WorldWideScience

Sample records for shih fu-tai ames

  1. Use of Shih in Chinese Operational Art

    2016-05-26

    These include leaders seeking to manipulate context, build troop morale through context, use an indirect approach, and exploit propensity within a...characteristics help determine whether or not shih was a factor in a given conflict. These include leaders seeking to manipulate context, build troop morale ...U.S. Army War College, 2011), ix-x; William H. Mott and Jae Chang Kim, The Philosophy of Chinese Military Culture: Shih vs. Li (New York, NY: Palgrave

  2. Autonomy @ Ames

    Van Dalsem, William; Krishnakumar, Kalmanje Srinivas

    2016-01-01

    This is a powerpoint presentation that highlights autonomy across the 15 NASA technology roadmaps, including specific examples of projects (past and present) at NASA Ames Research Center. The NASA technology roadmaps are located here: http:www.nasa.govofficesocthomeroadmapsindex.html

  3. A case of gastrinoma in a Shih-Tzu dog.

    Fukushima, Ushio; Sato, Miyuki; Okano, Shozo; Aramaki, Yoshitaka; Ito, Hiroshi; Yoshioka, Kazuki; Oyamada, Toshifumi; Uechi, Masami

    2004-03-01

    A five-year-old male Shih-Tzu dog presented with severe vomiting and weight loss. The clinical signs were successfully improved by an eight-day treatment with an H(2)-receptor antagonist, gastrointestinal protectant and antibiotics. Ten days later, however, recurrence of vomiting was seen despite continuous medical treatment. Based on clinical signs and the results of various diagnostic tests including CBC, biochemical analysis, contrast radiography, and endoscopy, a duodenal or pancreatic neoplasm was suspected and exploratory laparotomy was conducted. Some swollen pancreatic regions were found, and biopsy of the pancreas indicated the diagnosis of a gastrin-secreting tumor. Consequently, based on a high serum gastrin level as well as clinical signs and immunohistological findings, we diagnosed the disease as canine gastrinoma, a rare tumor of the pancreas.

  4. Routine environmental audit of Ames Laboratory, Ames, Iowa

    1994-09-01

    This document contains the findings identified during the routine environmental audit of Ames Laboratory, Ames, Iowa, conducted September 12--23, 1994. The audit included a review of all Ames Laboratory operations and facilities supporting DOE-sponsored activities. The audit's objective is to advise the Secretary of Energy, through the Assistant Secretary for Environment, Safety and Health, as to the adequacy of the environmental protection programs established at Ames Laboratory to ensure the protection of the environment, and compliance with Federal, state, and DOE requirements

  5. Calming effect of orally administered γ-aminobutyric acid in Shih Tzu dogs.

    Uetake, Katsuji; Okumoto, Ayano; Tani, Noriko; Goto, Akihiro; Tanaka, Toshio

    2012-12-01

    The calming effects of γ-aminobutyric acid (GABA) by oral administration were investigated in four adult Shih Tzu dogs. Three dosage levels (1, 2 and 4 mg/kg body weight) and non-administration were tested by an increase and decrease method. Changes in activity (for 1.5 h) and urinary cortisol levels (pre-administration, 3 and 7 h later) of dogs were monitored after administration. Without reference to dosage level, the mean times spent standing (P = 0.06), sitting (P level was observed at 7 h after administration (P GABA exerts calming effects on dogs as well as humans. © 2012 The Authors. Animal Science Journal © 2012 Japanese Society of Animal Science.

  6. Double Intussusception in a Shih-Tzu Puppy: The Triple-Circle Sign

    J. M. Kim, S. S. Kang1, G. Kim and S. H. Choi*

    2012-05-01

    Full Text Available Intussusception is a common surgical disorder in puppies. Double intussusception (DI however, is an extremely rare form of this pathology. The authors report a case of a 3-month-old, Shih-Tzu puppy referred to Veterinary Medical Center of Chungbuk National University, Korea with symptoms of abdominal discomfort, intermittent vomiting and bloody diarrhea for 5 days. Ultrasonographic examination of the left mid-abdominal region revealed a mass with a ‘triple case’ sign completely different from the classic ‘target sign’. The surgical intervention confirmed it to be an ileocecal DI in ascending colon. The case emphasizes the rare ‘triple case’ sign as a descriptive finding on ultrasonography in DI presentations.

  7. A Case Study of Synchronous Distance Learning Between Shih Chien University and Beijing Foreign Studies University

    Yen-Fen Lo

    2016-08-01

    Full Text Available Shih Chien University and Beijing Foreign Studies University collaboratively launched a project to offer synchronous distance learning courses on "Case Studies of Taiwanese Entrepreneurs" since February 2012. The three objectives of this study are: (1 to explore the Cross-Strait students' motives for selecting the course; (2 to examine the students' accommodation condition before and after completing the course; (3 to discuss the student's level of satisfaction of the course. This study uses qualitative data from case study interviews conducted in the second year of the project based on the research focus of the Cross-Strait students' motivation and satisfaction of the course. The research analysis tools are content analysis and theory triangulation. The findings are: (1 Cross-Strait students are motivated by their curiosity about the course, interest in the contents, and willingness to experience the novelty of distance learning to select the course; (2 the results of Cross-Strait students' accommodation condition are correlated to their interactions with the professor, the familiarity with the materials, the quality of the communication equipment, and the clarity of the images; (3 Cross-Strait students all accept the method of synchronous distance learning; (4 the quality of communication equipment has the lowest level of satisfaction.

  8. Factors Associated with Fear of Falling among Community-Dwelling Older Adults in the Shih-Pai Study in Taiwan

    Chang, Hsiao-Ting; Chen, Hsi-Chung; Chou, Pesus

    2016-01-01

    Background Fear of falling is an important risk indicator for adverse health related outcomes in older adults. However, factors associated with fear of falling among community-dwelling older adults are not well-explored. Objectives To explore the quality of life and associated factors in fear of falling among older people in the Shih-Pai area in Taiwan. Methods This community-based survey recruited three thousand eight hundred and twenty-four older adults aged ? 65 years. The measurements inc...

  9. Ames Optimized TCA Configuration

    Cliff, Susan E.; Reuther, James J.; Hicks, Raymond M.

    1999-01-01

    Configuration design at Ames was carried out with the SYN87-SB (single block) Euler code using a 193 x 49 x 65 C-H grid. The Euler solver is coupled to the constrained (NPSOL) and the unconstrained (QNMDIF) optimization packages. Since the single block grid is able to model only wing-body configurations, the nacelle/diverter effects were included in the optimization process by SYN87's option to superimpose the nacelle/diverter interference pressures on the wing. These interference pressures were calculated using the AIRPLANE code. AIRPLANE is an Euler solver that uses a unstructured tetrahedral mesh and is capable of computations about arbitrary complete configurations. In addition, the buoyancy effects of the nacelle/diverters were also included in the design process by imposing the pressure field obtained during the design process onto the triangulated surfaces of the nacelle/diverter mesh generated by AIRPLANE. The interference pressures and nacelle buoyancy effects are added to the final forces after each flow field calculation. Full details of the (recently enhanced) ghost nacelle capability are given in a related talk. The pseudo nacelle corrections were greatly improved during this design cycle. During the Ref H and Cycle 1 design activities, the nacelles were only translated and pitched. In the cycle 2 design effort the nacelles can translate vertically, and pitch to accommodate the changes in the lower surface geometry. The diverter heights (between their leading and trailing edges) were modified during design as the shape of the lower wing changed, with the drag of the diverter changing accordingly. Both adjoint and finite difference gradients were used during optimization. The adjoint-based gradients were found to give good direction in the design space for configurations near the starting point, but as the design approached a minimum, the finite difference gradients were found to be more accurate. Use of finite difference gradients was limited by the

  10. NASA Ames Environmental Sustainability Report 2011

    Clarke, Ann H.

    2011-01-01

    The 2011 Ames Environmental Sustainability Report is the second in a series of reports describing the steps NASA Ames Research Center has taken toward assuring environmental sustainability in NASA Ames programs, projects, and activities. The Report highlights Center contributions toward meeting the Agency-wide goals under the 2011 NASA Strategic Sustainability Performance Program.

