical assessment, allowing a timely management and resulting in shock reversal time reduction among children with septic shock.
Coincidence in the two-photon spectra of Li and Li2 at 735 nm
International Nuclear Information System (INIS)
DeGraffenreid, W; Sansonetti, Craig J
2005-01-01
A coincidence between the 2 2 S 1/2 -3 2 S 1/2 two-photon transition in the atomic spectrum of 6 Li and the X 1 Σ + g → E 1 Σ + g two-photon ro-vibrational series of 7 Li 2 was observed near 735 nm in a heat pipe oven using a tunable laser and thermionic diode detection scheme. The molecular transition obscures one component of the 6 Li atomic transition. Selective detection of the atomic transition was obtained by adding an intensity-modulated laser that drives atoms from the 3S to 16P state. The coincident molecular transition and four nearby molecular lines were identified using previously determined Dunham coefficients
Mössbauer spectra obtained using β - γ coincidence method after 57Mn implantation into LiH and LiD
Sato, Y.; Kobayashi, Y.; Yamada, Y.; Kubo, M. K.; Mihara, M.; Nagatomo, T.; Sato, W.; Miyazaki, J.; Tanigawa, S.; Natori, D.; Sato, S.; Kitagawa, A.
2016-12-01
Highly energetic 57Mn ( T 1/2 = 1.45 m) was generated by nuclear projectile fragmentation in a heavy-ion accelerator, and implanted into lithium hydride (LiH) and lithium deuteride (LiD) at 578 K. Mössbauer spectroscopy with β - γ coincidence detection was then carried out on the 57Fe obtained from β -decay of the 57Mn to study the time dependence of the site distributions and coordination environments of dilute Fe atoms implanted in the LiH and LiD. The results suggest that the Fe atoms can substitute for either the Li and H or D atoms within 100 ns. Additionally, the displacement behavior of the substitutional 57Fe atoms on the lattice sites is discussed.
Schroeder, Marshall A; Kumar, Nitin; Pearse, Alexander J; Liu, Chanyuan; Lee, Sang Bok; Rubloff, Gary W; Leung, Kevin; Noked, Malachi
2015-06-03
One of the greatest obstacles for the realization of the nonaqueous Li-O2 battery is finding a solvent that is chemically and electrochemically stable under cell operating conditions. Dimethyl sulfoxide (DMSO) is an attractive candidate for rechargeable Li-O2 battery studies; however, there is still significant controversy regarding its stability on the Li-O2 cathode surface. We performed multiple experiments (in situ XPS, FTIR, Raman, and XRD) which assess the stability of the DMSO-Li2O2 interface and report perspectives on previously published studies. Our electrochemical experiments show long-term stable cycling of a DMSO-based operating Li-O2 cell with a platinum@carbon nanotube core-shell cathode fabricated via atomic layer deposition, specifically with >45 cycles of 40 h of discharge per cycle. This work is complemented by density functional theory calculations of DMSO degradation pathways on Li2O2. Both experimental and theoretical evidence strongly suggests that DMSO is chemically and electrochemically stable on the surface of Li2O2 under the reported operating conditions.
International Nuclear Information System (INIS)
Wu, Naiteng; Wu, Hao; Liu, Heng; Zhang, Yun
2016-01-01
LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 (NCA) microspheres covered by a nanoscale Li_2TiO_3-based shell were synthesized by a facile strategy based on a solvothermal pre-coating treatment combined with a post-sintering lithiation process. The morphology, structure and composition of the Li_2TiO_3-coated NCA samples were investigated by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), scanning scanning electron microscope (SEM) with an energy-dispersive X-ray spectroscope (EDS), and transmission electron microscopy (TEM). Owing to the complete, uniform and nanoscale Li_2TiO_3 coating shell, the resultant surface-modified NCA microspheres used as Li-ion battery cathode materials manifest remarkably enhanced cycling performances, attaining 94% and 84% capacity retention after 200 and 400 cycles at 0.5 C, respectively, which is much better than the pristine NCA counterpart (60% retention, 200 cycles). More impressively, the surface-modified NCA also shows an intriguing storage stability. After being stored at 30 °C for 50 days, the coated NCA-based cells are subjected to be cycled both at room and elevated temperatures, in which the aged cells can still remain 84% capacity retention after 200 cycles at 25 °C and 77% capacity retention after 200 cycles at 55 °C, respectively. All these results demonstrate that the Li_2TiO_3-coated LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 microsphere is a promising cathode material for Li-ion batteries with long lifespan. - Graphical abstract: Nanoscale Li_2TiO_3-based shell encapsulated LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 (NCA) microspheres are fabricated through a solvothermal pre-coating treatment combined with post-lithiation process. The surface-coated NCA as cathode materials shows a remarkably enhanced cycling performance and storage stability for long lifespan Li-ion batteries. - Highlights: • Li_2TiO_3 is used as coating materials for layer structured LiNi_0_._8Co_0_._1_5Al_0_._0_5O_2 cathode. • Solvothermal coating
International Nuclear Information System (INIS)
Yuan, Y.F.; Wu, H.M.; Guo, S.Y.; Wu, J.B.; Yang, J.L.; Wang, X.L.; Tu, J.P.