  11. Management process invaded Ames as the Center shifted from NACA to NASA oversight. Ames constructed

    1968-01-01

    Management process invaded Ames as the Center shifted from NACA to NASA oversight. Ames constructed a review room in its headquarters building where, in the graphical style that prevailed in the 1960's, Ames leadership could review progress against schedule, budget and performance measures. Shown, in October 1965 is Merrill Mead chief of Ames' program and resources office. (for H Julian Allen Retirement album)

  12. NASA-Ames vertical gun

    Schultz, P. H.

    1984-01-01

    A national facility, the NASA-Ames vertical gun range (AVGR) has an excellent reputation for revealing fundamental aspects of impact cratering that provide important constraints for planetary processes. The current logistics in accessing the AVGR, some of the past and ongoing experimental programs and their relevance, and the future role of this facility in planetary studies are reviewed. Publications resulting from experiments with the gun (1979 to 1984) are listed as well as the researchers and subjects studied.

  13. Ames Life Science Data Archive: Translational Rodent Research at Ames

    Wood, Alan E.; French, Alison J.; Ngaotheppitak, Ratana; Leung, Dorothy M.; Vargas, Roxana S.; Maese, Chris; Stewart, Helen

    2014-01-01

    The Life Science Data Archive (LSDA) office at Ames is responsible for collecting, curating, distributing and maintaining information pertaining to animal and plant experiments conducted in low earth orbit aboard various space vehicles from 1965 to present. The LSDA will soon be archiving data and tissues samples collected on the next generation of commercial vehicles; e.g., SpaceX & Cygnus Commercial Cargo Craft. To date over 375 rodent flight experiments with translational application have been archived by the Ames LSDA office. This knowledge base of fundamental research can be used to understand mechanisms that affect higher organisms in microgravity and help define additional research whose results could lead the way to closing gaps identified by the Human Research Program (HRP). This poster will highlight Ames contribution to the existing knowledge base and how the LSDA can be a resource to help answer the questions surrounding human health in long duration space exploration. In addition, it will illustrate how this body of knowledge was utilized to further our understanding of how space flight affects the human system and the ability to develop countermeasures that negate the deleterious effects of space flight. The Ames Life Sciences Data Archive (ALSDA) includes current descriptions of over 700 experiments conducted aboard the Shuttle, International Space Station (ISS), NASA/MIR, Bion/Cosmos, Gemini, Biosatellites, Apollo, Skylab, Russian Foton, and ground bed rest studies. Research areas cover Behavior and Performance, Bone and Calcium Physiology, Cardiovascular Physiology, Cell and Molecular Biology, Chronobiology, Developmental Biology, Endocrinology, Environmental Monitoring, Gastrointestinal Physiology, Hematology, Immunology, Life Support System, Metabolism and Nutrition, Microbiology, Muscle Physiology, Neurophysiology, Pharmacology, Plant Biology, Pulmonary Physiology, Radiation Biology, Renal, Fluid and Electrolyte Physiology, and Toxicology. These

  14. Information from Yüan Shih on the Military Cooperation between the Golden Horde and the Yüan Dynasty.

    Zhu-Cheng Zhao.

    2016-12-01

    Full Text Available Research objective: to reveal relations in military affairs between the Golden Horde and the Yüan Dynasty on the basis of the data of the Chinese dynastic history Yüan shih. Research materials: because of the large distance between these medieval Chinggisid powers, internecine strife between the houses of the Jochids and Toluids, armed conflicts between Arik-Boke and Kublai and due to the fact that the rulers of the Jochid ulus supported Arik-Boke, their state became independent from the Great Mongol Empire. Later on, long-term military conflicts and political turmoil interrupted communication between Sarai and Khanbalik. The Jochid ulus and the Yuan dynasty conducted their own foreign policies. However, communication between them was not interrupted and some information from the Golden Horde still fall in Chinese chronicles. One of the important and fundamental sources relating to the Mongol history is Yüan shih (History of the Yüan Dynasty. This written source contains some materials (although in fragments revealing the nature of the relations between the Yuan Dynasty and the Golden Horde. Research results and novelty: the author has provided information that the military units composed of the peoples of the Golden Horde (primarily of the Ases and Kipchaks, as well as of the Russians were among the troops in the Yüan Empire. At the same time, their proportion was significant both in the composition of commanding staff, as well as among ordinary soldiers. However, the source does not contain any information about the conditions under which these warriors arrived in China as well as about the routes they were moving. It is indisputable fact that they were sent to the Far East from the Jochid ulus during the highest power of this state in the reign of khan Uzbek. Perhaps it was an indication that the Yüan emperor displayed his authority over Sarai Khan in the political sense as well.

  15. Tiger Team Assessment of the Ames Laboratory

    1992-03-01

    This report documents the Tiger Assessment of the Ames Laboratory (Ames), located in Ames, Iowa. Ames is operated for the US Department of Energy (DOE) by Iowa State University. The assessment was conducted from February 10 to March 5, 1992, under the auspices of the Office of Special Projects, Office of the Assistant Secretary of Environment, Safety and Health, Headquarters, DOE. The assessment was comprehensive, encompassing Environment, Safety, and Health (ES ampersand H) disciplines; management practices; and contractor and DOE self-assessments. Compliance with applicable Federal, State of Iowa, and local regulations; applicable DOE Orders; best management practices; and internal requirements at Ames Laboratory were assessed. In addition, an evaluation of the adequacy and effectiveness of DOE and the site contractor's management of ES ampersand H/quality assurance program was conducted

  16. Tiger Team Assessment of the Ames Laboratory

    1992-03-01

    This report documents the Tiger Assessment of the Ames Laboratory (Ames), located in Ames, Iowa. Ames is operated for the US Department of Energy (DOE) by Iowa State University. The assessment was conducted from February 10 to March 5, 1992, under the auspices of the Office of Special Projects, Office of the Assistant Secretary of Environment, Safety and Health, Headquarters, DOE. The assessment was comprehensive, encompassing Environment, Safety, and Health (ES H) disciplines; management practices; and contractor and DOE self-assessments. Compliance with applicable Federal, State of Iowa, and local regulations; applicable DOE Orders; best management practices; and internal requirements at Ames Laboratory were assessed. In addition, an evaluation of the adequacy and effectiveness of DOE and the site contractor's management of ES H/quality assurance program was conducted.

  17. The Ames Vertical Gun Range

    Karcz, J. S.; Bowling, D.; Cornelison, C.; Parrish, A.; Perez, A.; Raiche, G.; Wiens, J.-P.

    2016-01-01

    The Ames Vertical Gun Range (AVGR) is a national facility for conducting laboratory- scale investigations of high-speed impact processes. It provides a set of light-gas, powder, and compressed gas guns capable of accelerating projectiles to speeds up to 7 km s(exp -1). The AVGR has a unique capability to vary the angle between the projectile-launch and gravity vectors between 0 and 90 deg. The target resides in a large chamber (diameter approximately 2.5 m) that can be held at vacuum or filled with an experiment-specific atmosphere. The chamber provides a number of viewing ports and feed-throughs for data, power, and fluids. Impacts are observed via high-speed digital cameras along with investigation-specific instrumentation, such as spectrometers. Use of the range is available via grant proposals through any Planetary Science Research Program element of the NASA Research Opportunities in Space and Earth Sciences (ROSES) calls. Exploratory experiments (one to two days) are additionally possible in order to develop a new proposal.

  18. Ames Research Center Research and Technology 2000

    2002-01-01

    This report highlights the challenging work accomplished during fiscal year 2000 by Ames research scientists,engineers, and technologists. It discusses research and technologies that enable the Information Age, that expand the frontiers of knowledge for aeronautics and space, and that help to maintain U.S. leadership in aeronautics and space research and technology development. The accomplishments are grouped into four categories based on four of NASA's Strategic Enterprises: Aerospace Technology, Space Science, Biological and Physical Research, and Earth Science. The primary purpose of this report is to communicate knowledge-to inform our stakeholders, customer, and partners, and the people of the United States about the scope and diversity of Ames' mission,the nature of Ames' research and technolog) activities,and the stimulating challenges ahead. The accomplishments cited illustrate the contributions that Ames is willing to improve the quality of life for our citizens and the economic position of the United States in the world marketplace.

  19. Factors Associated with Fear of Falling among Community-Dwelling Older Adults in the Shih-Pai Study in Taiwan.

    Hsiao-Ting Chang

    Full Text Available Fear of falling is an important risk indicator for adverse health related outcomes in older adults. However, factors associated with fear of falling among community-dwelling older adults are not well-explored.To explore the quality of life and associated factors in fear of falling among older people in the Shih-Pai area in Taiwan.This community-based survey recruited three thousand eight hundred and twenty-four older adults aged ≥ 65 years. The measurements included a structured questionnaire, including quality of life by using Short-Form 36, and information of fear of falling, fall history, demographics, medical conditions, insomnia, sleep quality, depression and subjective health through face-to-face interviews.A total of 53.4% of participants reported a fear of falling. The rate of fear of falling was higher in female subjects. Subjects with fear of falling had lower Short Form-36 scores both for men and women. Falls in the previous year, older age, insomnia, depression and worse subjective health were correlates of fear of falling for both sexes. Male-specific associations with fear of falling were the accessibility of medical help in an emergency, diabetes mellitus and stroke. In parallel, cardiovascular diseases were a female-specific correlate for fear of falling.Fear of falling is prevalent among community-dwelling older adults. It is seems that there are gender differences in fear of falling with respect to the prevalence and associated factors in older adults. Gender differences should be considered when planning prevention and intervention strategies for fear of falling among older people.

  20. AmE 2012. Automotive meets electronics

    NONE

    2012-11-01

    This conference CD contains 19 contributions, which were presented at the AmE 2012. The main topics were: (1) Electrification; (2) High voltage (board networks) and electromagnetic compatibility; (3) Car-to-X and driver assistance; (4) Diagnosis; (5) Electrical systems. Six contributions were recorded separately for the ENERGY database. [German] Diese Tagungs-CD enthaelt 19 Beitraege, die auf der AmE 2012 vorgestellt wurden. Die Themenschwerpunkte waren: 1. Electrification; 2. Hochvolt(-bordnetze) und Elektromagnetische Vertraeglichkeit; 3. Car-to-X und Fahrerassistenz; 4. Diagnose; 5. Bordnetze. Sechs Beitraege wurden separat fuer die ENERGY-Datenbank aufgenommen.

  1. NASA Ames Fluid Mechanics Laboratory research briefs

    Davis, Sanford (Editor)

    1994-01-01

    The Ames Fluid Mechanics Laboratory research program is presented in a series of research briefs. Nineteen projects covering aeronautical fluid mechanics and related areas are discussed and augmented with the publication and presentation output of the Branch for the period 1990-1993.

  2. An aerial radiological survey of the Ames Laboratory and surrounding area, Ames, Iowa

    Maurer, R.J.

    1993-04-01

    An aerial radiological survey of the Ames Laboratory and surrounding area in Ames, Iowa, was conducted during the period July 15--25, 1991. The purpose of the survey was to measure and document the terrestrial radiological environment at the Ames Laboratory and the surrounding area for use in effective environmental management and emergency response planning. The aerial survey was flown at an altitude of 200 feet (61 meters) along a series of parallel lines 350 feet (107 meters) apart. The survey encompassed an area of 36 square miles (93 square kilometers) and included the city of Ames, Iowa, and the Iowa State University. The results are reported as exposure rates at 1 meter above ground level (inferred from the aerial data) in the form of a gamma radiation contour map. Typical background exposure rates were found to vary from 7 to 9 microroentgens per hour (μR/h). No anomalous radiation levels were detected at the Ames Laboratory. However, one anomalous radiation source was detected at an industrial storage yard in the city of Ames. In support of the aerial survey, ground-based exposure rate and soil sample measurements were obtained at several sites within the survey perimeter. The results of the aerial and ground-based measurements were found to agree within the expected uncertainty of ±15%

  3. Innovate the Teaching of Taiwaness History: An Application of Multimedia Distance Learning—A Web-site Construction Sample of Shih Hsin University

    Shaw-Fong Lee

    2004-03-01

    Full Text Available Traditionally, the teaching of history course mostly utilizes face to face instruction and oral presentation. Along with the development of educational technology, the teaching methods could be more various such as using internet and multimedia. Literature reviews also indicate that using internet and multimedia may improve the effect of learning and teaching. This paper explores the development of a web-based instructional system for the course of Taiwanese History at Shih Hsin University.The result and the product of this development project is the web site, http://distance.shu.edu.tw/taiwan/list.htm. The content of the web-site includes instructional materials such as animations, videos, pictures, texts, historical maps, and so on. The developmental methods used in this project use curriculum design, survey, interview, review of literatures and focus group discussion.[Article content in Chinese

  4. Air Traffic Management Research at NASA Ames

    Davis, Thomas J.

    2012-01-01

    The Aviation Systems Division at the NASA Ames Research Center conducts leading edge research in air traffic management concepts and technologies. This overview will present concepts and simulation results for research in traffic flow management, safe and efficient airport surface operations, super density terminal area operations, separation assurance and system wide modeling and simulation. A brief review of the ongoing air traffic management technology demonstration (ATD-1) will also be presented. A panel discussion, with Mr. Davis serving as a panelist, on air traffic research will follow the briefing.

  5. Radiological survey support activities for the decommissioning of the Ames Laboratory Research Reactor Facility, Ames, Iowa

    Wynveen, R.A.; Smith, W.H.; Sholeen, C.M.; Justus, A.L.; Flynn, K.F.

    1984-09-01

    At the request of the Engineering Support Division of the US Department of Energy-Chicago Operations Office and in accordance with the programmatic overview/certification responsibilities of the Department of Energy Environmental and Safety Engineering Division, the Argonne National Laboratory Radiological Survey Group conducted a series of radiological measurements and tests at the Ames Laboratory Research Reactor located in Ames, Iowa. These measurements and tests were conducted during 1980 and 1981 while the reactor building was being decontaminated and decommissioned for the purpose of returning the building to general use. The results of these evaluations are included in this report. Although the surface contamination within the reactor building could presumably be reduced to negligible levels, the potential for airborne contamination from tritiated water vapor remains. This vapor emmanates from contamination within the concrete of the building and should be monitored until such time as it is reduced to background levels. 2 references, 8 figures, 6 tables.

  6. Gender Difference in the Interaction Effects of Diabetes and Hypertension on Stroke among the Elderly in the Shih-Pai Study, Taiwan.

    Yun-Ju Lai

    Full Text Available To investigate the interaction effects of diabetes and hypertension on stroke, and also investigate the independent and interaction effects of parental history and environmental factors on diabetes and hypertension in a cross-sectional elderly population.The Shih-Pai Community Medical Service Program was a community-based, fixed cohort study conducted between June 1999 and November 2002. Socio-demographic and clinical data of subjects aged 65 years and older were collected by well-trained interviewers during home visits. Interaction effects were analyzed using Rothman's synergy index (SI.In total, 4,124 subjects were included in the study, with 2,284 males and 1,840 females. The synergistic interaction of diabetes and hypertension on stroke was statistically significant in women (SI = 3.16, 95% CI: 1.35-7.39. The synergistic interaction of parental diabetes and being overweight on diabetes was only statistically significant in men, and not in women (SI = 3.30, 95% CI: 1.00-10.83 in men, and SI = 1.15, 95% CI: 0.30-4.39 in women.A synergistic interaction was found for diabetes and hypertension in both sexes when parental history and being overweight were combined. Furthermore, combining diabetes and hypertension in elderly women was significant in terms of the risk of stroke. Strategies to control risk factors in individuals at additional high risk are urgently needed.