2008-01-01
The surface-modified spinel LiMn 2 O 4 by doped LiNi 0.05 Mn 1.95 O 4 was prepared by a tartaric acid gel method. Transmission electron microscope (TEM) images indicated that some small particles with 100-200 nm in diameter modified the surface of large particle LiMn 2 O 4 . Energy dispersive spectrometry (EDS) showed that the particles were LiNi 0.05 Mn 1.95 O 4 . Electrochemical properties of LiNi 0.05 Mn 1.95 O 4 -modified spinel LiMn 2 O 4 were intensively investigated by the galvanostatic charge-discharge tests, cyclic voltammetry (CV) and AC impedance measurements. The doped LiNi 0.05 Mn 1.95 O 4 -modified LiMn 2 O 4 cathode delivered the same initial discharge capacity as the unmodified LiMn 2 O 4 , but its cyclic stability was evidently improved, the capacity retention ratio reached 96% after 20 cycles, being higher than 89% of the unmodified LiMn 2 O 4 . Cyclic voltammograms of the LiNi 0.05 Mn 1.95 O 4 -modified LiMn 2 O 4 did not markedly change while the semicircle diameter of AC impedance spectra evidently decreased after 20 cycles, which showed that the surface modification with LiNi 0.05 Mn 1.95 O 4 improved the electrochemical activity and cycling stability of LiMn 2 O 4 .
Shock waves in luminous early-type stars
International Nuclear Information System (INIS)
Castor, J.I.
1986-01-01
Shock waves that occur in stellar atmospheres have their origin in some hydrodynamic instability of the atmosphere itself or of the stellar interior. In luminous early-type stars these two possibilities are represented by shocks due to an unstable radiatively-accelerated wind, and to shocks generated by the non-radial pulsations known to be present in many or most OB stars. This review is concerned with the structure and development of the shocks in these two cases, and especially with the mass loss that may be due specifically to the shocks. Pulsation-produced shocks are found to be very unfavorable for causing mass loss, owing to the great radiation efficiency that allows them to remain isothermal. The situation regarding radiatively-driven shocks remains unclear, awaiting detailed hydrodynamics calculations. 20 refs., 2 figs
Computer simulations of collisionless shock waves
International Nuclear Information System (INIS)
Leroy, M.M.
1984-01-01
A review of the contributions of particle computer simulations to the understanding of the physics of magnetic shock waves in collisionless plasmas is presented. The emphasis is on the relation between the computer simulation results, spacecraft observations of shocks in space, and related theories, rather than on technical aspects of the numerics. It is shown that much has been learned from the comparison of ISEE spacecraft observations of the terrestrial bow shock and particle computer simulations concerning the quasi-perpendicular, supercritical shock (ion scale structure, ion reflection mechanism and ultimate dissipation processes). Particle computer simulations have also had an appreciable prospective role in the investigation of the physics of quasi-parallel shocks, about which still little is known observationally. Moreover, these numerical techniques have helped to clarify the process of suprathermal ion rejection by the shock into the foreshock, and the subsequent evolution of the ions in the foreshock. 95 references
An electrochemical study of the systems Li1+-xV2O4 and Li1-xVO2 (0≤x≤1)
International Nuclear Information System (INIS)
De Picciotto, L.A.; Thackeray, M.M.; Pistoia, G.
1988-01-01
Electrochemical properties of the systems Li 1±x V 2 O 4 (0≤x≤1), Li 1-x VO 2 (0≤x 2 O 4 is reversible, which confirms that lithium may be cycled, topotactically, in and out of the Li 1+x V 2 O 4 spinel structure. Delithiation of the LiV 2 O 4 spinel is irreversible; during this process the vanadium ions migrate through the oxide layers. This results in a defect rocksalt phase, which can, in turn, be relithiated by a different mechanism. Lithium extraction for the layered compound LiVO 2 yields a structure similar to the delithiated LiV 2 O 4 product. The spinel-derived compounds Li 1 +-x/V 2 O 4 (0 -3 Ω -1 cm -1 at x=0 and 10 -6 Ω -1 cm -1 at x=1. Lithium diffusion rates in Li 1±x V 2 O 4 samples increase with lithiation from D=4x10 -10 cm 2 /s in LiV 2 O 4 to D=6x10 -8 cm 2 /s in Li 2 V 2 O 4 . Intermediate values of D are obtained in the delithiated compound Li 0.28 V 2 O 4 and in the layered oxide LiVO 2 ; significantly lower values of D, viz. 1x10 -11 cm 2 /s and 4x10 -11 cm 2 /s , are found in the spinels LiMn 2 O 4 and Fe 3 O 4 respectively. 28 refs.; 5 figs.; 1 table
The astrophysical reaction 8Li(n,gamma)9Li from measurements by reverse kinematics
Bertulani, Carlos A.