  7. Ames life science telescience testbed evaluation

    Haines, Richard F.; Johnson, Vicki; Vogelsong, Kristofer H.; Froloff, Walt

    1989-01-01

    Eight surrogate spaceflight mission specialists participated in a real-time evaluation of remote coaching using the Ames Life Science Telescience Testbed facility. This facility consisted of three remotely located nodes: (1) a prototype Space Station glovebox; (2) a ground control station; and (3) a principal investigator's (PI) work area. The major objective of this project was to evaluate the effectiveness of telescience techniques and hardware to support three realistic remote coaching science procedures: plant seed germinator charging, plant sample acquisition and preservation, and remote plant observation with ground coaching. Each scenario was performed by a subject acting as flight mission specialist, interacting with a payload operations manager and a principal investigator expert. All three groups were physically isolated from each other yet linked by duplex audio and color video communication channels and networked computer workstations. Workload ratings were made by the flight and ground crewpersons immediately after completing their assigned tasks. Time to complete each scientific procedural step was recorded automatically. Two expert observers also made performance ratings and various error assessments. The results are presented and discussed.

  8. AMES: Towards an Agile Method for ERP Selection

    Juell-Skielse, Gustaf; Nilsson, Anders G.; Nordqvist, Andreas; Westergren, Mattias

    2012-01-01

    Conventional on-premise installations of ERP are now rapidly being replaced by ERP as service. Although ERP becomes more accessible and no longer requires local infrastructure, current selection methods do not take full advantage of the provided agility. In this paper we present AMES (Agile Method for ERP Selection), a novel method for ERP selection which better utilizes the strengths of service oriented ERP. AMES is designed to shorten lead time for selection, support identification of essen...

  9. The ames network and the task group on WWER's

    Davies, L.M.; Duysen, J.C. van; Estorff, U. von; Sycamore, D.

    1997-01-01

    The European Network on 'Ageing Materials Evaluation and Studies' (AMES) was created in 1993. Its main objectives are (a) to provide information and understanding on neutron irradiation effects in reactor materials in support of designers, operators, regulators and researchers and (b) to establish and discharge projects in the above areas. The Steering Committee is composed of at least one participant from each nuclear European Union country. The JRC's Institute for Advanced Materials of the European Commission plays the role of Operating Agent and Manager of the AMES Network. This paper describes the structure, objectives, and major projects of the AMES network. Particular emphasis is placed upon the work it is intended to perform within the Task Group on 'WWER's of the first AMES project (AMES1) on 'Validation of surveillance practice and mitigation methods'. EC DGXVII is addressing the question of how to facilitate contacts between EU and Russian industries in the framework of nuclear Industrial co-operation, and this project may provide a suitable starting point upon which to develop a basis for further work of mutual interest. (author)

  10. Functionally enhanced brown adipose tissue in Ames dwarf mice.

    Darcy, Justin; Bartke, Andrzej

    2017-01-02

    Reduced insulin-like growth factor 1/insulin signaling (IIS) has been linked to extended longevity in species ranging from yeast to mammals. In mammals, this is exemplified in Ames dwarf (Prop1 df/df ) mice, which have a 40%-60% increase in longevity (males and females, respectively) due to their recessive Prop1 loss-of-function mutation that results in lack of growth hormone (GH), thyroid-stimulating hormone and prolactin. Our laboratory has previously shown that Ames dwarf mice have functionally unique white adipose tissue (WAT) that improves, rather than impairs, insulin sensitivity. Because GH and thyroid hormone are integral to adipose tissue development and function, we hypothesized that brown adipose tissue (BAT) in Ames dwarf mice may also be functionally unique and/or enhanced. Here, we elaborate on our recent findings, which demonstrate that BAT is functionally enhanced in Ames dwarf mice, and suggest that BAT removal in these mice results in utilization of WAT depots as an energy source. We also discuss how our findings compare to those in other long-lived dwarf mice with altered IIS, which unlike Ames dwarf mice, are essentially euthyroid. Lastly, we provide some insights into the implications of these findings and discuss some of the necessary future work in this area.

  11. Building Climate Resilience at NASA Ames Research Center

    Iraci, L. T.; Mueller, C.; Podolske, J. R.; Milesi, C.

    2016-12-01

    NASA Ames Research Center, located at the southern end of the San Francisco Bay (SFB) estuary, has identified three primary vulnerabilities to changes in climate. The Ames Climate Adaptation Science Investigator (CASI) workgroup has studied each of these challenges to operations and the potential exposure of infrastructure and employees to an increased frequency of hazards. Sea level rise inundation scenarios for the SFB Area generally refer to projected scenarios in mean sea level rather than changes in extreme tides that could occur during future storm conditions. In the summer of 2014, high resolution 3-D mapping of the low-lying portion of Ames was performed. Those data are integrated with improved sea level inundation scenarios to identify the buildings, basements and drainage systems potentially affected. We will also identify the impacts of sea level and storm surge effects on transportation to and from the Center. This information will help Center management develop future master plans. Climate change will also lead to changes in temperature, storm frequency and intensity. These changes have potential impacts on localized floods and ecosystems, as well as on electricity and water availability. Over the coming decades, these changes will be imposed on top of ongoing land use and land cover changes, especially those deriving from continued urbanization and increase in impervious surface areas. These coupled changes have the potential to create a series of cascading impacts on ecosystems, including changes in primary productivity and disturbance of hydrological properties and increased flood risk. The majority of the electricity used at Ames is supplied by hydroelectric dams, which will be influenced by reductions in precipitation or changes in the timing or phase of precipitation which reduces snow pack. Coupled with increased demand for summertime air conditioning and other cooling needs, NASA Ames is at risk for electricity shortfalls. To assess the

  12. Ames and other European networks in integrity of ageing structures

    Davies, L.M.; Von Estorff, U.; Crutzen, S.

    1996-01-01

    Several European institutions and organisations and the Joint Research Centre have developed co-operative programmes now organised into Networks for mutual benefit. They include utilities, engineering companies, Research and Development laboratories and regulatory bodies. Networks are organised and managed like the successful Programme for the Inspection of Steel Components (PISC). The JRC's Institute for Advanced Materials of the European Commission plays the role of Operating Agent and manager of these Networks: ENIQ. AMES, NESC, each of them dealing with specific aspect of fitness for purpose of materials in structural components. This paper describes the structure and the objectives of these networks. Particular emphasis is given to the network AMES

  13. Correlates of self-report chronic insomnia disorders with 1-6 month and 6-month durations in home-dwelling urban older adults - the Shih-Pai Sleep Study in Taiwan: a cross-sectional community study.

    Chiou, Jing-Hui; Chen, Hsi-Chung; Chen, Kuang-Hung; Chou, Pesus

    2016-06-03

    To examine the correlates of insomnia disorder with different durations in home-dwelling older adults. A cross-sectional survey in the Shih-Pai area of Taipei City, Taiwan (The Shih-Pai Sleep Study). A total 4047 subjects over the age of 65 years completed the study (2259 men and 1788 women). The Pittsburgh Sleep Quality Index and the duration of insomnia symptoms were used to identify DSM-IV 1-6 month and 6-month insomnia disorders. The prevalence of DSM-IV defined insomnia disorder was 5.8 %; two-thirds of these case lasted for ≥6 months. The shared correlates for both 1-6 and 6-month insomnia disorders were gender (women), depression and moderate pain. Pulmonary diseases were exclusively associated with 1-6 month insomnia disorder (OR: 2.57, 95 % CI: 1.46-4.52). In contrast, heart disease (OR: 1.73, 95 % CI: 1.21-2.49) and severe pain (OR: 2.34, 95 % CI: 1.14-4.40) were associated with 6-month insomnia disorder. The prevalence of persistent insomnia disorder is higher than short-term insomnia disorder. Correlates for less persistent and more persistent insomnia disorder appears to be partially different. Duration quantifiers may be important in the identification of the etiology of insomnia and further studies with follow-ups are needed to examine the order of developing insomnia disorder and associated conditions.