1998-01-01
We study the breakup of 9Li projectiles in high energy (28.5 MeV/u) collisions with heavy nuclear targets (208Pb). The wave functions are calculated using a single-particle model for 9Li, and a simple optical potential model for the scattering part. A good agreement with measured data is obtained with insignificant E2 contribution.
Shock-induced devolatilization of calcite
Boslough, M. B.; Ahrens, T. J.; Vizgirda, J.; Becker, R. H.; Epstein, S.
1982-01-01
Experimental measurements of the release adiabats by Vizgirda (1981) indicate that substantial vaporization takes place upon release from shock pressures of 37 GPa for calcite and 14 GPa for aragonite. The present investigation includes the first controlled partial vaporization experiments on calcite. The experiments were conducted to test the predictions of the release adiabat experiments. The quantities of the gaseous species produced from shocked calcite and their carbon and oxygen isotopic compositions were determined, and the shock-induced effect on the Mn(2+) electron spin resonance spectrum in the shock-recovered calcite was observed. On the basis of the obtained results, it is concluded that shock stresses at the 17-18 GPa level give rise to volatilization of 0.03-0.3 (mole) percent of calcite to CO2 and CO. The devolatilization of calcite occurs at low pressure at significantly lower entropy densities than predicted on the basis of thermodynamic continuum models.
Shocking matter to extreme conditions
International Nuclear Information System (INIS)
Gupta, Y.M.; Sharma, S.M.
1997-01-01
A good understanding of the thermodynamic response of matter at high compression and high energy densities is important to several areas of physics. Shock-wave experiments are uniquely suited for obtaining data at extreme conditions, and a shock-compressed matter can be viewed as a condensed system with or without dissociation or as a strongly coupled plasma. This article reviews work by Da Silva et al. in which irradiances ranging from 5x10 superscript 12 to 2x10 superscript 14 W/cm 2 were used to generate 8- to 10-ns square pulses in liquid deuterium. The authors demonstrated negligible pre-heating of the sample, steady propagation of the shock wave, and direct determination of the shock wave velocity along with particle velocity and density in the shocked state. Da Silva et al. results are compared with models and other experimental information, and the usefulness of the data in other areas is assessed. 11 refs., 1 fig
Mechanisms of emission of particles charged in 6Li + 6Li and 6Li + 10B reactions at low energies
International Nuclear Information System (INIS)
Quebert, Jean
1964-01-01
The lithium 6 nucleus is a projectile of interest to study nuclear reactions at low energy due to the possibility to obtain high heats of reaction, and to its structure which can play an important role in the projectile-target interaction. This research thesis focused on the study of two low-energy reactions provoked by lithium projectiles. These reactions are studied within the framework of the theoretical model of aggregates. The first part presents the experimental conditions of both reactions, reports the development and analysis of nuclear plates, and the transformation of a given type of particle histogram into a spectrum in the mass centre system. The next parts report the study of the 6 Li + 6 Li reaction (previous results, kinematic analysis, spectrum of secondary particles, theoretical analysis of results) and of the 6 Li + 10 B reaction (previous results, experimental results, study of the continuous spectrum of alpha particle, reaction mechanisms)
Tan, Rui; Gao, Rongtan; Zhao, Yan; Zhang, Mingjian; Xu, Junyi; Yang, Jinlong; Pan, Feng
2016-11-16
A novel type of organic-inorganic hybrid polymer electrolytes with high electrochemical performances around room temperature is formed by hybrid of nanofillers, Y-type oligomer, polyoxyethylene and Li-salt (PBA-Li), of which the T g and T m are significantly lowered by blended heterogeneous polyethers and embedded nanofillers with benefit of the dipole modification to achieve the high Li-ion migration due to more free-volume space. The quasi-solid-state Li-ion batteries based on the LiFePO 4 /15PBA-Li/Li-metal cells present remarkable reversible capacities (133 and 165 mAh g -1 @0.2 C at 30 and 45 °C, respectively), good rate ability and stable cycle performance (141.9 mAh g -1 @0.2 C at 30 °C after 150 cycles).
Why the Nature of Oil Shocks Matters
International Nuclear Information System (INIS)
Archanskaia, Elizaveta; Hubert, Paul; Creel, Jerome
2009-03-01
This article studies the impact of oil shocks on the macro-economy in two ways insofar unexploited in the literature. The analysis is conducted at the global level, and it explicitly accounts for the potentially changing nature of oil shocks. Based on an original world GDP series and a grouping of oil shocks according to their nature, we find that oil supply shocks negatively impact world growth, contrary to oil demand shocks, pro-cyclical in their nature. This result is robust at the national level for the US. Furthermore, endogenous monetary policy is shown to have no counter-cyclical effects in the context of an oil demand shock. (authors)
The microphysics of collisionless shock waves
DEFF Research Database (Denmark)
Marcowith, Alexandre; Bret, Antoine; Bykov, Andrei
2016-01-01
Collisionless shocks, that is shocks mediated by electromagnetic processes, are customary in space physics and in astrophysics. They are to be found in a great variety of objects and environments: magnetospheric and heliospheric shocks, supernova remnants, pulsar winds and their nebulæ, active ga...
Laser shock wave and its applications
Yang, Chaojun; Zhang, Yongkang; Zhou, Jianzhong; Zhang, Fang; Feng, Aixin
2007-12-01
The technology of laser shock wave is used to not only surface modification but also metal forming. It can be divided into three parts: laser shock processing, laser shock forming (LSF) and laser peenforming(LPF). Laser shock processing as a surface treatment to metals can make engineering components have a residual compressive stress so that it obviously improves their fatigue strength and stress corrosion performances, while laser shock forming (LSF) is a novel technique that is used in plastic deformation of sheet metal recently and Laser peen forming (LPF) is another new sheet metal forming process presented in recent years. They all can be carried out by a high-power and repetition pulse Nd:Glass laser device made by Jiangsu University. Laser shock technology has characterized of ultrahigh pressure and high strain rate (10 6 - 10 7s -1). Now, for different materials, we are able to form different metals to contours and shapes and simultaneity leave their surfaces in crack-resistant compressive stress state. The results show that the technology of laser shock wave can strengthen surface property and prolong fatigue life and especially can deform metals to shapes that could not be adequately made using conventional methods. With the development of the technology of laser shock wave, the applied fields of laser will become greater and greater.
Behavior of pellet injected Li ions into heliotron E plasmas
International Nuclear Information System (INIS)
Kondo, K.; Christou, C.; Ida, K.
1996-07-01
Li pellet injection has provided a complex plasma with a large fraction of Li ions, which is characterized by intense emissions from Li I and III. The spatial profiles of the fully ionized Li 3+ ions are measured by charge exchange recombination spectroscopy with a resolution of 13 mm, and the local decay time of the injected Li ion has been estimated. The spectral profile of the charge exchange recombination line of Li 2+ from n=5 to n=4 shows a complicated structure, which depends of Li 3+ density. The effects on other intrinsic impurities and recycled Li are also discussed. (author)
The cosmic {sup 6}Li and {sup 7}Li problems and BBN with long-lived charged massive particles
Energy Technology Data Exchange (ETDEWEB)
Karsten, Jedamzik [Montpellier-2 Univ., Lab. de Physique Mathemathique et Theorique, C.N.R.S., 34 - Montpellier (France)
2007-07-01
Charged massive particles (CHAMPs), when present during the Big Bang nucleosynthesis (BBN) era, may significantly alter the synthesis of light elements when compared to a standard BBN scenario. This is due to the formation of bound states with nuclei. This paper presents a detailed numerical and analytical analysis of such CHAMP BBN. All reactions important for predicting light-element yields are calculated within the Born approximation. Three prior neglected effects are treated in detail: (a) photo destruction of bound states due to electromagnetic cascades induced by the CHAMP decay, (b) late-time efficient destruction/production of H{sup 2}, Li{sup 6}, and Li{sup 7} due to reactions on charge Z = 1 nuclei bound to CHAMPs, and (c) CHAMP exchange between nuclei. Each of these effects may induce orders-of-magnitude changes in the final abundance yields. The study focusses on the impact of CHAMPs on a possible simultaneous solution of the Li{sup 6} and Li{sup 7} problems. It is shown that a prior suggested simultaneous solution of the Li{sup 6} and Li{sup 7} problems for a relic decaying at {tau}{sub x} {approx} 1000 s is only very weakly dependent on the relic being neutral or charged, unless its hadronic branching ratio is B{sub h} << 10{sup -4} very small. By use of a Monte-Carlo analysis it is shown that within CHAMP BBN the existence of further parameter space for a simultaneous solution of the Li{sup 6} and Li{sup 7} problem for long decay times {tau}{sub x} {>=} 10{sup 6} s seems possible but fairly unlikely. (author)
International Nuclear Information System (INIS)
Valerio, Mario Ernesto Giroldo; Amaral, Jomar Batista de; Baldochi, Sonia Licia Vera; Mazzocchi, L.; Sasaki, Jose Marcos; Jackson, Robert A.