  14. Developing questionnaires for educational research: AMEE Guide No. 87

    La Rochelle, Jeffrey S.; Dezee, Kent J.; Gehlbach, Hunter

    2014-01-01

    In this AMEE Guide, we consider the design and development of self-administered surveys, commonly called questionnaires. Questionnaires are widely employed in medical education research. Unfortunately, the processes used to develop such questionnaires vary in quality and lack consistent, rigorous standards. Consequently, the quality of the questionnaires used in medical education research is highly variable. To address this problem, this AMEE Guide presents a systematic, seven-step process for designing high-quality questionnaires, with particular emphasis on developing survey scales. These seven steps do not address all aspects of survey design, nor do they represent the only way to develop a high-quality questionnaire. Instead, these steps synthesize multiple survey design techniques and organize them into a cohesive process for questionnaire developers of all levels. Addressing each of these steps systematically will improve the probabilities that survey designers will accurately measure what they intend to measure. PMID:24661014

  15. Ames Laboratory annual site environmental report, calendar year 1996

    1998-04-01

    This report summarizes the environmental status of Ames Laboratory for calendar year 1996. It includes descriptions of the Laboratory site, its mission, the status of its compliance with applicable environmental regulations, its planning and activities to maintain compliance, and a comprehensive review of its environmental protection, surveillance and monitoring programs. Ames Laboratory is located on the campus of Iowa State University (ISU) and occupies twelve buildings owned by the Department of Energy (DOE). The Laboratory also leases space in ISU owned buildings. Laboratory activities involve less than ten percent of the total chemical use and approximately one percent of the radioisotope use on the ISU campus. In 1996, the Office of Assurance and Assessment merged with the Environment, Safety and Health Group forming the Environment, Safety, Health and Assurance (ESH and A) office. In 1996, the Laboratory accumulated and disposed of wastes under US Environmental Protection Agency (EPA) issued generator numbers. Ames Laboratory submitted a Proposed Site Treatment Plan to EPA in December 1995. This plan complied with the Federal Facilities Compliance Act (FFCA). It was approved by EPA in January 1996. The consent agreement/consent order was issued in February 1996. Pollution awareness, waste minimization and recycling programs, implemented in 1990 and updated in 1994, continued through 1996. Included in these efforts were a waste white paper and green computer paper recycling program. Ames Laboratory also continued to recycle salvageable metal and used oil, and it recovered freon for recycling. All of the chemical and nearly all of the radiological legacy wastes were properly disposed by the end of 1996. Additional radiological legacy waste will be properly disposed during 1997

  16. Ames Laboratory Site Environmental Report, Calendar year 1991

    Mathison, L.

    1991-01-01

    The summarized data and conclusions from the Ames Laboratory environmental monitoring program are presented in this Annual Site Environmental Report. This program is a working requirement of Department of Energy (DOE) Order 5484.1, ''Environmental Protection, Safety, and Health Protection Information Reporting Requirements'' and Order 5400.1, ''General Environmental Protection Program.'' Ames Laboratory is located on the campus of Iowa State University (ISU) and occupies several buildings owned by the DOE. The Laboratory also leases space in ISU-owned buildings. Laboratory research activities involve less than ten percent of the total chemical use and one percent of the radioisotope use on the ISU campus. Ames Laboratory is responsible for a small chemical burial site, located on ISU property. The site was used for the disposal of chemical and metal slags from thorium and uranium production. Samples of water from existing test wells and upstream and downstream sites on the nearby Squaw Creek show no detectable migration of the contents of the burial site. A Site Assessment plan submitted to the State of Iowa Department of Natural Resources (DNR) was approved. A Remedial Investigation/Feasibility Study work plan has been completed for additional studies at the site. This has been reviewed and approved by the DOE Chicago Field Office and the DNR. A National Environmental Policy Act (NEPA) review of the site resulted in a categorical exclusion finding which has been approved by the DOE. Ames Laboratory has an area contaminated by diesel fuel at the location of a storage tank which was removed in 1970. Soil corings and groundwater have been analyzed for contamination and an assessment written. Pollution awareness and waste minimization programs and plans were implemented in 1990. Included in this effort was the implementation of a waste white paper and green computer paper recycling program

  17. Phospholipid composition and longevity: lessons from Ames dwarf mice.

    Valencak, Teresa G; Ruf, Thomas

    2013-12-01

    Membrane fatty acid (FA) composition is correlated with longevity in mammals. The "membrane pacemaker hypothesis of ageing" proposes that animals which cellular membranes contain high amounts of polyunsaturated FAs (PUFAs) have shorter life spans because their membranes are more susceptible to peroxidation and further oxidative damage. It remains to be shown, however, that long-lived phenotypes such as the Ames dwarf mouse have membranes containing fewer PUFAs and thus being less prone to peroxidation, as would be predicted from the membrane pacemaker hypothesis of ageing. Here, we show that across four different tissues, i.e., muscle, heart, liver and brain as well as in liver mitochondria, Ames dwarf mice possess membrane phospholipids containing between 30 and 60 % PUFAs (depending on the tissue), which is similar to PUFA contents of their normal-sized, short-lived siblings. However, we found that that Ames dwarf mice membrane phospholipids were significantly poorer in n-3 PUFAs. While lack of a difference in PUFA contents is contradicting the membrane pacemaker hypothesis, the lower n-3 PUFAs content in the long-lived mice provides some support for the membrane pacemaker hypothesis of ageing, as n-3 PUFAs comprise those FAs being blamed most for causing oxidative damage. By comparing tissue composition between 1-, 2- and 6-month-old mice in both phenotypes, we found that membranes differed both in quantity of PUFAs and in the prevalence of certain PUFAs. In sum, membrane composition in the Ames dwarf mouse supports the concept that tissue FA composition is related to longevity.

  18. Is the Moon Illusion a Celestial Ames Demonstration?

    Brecher, Kenneth

    2010-01-01

    To most naked eye observers, the Moon appears larger when seen near the horizon than it does when seen near the zenith. This "Moon Illusion” has been reported from as early as the fourth century BC and has been the subject of hundreds of papers and two books. Its explanation does not lie in the realm of physics (atmospheric refraction) or astronomy (eccentric lunar orbit) but, rather, in the realm of visual perception. Theories for the cause of the effect abound but, at present, there is no universally accepted explanation. Because the effect can be easily observed in many locations and during the course of an academic year, the moon illusion can provide a nice astronomical example that involves both direct observations and theoretical analysis. As part of the NSF funded "Project LITE: Light Inquiry Through Experiments", we have been developing inexpensive experiments and demonstrations that can be done at home. One of these is a miniature version of the classic "Ames Room". The life size version was originally developed by Adelbert Ames, Jr. and can be seen in many science museums. Our "digital” Ames Room has been designed to be printed on heavy paper using an inexpensive inkjet printer from a PDF file that is posted on the Project LITE web site http://lite.bu.edu and then cut and folded to make the room. When viewed through one wall using a commonly available door viewer, it dramatically demonstrates how the eye and brain system assesses the relative size of objects by making comparisons with the surrounding environment in which the objects are placed. In this presentation we will discuss some insights that the Ames Room provides that may offer clues to the correct explanation for the Moon Illusion. Project LITE is supported by the NSF through DUE Grant # 0715975.

  19. NASA Ames Arc Jets and Range, Capabilities for Planetary Entry

    Fretter, Ernest F.

    2005-01-01

    NASA is pursuing innovative technologies and concepts as part of America's Vision for Space Exploration. The rapidly emerging field of nanotechnology has led to new concepts for multipurpose shields to prevent catastrophic loss of vehicles and crew against the triple threats of aeroheating during atmospheric entry, radiation (Solar and galactic cosmic rays) and Micrometorid/Orbital Debris (MMOD) strikes. One proposed concept is the Thermal Radiation Impact Protection System (TRIPS) using carbon nanotubes, hydrogenated carbon nanotubes, and ceramic coatings as a multi-use TPS. The Thermophysics Facilities Branch of the Space Technology Division at NASA Ames Research Center provides testing services for the development and validation of the present and future concepts being developed by NASA and national and International research firms. The Branch operates two key facilities - the Range Complex and the Arc Jets. The Ranges include both the Ames Vertical Gun Range (AVGR) and the Hypervelocity Free Flight (HFF) gas guns best suited for MMOD investigations. Test coupons can be installed in the AVGR or HFF and subjected to particle impacts from glass or metal particles from micron to _ inch (6.35-mm) diameters and at velocities from 5 to 8 kilometers per second. The facility can record high-speed data on film and provide damage assessment for analysis by the Principle Investigator or Ames personnel. Damaged articles can be installed in the Arc Jet facility for further testing to quantify the effects of damage on the heat shield s performance upon entry into atmospheric environments.