2004-01-01
Full text: Cr-doped LiCaAlF 6 (LiCAF) and LiSrAlF 6 (LiSAF) were used as laser operating in the near infrared region. Ce-doped LiCAF and LiSAF have been reported as leading candidates for tunable all-solid-state lasers in the UV region. Spectroscopic properties of LiCaAlF 6 : Nd suggest that this crystal can be used as selective optical filter and refractive element for 157 nm photolithography. The question of whether the RE dopant will prefer the Li + , the M 2+ site or the Al 3+ site is not yet known. Nevertheless most of the optical properties of these hosts including their laser action depend on the local symmetry, charge compensation mechanism and possible deformation of the lattice. In the present work, Powder X-ray Diffraction (XRD), X-ray Absorption Spectroscopy (XAS), Spectro fluorimetry, combined with computer modeling, were used to study the local structure around the dopant and determine the site occupied by them and also the distance and nature of the co-ordinating atoms. The compounds were prepared from commercially available CaF2 and SrF2 powders of high purity; LiF previously purified by the zone melting method, and AlF3 and RE dopants obtained from the hydro fluorination of commercial Al 2 O 3 . The synthesis of 2 mol % RE doped LiCAF and LiSAF samples were performed in a platinum reactor. The compositions were 2 mol % LiF and AlF3 enriched to compensate for their high vaporization. Powder XRD measurements were performed at room temperature in a Rigaku DMAX diffractometer in step scan mode using Cu K radiation. The Rietveld method (DBWS-9807a software) was employed in the analysis of the patterns. It was found that in the doped samples the concentration of the LiCAF or LiSAF phases are 84-95% and a small amount of AlF 3 and α - Li 3 AlF 6 were formed. The XAS experiments were performed on and above the L III absorption edge of the Er, Ho and Nd ions in fluorescence and transmission mode at room temperature in the XAS station at the LNLS, Campinas
Relativistic shocks and particle acceleration
International Nuclear Information System (INIS)
Heavens, A.F.
1988-01-01
In this paper, we investigate the fluid dynamics of relativistic shock waves, and use the results to calculate the spectral index of particles accelerated by the Fermi process in such shocks. We have calculated the distributions of Fermi-accelerated particles at shocks propagating into cold proton-electron plasma and also cold electron-positron plasma. We have considered two different power spectra for the scattering waves, and find, in contrast to the non-relativistic case, that the spectral index of the accelerated particles depends on the wave power spectrum. On the assumption of thermal equilibrium both upstream and downstream, we present some useful fits for the compression ratio of shocks propagating at arbitrary speeds into gas of any temperature. (author)
Facile Solution Route to Synthesize Nanostructure Li4Ti5O12 for High Rate Li-Ion Battery
Directory of Open Access Journals (Sweden)
M. V. Tran
2016-01-01
Full Text Available High rate Li-ion batteries have been given great attention during the last decade as a power source for hybrid electric vehicles (HEVs, EVs, etc. due to the highest energy and power density. These lithium batteries required a new design of material structure as well as innovative electrode materials. Among the promising candidates, spinel Li4Ti5O12 has been proposed as a high rate anode to replace graphite anode because of high capacity and a negligible structure change during intercalation of lithium. In this work, we synthesized a spinel Li4Ti5O12 in nanosize by a solution route using LiOH and Ti(OBu4 as precursor. An evaluation of structure and morphology by XRD and SEM exhibited pure spinel phase Li4Ti5O12 and homogenous nanoparticles around 100 nm. In the charge-discharge test, nanospinel Li4Ti5O12 presents excellent discharge capacity 160 mAh/g at rate C/10, as well as good specific capacities of 120, 110, and 100 mAh/g at high rates C, 5C and 10C, respectively.
Equation of state of laser-shocked compressed iron; Equation d'etat du fer comprime par choc laser
Energy Technology Data Exchange (ETDEWEB)
Huser, G
2004-01-01
This thesis enters the field of highly compressed materials equation of state studies. In particular, it focuses on the case of laser shock compressed iron. This work indeed aims at getting to the conditions of the earth's core, comprising a solid inner core and a liquid outer core. The understanding of phenomena governing the core's thermodynamics and the geodynamic process requires the knowledge of iron melting line locus around the solid-liquid interface at 3.3 Mbar. Several experiments were performed to that extent. First, an absolute measurement of iron Hugoniot was obtained. Following is a study of partially released states of iron into a window material: lithium fluoride (LiF). This configuration enables direct access to compressed iron optical properties such as reflectivity and self-emission. Interface velocity measurement is dominated by compressed LiF optical properties and is used as a pressure gauge. Using a dual wavelength reflectivity diagnostic, compressed iron electrical conductivity was estimated and found to be in good agreement with previous results found in geophysics literature. Self-emission diagnostic was used to measure temperature of partially released iron and revealed a solid-liquid phase transition at Mbar pressures. (author)
DEFF Research Database (Denmark)
Viswanathan, V.; Thygesen, Kristian Sommer; Hummelshøj, J.S.