  20. Unique life sciences research facilities at NASA Ames Research Center

    Mulenburg, G. M.; Vasques, M.; Caldwell, W. F.; Tucker, J.

    1994-01-01

    The Life Science Division at NASA's Ames Research Center has a suite of specialized facilities that enable scientists to study the effects of gravity on living systems. This paper describes some of these facilities and their use in research. Seven centrifuges, each with its own unique abilities, allow testing of a variety of parameters on test subjects ranging from single cells through hardware to humans. The Vestibular Research Facility allows the study of both centrifugation and linear acceleration on animals and humans. The Biocomputation Center uses computers for 3D reconstruction of physiological systems, and interactive research tools for virtual reality modeling. Psycophysiological, cardiovascular, exercise physiology, and biomechanical studies are conducted in the 12 bed Human Research Facility and samples are analyzed in the certified Central Clinical Laboratory and other laboratories at Ames. Human bedrest, water immersion and lower body negative pressure equipment are also available to study physiological changes associated with weightlessness. These and other weightlessness models are used in specialized laboratories for the study of basic physiological mechanisms, metabolism and cell biology. Visual-motor performance, perception, and adaptation are studied using ground-based models as well as short term weightlessness experiments (parabolic flights). The unique combination of Life Science research facilities, laboratories, and equipment at Ames Research Center are described in detail in relation to their research contributions.

  1. The AMES network strategy developments within and outside the EU

    Sevini, F.; Debarberis, L.; Davies, L.M.; English, C.

    2001-01-01

    The AMES (Ageing Materials Evaluation and Studies) network started its activity in 1993 with the aim of studying the consequences and the mechanisms of the ageing process in materials used for nuclear reactor components. Together with ENIQ, NESC, EPERC, it forms the so-called ''Structural Integrity of Industrial Components'' cluster of networks operated by the Joint Research Centre - Institute for Advanced Materials of the European Commission. After two initial phases dedicated to the compilation of state-of-the-art reports on non-destructive monitoring techniques for thermal ageing, dosimetry, survey of regulatory requirements, predictive formulas for irradiation embrittlement, AMES has entered its third strategy phase with the fifth EURATOM Framework Program, Nuclear Fission Safety Key Action. Most of the projects proposed for this program and sustained by the Steering committee were selected for funding. Their focus is on the influence of chemical composition, namely phosphorus and nickel content, on the irradiation embrittlement of reactor pressure vessel materials, on the improvement of surveillance temperature measurement, on the validation of the Master Curve approach, and on ND techniques to monitor ageing of irradiated steels. The paper describes the objectives of the new fifth Framework Program projects and how they are part of the AMES strategy, pointing out the involvement of CEEC and NIS countries. (authors)

  2. Ames Laboratory Site Environmental Report, Calendar year 1992

    1992-01-01

    The summarized data and conclusions from the Ames Laboratory environmental monitoring program are presented in this Annual Site Environmental Report. Pollution awareness and waste minimization programs and plans implemented in 1990 are continuing to date. Ames Laboratory (AL) is responsible for a small chemical burial site, located on ISU property. The site was used for the disposal of chemical and metal slags from thorium and uranium production. Samples of water from existing test wells, and upstream and downstream sites on the nearby Squaw Creek, have not detected migration of the buried materials off site. Surface, hand auger and deep boring soil samples have been collected from the site. The analytical results are pending, Six new monitoring wells have been installed and sampled. Analytical results are pending. Ames Laboratory is responsible for an area contaminated by diesel fuel that leaked from an underground storage tank (UST) in 1970. The tank was removed that year. Soil borings and groundwater have been analyzed for contamination and a preliminary assessment written. Nine small inactive waste sites have been identified for characterization. The NEPA review for this work resulted in a CX determination. The work plans were approved by AL and CH. A subcontractor has surveyed and sampled the sites. Analytical results are pending

  3. Spatial delayed nonmatching-to-sample performances in long-living Ames dwarf mice.

    Derenne, Adam; Brown-Borg, Holly M; Martner, Sarah; Wolff, Wendy; Frerking, Morgan

    2014-01-17

    Ames dwarf mice have an extended lifespan by comparison with normal mice. Behavioral testing has revealed that sometimes Ames dwarf mice also evince superior performances relative to normal mice, but in other cases they do not. In this experiment, Ames dwarf and normal mice were compared on a T-maze test and on a delayed nonmatching-to-sample variant of a T-maze test. On the simple T-maze, Ames dwarf and normal mice committed comparable numbers of errors. On the nonmatching-to-sample task, normal mice mastered the discrimination by the end of the experiment while Ames dwarf mice did not. The apparatus, distances traveled and session duration were equivalent between the two tasks. The poorer performances of Ames dwarf mice on the nonmatching-to-sample task suggests that Ames dwarf mice may not be as capable of learning relatively cognitively complex tasks as normal mice. © 2013.

  4. Groundwater hydrology study of the Ames Chemical Disposal Site

    Stickel, T.

    1996-01-01

    The Ames Laboratory Chemical Disposal Site is located in northwestern Ames, Iowa west of Squaw Creek. From 1957 to 1966, Ames Laboratory conducted research to develop processes to separate uranium and thorium from nuclear power fuel and to separate yttrium from neutron shielding sources. The wastes from these processes, which contained both hazardous and radiological components, were placed into nine burial pits. Metal drums, plywood boxes, and steel pails were used to store the wastes. Uranium was also burned on the ground surface of the site. Monitoring wells were placed around the waste burial pits. Groundwater testing in 1993 revealed elevated levels of Uranium 234, Uranium 238, beta and alpha radiation. The north side of the burial pit had elevated levels of volatile organic compounds. Samples in the East Ravine showed no volatile organics; however, they did contain elevated levels of radionuclides. These analytical results seem to indicate that the groundwater from the burial pit is flowing down hill and causing contamination in the East Ravine. Although there are many avenues for the contamination to spread, the focus of this project is to understand the hydrogeology of the East Ravine and to determine the path of groundwater flow down the East Ravine. The groundwater flow data along with other existing information will be used to assess the threat of chemical migration down the East Ravine and eventually off-site. The primary objectives of the project were as follows: define the geology of the East Ravine; conduct slug tests to determine the hydraulic conductivity of both oxidized and unoxidized till; develop a three-dimensional mathematical model using ModIME and MODFLOW to simulate groundwater flow in the East Ravine

  5. Voluntary cleanup of the Ames chemical disposal site

    Taboas, A.L.; Freeman, R.; Peterson, J.

    2003-01-01

    The U.S. Department of Energy completed a voluntary removal action at the Ames chemical disposal site, a site associated with the early days of the Manhattan Project. It contained chemical and low-level radioactive wastes from development of the technology to extract uranium from uranium oxide. The process included the preparation of a Remedial Investigation, Feasibility Study, Baseline Risk Assessment, and, ultimately, issuance of a Record of Decision. Various stakeholder groups were involved, including members of the regulatory community, the general public, and the landowner, Iowa State University. The site was restored and returned to the landowner for unrestricted use.