2011-01-01
Non-aqueous Li-air or Li-O2 cells show considerable promise as a very high energy density battery couple. Such cells, however, show sudden death at capacities far below their theoretical capacity and this, among other problems, limits their practicality. In this paper, we show that this sudden...... death arises from limited charge transport through the growing Li 2O2 film to the Li2O2-electrolyte interface, and this limitation defines a critical film thickness, above which it is not possible to support electrochemistry at the Li2O 2-electrolyte interface. We report both electrochemical experiments...... using a reversible internal redox couple and a first principles metal-insulator-metal charge transport model to probe the electrical conductivity through Li2O2 films produced during Li-O 2 discharge. Both experiment and theory show a sudden death in charge transport when film thickness is ∼5 to 10 nm...
Shock interaction with a two-gas interface in a novel dual-driver shock tube
Labenski, John R.
Fluid instabilities exist at the interface between two fluids having different densities if the flow velocity and density gradient are anti-parallel or if a shock wave crosses the boundary. The former case is called the Rayleigh-Taylor (R-T) instability and the latter, the Richtmyer-Meshkov (R-M) instability. Small initial perturbations on the interface destabilize and grow into larger amplitude structures leading to turbulent mixing. Instabilities of this type are seen in inertial confinement fusion (ICF) experiments, laser produced plasmas, supernova explosions, and detonations. A novel dual-driver shock tube was used to investigate the growth rate of the R-M instability. One driver is used to create an argon-refrigerant interface, and the other at the opposite end of the driven section generates a shock to force the interface with compressible flows behind the shock. The refrigerant gas in the first driver is seeded with sub-micron oil droplets for visualization of the interface. The interface travels down the driven section past the test section for a fixed amount of time. A stronger shock of Mach 1.1 to 1.3 drives the interface back past the test section where flow diagnostics are positioned. Two schlieren systems record the density fluctuations while light scattering detectors record the density of the refrigerant as a function of position over the interface. A pair of digital cameras take stereo images of the interface, as mapped out by the tracer particles under illumination by a Q-switched ruby laser. The amount of time that the interface is allowed to travel up the driven section determines the interaction time as a control. Comparisons made between the schlieren signals, light scattering detector outputs, and the images quantify the fingered characteristics of the interface and its growth due to shock forcing. The results show that the interface has a distribution of thickness and that the interaction with a shock further broadens the interface. The
Electric shock and electrical fire specialty
International Nuclear Information System (INIS)
2011-02-01
This book deals with electric shock and electrical fire, which is made up seven chapters. It describes of special measurement for electric shock and electrical fire. It mentions concretely about electrical fire analysis and precautionary measurement, electrical shock analysis cases, occurrence of static electricity and measurement, gas accident, analysis of equipment accident and precautionary measurement. The book is published to educate the measurement on electric shock and electrical fire by electrical safety technology education center in Korea Electrical Safety Corporation.
Hot cracks formation nature in welds Al-Mg-Li and Al-Cu-Li alloy systems
International Nuclear Information System (INIS)
Ryazantsev, V.I.; Fedoseev, V.A.
1997-01-01
Mechanism of cleavage formation in alloy systems Al-Mg-Li and Al-Cu-Li welds at thermal test is proposed. This mechanism is connected with stitching spacing and stretching in direction of main deformation of intermetallic compounds inclusions and with active gases movement into the liquid phase [ru
International Nuclear Information System (INIS)
Phani Dathar, Gopi Krishna; Balachandran, Janakiraman; Kent, Paul R. C.; Rondinone, Adam J.; Ganesh, P.