  6. Estimation of γ irradiation induced genetic damage by Ames test

    Hosoda, Eiko

    1999-01-01

    Mutation by 60 Co γ irradiation was studied in five different histidine-requiring auxotrophs of Salmonella typhimurium. The strains TA98 (sensitive to frameshift) and TA100 (sensitive to base-pair substitution) were irradiated (10-84 Gy and 45-317 Gy, respectively) and revertants were counted. TA98 exhibited radiation-induced revertants, 2.8 fold of spontaneous revertants, although no significant increase was detected in TA100. Then, three other frameshift-sensitive strains TA1537, TA1538 and TA94 were irradiated in a dose of 61-167 Gy. Only in TA94, revertants increased 3.5 fold. Since spontaneous revertants are known to be independent of cell density, a decrease of bacterial number by γ irradiation was confirmed not to affect the induced revertants by dilution test. Thus the standard Ames Salmonella assay identified γ irradiation was confirmed not to affect the induced revertants by dilution test. Thus the standard Ames Salmonella assay identified γ irradiation as a mutagenetic agent. The mutagenicity of dinitropyrene, a mutagen widely existing in food, and dismutagenicity of boiling water insoluble fraction of Hizikia fusiforme, edible marine alga, were tested on γ induced revertant formation in TA98 and TA94. Dinitropyrene synergistically increased γ induced revertants and Hizikia insoluble fraction reduced the synergistic effect of dinitropyrene dependently on the concentration. (author)

  7. The AMES network in the 6th Framework Programme

    Sevini, F.; Debarberis, L.; Taylor, N.; Gerard, R.; English, C.; Brumovsky, M.

    2003-01-01

    The AMES (Ageing Materials European Strategy) European network started its activity in 1993 with the aim of studying ageing mechanisms and remedial procedures for structural materials used for nuclear reactor components. Operated by JRC-IE, it has been supporting the co-ordination of the project cluster throughout the 4th and 5th EURATOM Framework Programs, carrying out projects on with plant life management implications. Among them we can list the development of non-destructive techniques applied to thermal ageing and neutron embrittlement monitoring (AMES-NDT and GRETE), improved surveillance for VVER 440 reactors (COBRA), dosimetry (AMESDOSIMETRY, MADAM and REDOS), chemical composition effects on neutron embrittlement (PISA) and advanced fracture mechanics for integrity assessment (FRAME). Main frame of the network in the 5th Framework Programme is the ATHENA project, which is aimed at summarizing the obtained achievements and edit guidelines on important issues like the Master Curve, Effect of chemical composition on embrittlement rate in RPV steels, Re-embrittlement models validation after VVER-440 annealing and open issues in embrittlement of VVER type reactors. In the 6th EURATOM Framework Programme started in 2003 the network will be part of a broader initiative on PLIM including in a more integrated way NESC, ENIQ, NET and AMALIA networks. This paper shows an overview of the concluded projects, achievements of the running ones and open issues tackled in the 6th EURATOM FWP and a summary of the plans for a new broader network on NPP Plant Life management (SAFELIFE). (author)

  8. Penentuan Titik Lokasi Pelabuhan Penyeberangan Amed Di Kabupaten Karangasem

    I Gusti Ngurah Putra Dirgayusa

    2016-07-01

    Full Text Available Accumulation of social activity, economy and transportation that occur in Southern part of Bali adversely affects at transportation infrastructure carrying activity in this area. These require the government to get the solution of this problem. Through spatial planning area of Bali province 2005, governments establish Amed Bay developed as crossing harbor. These cases mean to divide the shout hem traffic line and support the development in northern part of Bali. The object of this research is in Purwakerti village, district of Abang, Karangasem regency. Research held based on technical and legality review. In advance analyze of those aspects that established some alterative potential location based on area requirement and mapping survey result. Following, each location alternative disassembly and examined their advantages and disadvantages in each aspect. Technical aspect analyze of land and territorial water technique. The approach that used in harbor location selection for this technique is weighting and assessment method in assessment matrix. The weighting value that used refers to harbor location selection in Makian bay. Meanwhile, for legality aspect, analyzed by policy review that relate to spatial area and location selection of harbor development. Based on minimum area demand analyze that 0.7 Ha for land facilities and 15.8 Ha for waters facilities. Refers to minimum area demand and layout spatial survey, four locations are selected for alternative points. After technical and legality aspect analyzed, then obtained second area chosen which located in Amed country, Purwakerti village.

  9. A Perspective on NASA Ames Air Traffic Management Research

    Schroeder, Jeffery A.

    2012-01-01

    This paper describes past and present air-traffic-management research at NASA Ames Research Center. The descriptions emerge from the perspective of a technical manager who supervised the majority of this research for the last four years. Past research contributions built a foundation for calculating accurate flight trajectories to enable efficient airspace management in time. That foundation led to two predominant research activities that continue to this day - one in automatically separating aircraft and the other in optimizing traffic flows. Today s national airspace uses many of the applications resulting from research at Ames. These applications include the nationwide deployment of the Traffic Management Advisor, new procedures enabling continuous descent arrivals, cooperation with industry to permit more direct flights to downstream way-points, a surface management system in use by two cargo carriers, and software to evaluate how well flights conform to national traffic management initiatives. The paper concludes with suggestions for prioritized research in the upcoming years. These priorities include: enabling more first-look operational evaluations, improving conflict detection and resolution for climbing or descending aircraft, and focusing additional attention on the underpinning safety critical items such as a reliable datalink.

  10. NASA Ames Sustainability Initiatives: Aeronautics, Space Exploration, and Sustainable Futures

    Grymes, Rosalind A.

    2015-01-01

    In support of the mission-specific challenges of aeronautics and space exploration, NASA Ames produces a wealth of research and technology advancements with significant relevance to larger issues of planetary sustainability. NASA research on NexGen airspace solutions and its development of autonomous and intelligent technologies will revolutionize both the nation's air transporation systems and have applicability to the low altitude flight economy and to both air and ground transporation, more generally. NASA's understanding of the Earth as a complex of integrated systems contributes to humanity's perception of the sustainability of our home planet. Research at NASA Ames on closed environment life support systems produces directly applicable lessons on energy, water, and resource management in ground-based infrastructure. Moreover, every NASA campus is a 'city'; including an urbanscape and a workplace including scientists, human relations specialists, plumbers, engineers, facility managers, construction trades, transportation managers, software developers, leaders, financial planners, technologists, electricians, students, accountants, and even lawyers. NASA is applying the lessons of our mission-related activities to our urbanscapes and infrastructure, and also anticipates a leadership role in developing future environments for living and working in space.

  11. Brown Adipose Tissue Function Is Enhanced in Long-Lived, Male Ames Dwarf Mice

    McFadden, Samuel; Fang, Yimin; Huber, Joshua A.; Zhang, Chi; Sun, Liou Y.; Bartke, Andrzej

    2016-01-01

    Ames dwarf mice (Prop1df/df) are long-lived due to a loss of function mutation, resulting in deficiency of GH, TSH, and prolactin. Along with a marked extension of longevity, Ames dwarf mice have improved energy metabolism as measured by an increase in their oxygen consumption and heat production, as well as a decrease in their respiratory quotient. Along with alterations in energy metabolism, Ames dwarf mice have a lower core body temperature. Moreover, Ames dwarf mice have functionally altered epididymal white adipose tissue (WAT) that improves, rather than impairs, their insulin sensitivity due to a shift from pro- to anti-inflammatory cytokine secretion. Given the unique phenotype of Ames dwarf epididymal WAT, their improved energy metabolism, and lower core body temperature, we hypothesized that Ames dwarf brown adipose tissue (BAT) may function differently from that of their normal littermates. Here we use histology and RT-PCR to demonstrate that Ames dwarf mice have enhanced BAT function. We also use interscapular BAT removal to demonstrate that BAT is necessary for Ames dwarf energy metabolism and thermogenesis, whereas it is less important for their normal littermates. Furthermore, we show that Ames dwarf mice are able to compensate for loss of interscapular BAT by using their WAT depots as an energy source. These findings demonstrate enhanced BAT function in animals with GH and thyroid hormone deficiencies, chronic reduction of body temperature, and remarkably extended longevity. PMID:27740871

  12. Atmosphere of Freedom: Sixty Years at the NASA Ames Research Center

    Bugos, Glenn E.; Launius, Roger (Technical Monitor)