2016-01-01
The attractive safety and long-term stability of all solid-state batteries has added a new impetus to the discovery and development of solid electrolytes for lithium batteries. Recently several superionic lithium conducting solid electrolytes have been discovered. All the superionic lithium containing compounds (β-Li 3 PS 4 and Li 10 GeP 2 S 12 and oxides, predominantly in the garnet phase) have partially occupied sites. This naturally begs the question of understanding the role of partial site occupancies (or site disorder) in optimizing ionic conductivity in these family of solids. In this paper, we find that for a given topology of the host lattice, maximizing the number of sites with similar Li-ion adsorption energies, which gives partial site occupancy, is a natural way to increase the configurational entropy of the system and optimize the conductivity. For a given topology and density of Li-ion adsorption sites, the ionic conductivity is maximal when the number of mobile Li-ions are equal to the number of mobile vacancies, also the very condition for achieving maximal configurational entropy. We demonstrate applicability of this principle by elucidating the role of Li-ion site disorder and the local chemical environment in the high ionic conductivity of β-Li 3 PS 4 . In addition, for β-Li 3 PS 4 we find that a significant density of vacancies in the Li-ion sub-lattice (~25%) leads to sub-lattice melting at (~600 K) leading to a molten form for the Li-ions in an otherwise solid anionic host. This gives a lithium site occupancy that is similar to what is measured experimentally. We further show that quenching this disorder can improve conductivity at lower temperatures. As a consequence, we discover that (a) one can optimize ionic conductivity in a given topology by choosing a chemistry/composition that maximizes the number of mobile-carriers i.e. maximizing both mobile Li-ions and vacancies, and (b) when the concentration of vacancies becomes significant in
Surface Modification of LiMn2O4 for Lithium Batteries by Nanostructured LiFePO4 Phosphate
Directory of Open Access Journals (Sweden)
B. Sadeghi
2012-01-01
Full Text Available LiMn2O4 spinel cathode materials have been successfully synthesized by solid-state reaction. Surface of these particles was modified by nanostructured LiFePO4 via sol gel dip coating method. Synthesized products were characterized by thermally analyzed thermogravimetric and differential thermal analysis (TG/DTA, X-ray diffraction (XRD, scanning electron microscopy (SEM, transmission electron microscopy (TEM, and energy dispersive X-ray spectroscopy (EDX. The results of electrochemical tests showed that the charge/discharge capacities improved and charge retention of battery enhanced. This improved electrochemical performance is caused by LiFePO4 phosphate layer on surfaces of LiMn2O4 cathode particles.
The reaction d(α,γ)6Li at low energies and the primordial nucleosynthesis of 6Li
International Nuclear Information System (INIS)
Cecil, F.E.; Yan, J.; Galovich, C.S.
1996-01-01
We have searched for the reaction d(α,γ) 6 Li at an α-d center-of-mass energy of 53 keV. An upper limit on the reaction S factor is 2.0x10 -7 MeVb at the 90% confidence level, corresponding to a limit on the synthesis of 6 Li from a standard big bang of 0.9% of the present abundance for a total baryon-to-photon ratio 2.86 10 6 Li-to- 7 Li isotopic abundance ratio immediately after a standard big bang is constrained to be less than 0.85%, considerably less than a recent measurement of this ratio in a metal-poor, Population II halo star. copyright 1996 The American Physical Society
Benchmark Linelists and Radiative Cooling Functions for LiH Isotopologues
Diniz, Leonardo G.; Alijah, Alexander; Mohallem, José R.
2018-04-01
Linelists and radiative cooling functions in the local thermodynamic equilibrium limit have been computed for the six most important isotopologues of lithium hydride, 7LiH, 6LiH, 7LiD, 6LiD, 7LiT, and 6LiT. The data are based on the most accurate dipole moment and potential energy curves presently available, the latter including adiabatic and leading relativistic corrections. Distance-dependent reduced vibrational masses are used to account for non-adiabatic corrections of the rovibrational energy levels. Even for 7LiH, for which linelists have been reported previously, the present linelist is more accurate. Among all isotopologues, 7LiH and 6LiH are the best coolants, as shown by the radiative cooling functions.
Electromagnetically driven radiative shocks and their measurements
International Nuclear Information System (INIS)
Kondo, K.; Watanabe, M.; Nakajima, M.; Kawamura, T.; Horioka, K.
2005-01-01
Experimental results on a generation of strong shocks in a compact pulse power device are reported. The characteristics of strong shocks are different from hydrodynamical shocks' because they depend on not only collisions but radiation processes. Radiative shocks are relevant to high energy density phenomena such as the explosions of supernovae. When initial pressure is lower than about 50 mtorr, an interesting structure is confirmed at the shock front, which might indicate a phenomenon proceeded by the radiative process. (author)
Diffusion of Li+ ion on graphene: A DFT study
International Nuclear Information System (INIS)
Zheng Jiming; Ren Zhaoyu; Guo Ping; Fang Li; Fan Jun
2011-01-01
Density functional theory investigations show that the Li + ion is stabilized at Center of hexagonal carbon ring with the distance of 1.84 Å from graphene surface. The potential barrier of Li + ion diffusion on the graphene surface, about 0.32 eV, is much lower than that of Li + ion penetrating the carbon ring which is 10.68 eV. When a vacancy of graphene exists, potential barrier about 10.25 eV for Li + ion penetrating the defect is still high, and the ability of the vacancy to sizing the Li + ion is also observed. Electronic densities of states show that the formation of a localized bond between Li atom and edge carbon of vacancy is the main reason for high potential barrier when Li + ion penetrate a vacancy. While Coulomb repulsion is the control factor for high potential barrier in case of Li + ion penetrating a carbon ring.
Entropy Generation Across Earth's Bow Shock
Parks, George K.; McCarthy, Michael; Fu, Suiyan; Lee E. s; Cao, Jinbin; Goldstein, Melvyn L.; Canu, Patrick; Dandouras, Iannis S.; Reme, Henri; Fazakerley, Andrew;
2011-01-01
Earth's bow shock is a transition layer that causes an irreversible change in the state of plasma that is stationary in time. Theories predict entropy increases across the bow shock but entropy has never been directly measured. Cluster and Double Star plasma experiments measure 3D plasma distributions upstream and downstream of the bow shock that allow calculation of Boltzmann's entropy function H and his famous H-theorem, dH/dt O. We present the first direct measurements of entropy density changes across Earth's bow shock. We will show that this entropy generation may be part of the processes that produce the non-thermal plasma distributions is consistent with a kinetic entropy flux model derived from the collisionless Boltzmann equation, giving strong support that solar wind's total entropy across the bow shock remains unchanged. As far as we know, our results are not explained by any existing shock models and should be of interests to theorists.
LiDAR utility for natural resource managers
Andrew Thomas Hudak; Jeffrey Scott Evans; Alistair Mattthew Stuart. Smith
2009-01-01
Applications of LiDAR remote sensing are exploding, while moving from the research to the operational realm. Increasingly, natural resource managers are recognizing the tremendous utility of LiDAR-derived information to make improved decisions. This review provides a cross-section of studies, many recent, that demonstrate the relevance of LiDAR across a suite of...
Risk shocks and housing markets
Dorofeenko, Viktor; Lee, Gabriel S.; Salyer, Kevin D.
2010-01-01
Abstract: This paper analyzes the role of uncertainty in a multi-sector housing model with financial frictions. We include time varying uncertainty (i.e. risk shocks) in the technology shocks that affect housing production. The analysis demonstratesthat risk shocks to the housing production sector are a quantitatively important impulse mechanism for the business cycle. Also, we demonstrate that bankruptcy costs act as an endogenous markup factor in housing prices; as a consequence, the volati...
PIV tracer behavior on propagating shock fronts
International Nuclear Information System (INIS)
Glazyrin, Fyodor N; Mursenkova, Irina V; Znamenskaya, Irina A
2016-01-01
The present work was aimed at the quantitative particle image velocimetry (PIV) measurement of a velocity field near the front of a propagating shock wave and the study of the dynamics of liquid tracers crossing the shock front. For this goal, a shock tube with a rectangular cross-section (48 × 24 mm) was used. The flat shock wave with Mach numbers M = 1.4–2.0 propagating inside the tube channel was studied as well as an expanding shock wave propagating outside the channel with M = 1.2–1.8 at its main axis. The PIV imaging of the shock fronts was carried out with an aerosol of dioctyl sebacate (DEHS) as tracer particles. The pressures of the gas in front of the shock waves studied ranged from 0.013 Mpa to 0.1 MPa in the series of experiments. The processed PIV data, compared to the 1D normal shock theory, yielded consistent values of wake velocity immediately behind the plain shock wave. Special attention was paid to the blurring of the velocity jump on the shock front due to the inertial particle lag and peculiarities of the PIV technique. A numerical algorithm was developed for analysis and correction of the PIV data on the shock fronts, based on equations of particle-flow interaction. By application of this algorithm, the effective particle diameter of the DEHS aerosol tracers was estimated as 1.03 ± 0.12 μm. A number of different formulations for particle drag were tested with this algorithm, with varying success. The results show consistency with previously reported experimental data obtained for cases of stationary shock waves. (paper)
The LiBH4-LiI Solid Solution as an Electrolyte in an All-Solid-State Battery
DEFF Research Database (Denmark)
Sveinbjörnsson, Dadi Þorsteinn; Christiansen, Ane Sælland; Viskinde, Rasmus
2014-01-01
The charge and discharge performance of an all-solid-state lithium battery with the LiBH4-LiI solid solution as an electrolyte is reported. Lithium titanate (Li4Ti5O12) was used as the positive electrode and lithium metal as the negative electrode. The performance of the all-solid-state cell...
DEFF Research Database (Denmark)
Willerslev, Rane; Suhr, Christian
2014-01-01
The modern medium of film has long been hailed for its capacity for producing shocks of an entertaining, thought-provoking, or even politically emancipative nature. But what is a shock, how and when does it occur, how long does it last, and are there particular techniques for producing cinematic...