    2000-01-01

    Throughout Ames History, four themes prevail: a commitment to hiring the best people; cutting-edge research tools; project management that gets things done faster, better and cheaper; and outstanding research efforts that serve the scientific professions and the nation. More than any other NASA Center, Ames remains shaped by its origins in the NACA (National Advisory Committee for Aeronautics). Not that its missions remain the same. Sure, Ames still houses the world's greatest collection of wind tunnels and simulation facilities, its aerodynamicists remain among the best in the world, and pilots and engineers still come for advice on how to build better aircraft. But that is increasingly part of Ames' past. Ames people have embraced two other missions for its future. First, intelligent systems and information science will help NASA use new tools in supercomputing, networking, telepresence and robotics. Second, astrobiology will explore lore the prospects for life on Earth and beyond. Both new missions leverage Ames long-standing expertise in computation and in the life sciences, as well as its relations with the computing and biotechnology firms working in the Silicon Valley community that has sprung up around the Center. Rather than the NACA missions, it is the NACA culture that still permeates Ames. The Ames way of research management privileges the scientists and engineers working in the laboratories. They work in an atmosphere of freedom, laced with the expectation of integrity and responsibility. Ames researchers are free to define their research goals and define how they contribute to the national good. They are expected to keep their fingers on the pulse of their disciplines, to be ambitious yet frugal in organizing their efforts, and to always test their theories in the laboratory or in the field. Ames' leadership ranks, traditionally, are cultivated within this scientific community. Rather than manage and supervise these researchers, Ames leadership merely

  13. Scientific visualization in computational aerodynamics at NASA Ames Research Center

    Bancroft, Gordon V.; Plessel, Todd; Merritt, Fergus; Walatka, Pamela P.; Watson, Val

    1989-01-01

    The visualization methods used in computational fluid dynamics research at the NASA-Ames Numerical Aerodynamic Simulation facility are examined, including postprocessing, tracking, and steering methods. The visualization requirements of the facility's three-dimensional graphical workstation are outlined and the types hardware and software used to meet these requirements are discussed. The main features of the facility's current and next-generation workstations are listed. Emphasis is given to postprocessing techniques, such as dynamic interactive viewing on the workstation and recording and playback on videodisk, tape, and 16-mm film. Postprocessing software packages are described, including a three-dimensional plotter, a surface modeler, a graphical animation system, a flow analysis software toolkit, and a real-time interactive particle-tracer.

  14. Applied Computational Fluid Dynamics at NASA Ames Research Center

    Holst, Terry L.; Kwak, Dochan (Technical Monitor)

    1994-01-01

    The field of Computational Fluid Dynamics (CFD) has advanced to the point where it can now be used for many applications in fluid mechanics research and aerospace vehicle design. A few applications being explored at NASA Ames Research Center will be presented and discussed. The examples presented will range in speed from hypersonic to low speed incompressible flow applications. Most of the results will be from numerical solutions of the Navier-Stokes or Euler equations in three space dimensions for general geometry applications. Computational results will be used to highlight the presentation as appropriate. Advances in computational facilities including those associated with NASA's CAS (Computational Aerosciences) Project of the Federal HPCC (High Performance Computing and Communications) Program will be discussed. Finally, opportunities for future research will be presented and discussed. All material will be taken from non-sensitive, previously-published and widely-disseminated work.

  15. Ames Laboratory site environmental report, Calendar year 1994

    1994-01-01

    The Ames Laboratory conducts fundamental research in the physical, chemical, materials, and mathematical sciences and engineering which underlie energy generating, conversion, transmission and storage technologies, environmental improvement, and other technical areas essential to national needs. These efforts will be maintained so as to contribute to the achievement of the vision of DOE and, more specifically, to increase the general levels of knowledge and technical capabilities, to prepare engineering and physical sciences students for the future, both academia and industry, and to develop new technologies and practical applications from our basic scientific programs that will contribute to a strengthening of the US economy. The Laboratory approaches all its operations with the safety and health of all workers as a constant objective and with genuine concern for the environment. The Laboratory relies upon its strengths in materials synthesis and processing, materials reliability, chemical analysis, chemical sciences, photosynthesis, materials sciences, metallurgy, high-temperature superconductivity, and applied mathematical sciences to conduct the long term basic and intermediate range applied research needed to solve the complex problems encountered in energy production, and utilization as well as environmental restoration and waste management. Ames Laboratory will continue to maintain a very significant and highly beneficial pre-college math and science education program which currently serves both teachers and students at the middle school and high school levels. Our technology transfer program is aided by joint efforts with ISU's technology development and commercialization enterprise and will sustain concerted efforts to implement Cooperative Research and Development Agreements, industrially sponsored Work for Others projects. and scientific personnel exchanges with our various customers

  16. Mutagenicity of Flavonoids Assayed by Bacterial Reverse Mutation (Ames Test

    Eliana Aparecida Varanda

    2012-05-01

    Full Text Available The mutagenicity of ten flavonoids was assayed by the Ames test, in Salmonella typhimurium strains TA98, TA100 and TA102, with the aim of establishing hydroxylation pattern-mutagenicity relationship profiles. The compounds assessed were: quercetin, kaempferol, luteolin, fisetin, chrysin, galangin, flavone, 3-hydroxyflavone, 5-hydroxyflavone and 7-hydroxyflavone. In the Ames assay, quercetin acted directly and its mutagenicity increased with metabolic activation. In the presence of S9 mix, kaempferol and galangin were mutagenic in the TA98 strain and kaempferol showed signs of mutagenicity in the other strains. The absence of hydroxyl groups, as in flavone, only signs of mutagenicity were shown in strain TA102, after metabolization and, among monohydroxylated flavones (3-hydroxyflavone, 5-hydroxyflavone and 7-hydroxyflavone, the presence of hydroxyl groups only resulted in minor changes. Luteolin and fisetin also showed signs of mutagenicity in strain TA102. Finally, chrysin, which has only two hydroxy groups, at the 5-OH and 7-OH positions, also did not induce mutagenic activity in any of the bacterial strains used, under either activation condition. All the flavonoids were tested at concentrations varying from 2.6 to 30.7 nmol/plate for galangin and 12.1 to 225.0 nmol/plate for other flavonoids. In light of the above, it is necessary to clarify the conditions and the mechanisms that mediate the biological effects of flavonoids before treating them as therapeutical agents, since some compounds can be biotransformed into more genotoxic products; as is the case for galangin, kaempferol and quercetin.

  17. Evaluation of Genotoxicity of CSE1034 by Ames and In vitro ...

    NADPH) was obtained from Himedia (Mumbai, India). Ames test. The test was ..... W, Passarge E. Toxicity of antibiotics cultured human skin fibroblast. Humangenetik 1975; 28: 273-267. 15. McCann J, Choi E, Yamasaki E, Ames BN. Detection of.

  18. (New) NASA Administrator Sean O'Keefe comes to Ames for employee briefing and tour. Here he welcomes

    2002-01-01

    (New) NASA Administrator Sean O'Keefe comes to Ames for employee briefing and tour. Here he welcomes JASON kids to NASA while handing out patches and pins. Tom Clausen and Donald James, Ames Education Office in background.

  19. (New) NASA Administrator Sean O'Keefe comes to Ames for employee briefing and tour. Meets with

    2002-01-01

    (New) NASA Administrator Sean O'Keefe comes to Ames for employee briefing and tour. Meets with Roberto Cruz, National Hispanic University (left) at Amesto sign the educational MOU between NHU and Ames.

  20. Sixth Annual NASA Ames Space Science and Astrobiology Jamboree

    Hollingsworth, Jeffery; Howell, Steve; Fonda, Mark; Dateo, Chris; Martinez, Christine M.

    2018-01-01

    Welcome to the Sixth Annual NASA Ames Research Center, Space Science and Astrobiology Jamboree at NASA Ames Research Center (ARC). The Space Science and Astrobiology Division consists of over 60 Civil Servants, with more than 120 Cooperative Agreement Research Scientists, Post-Doctoral Fellows, Science Support Contractors, Visiting Scientists, and many other Research Associates. Within the Division there is engagement in scientific investigations over a breadth of disciplines including Astrobiology, Astrophysics, Exobiology, Exoplanets, Planetary Systems Science, and many more. The Division's personnel support NASA spacecraft missions (current and planned), including SOFIA, K2, MSL, New Horizons, JWST, WFIRST, and others. Our top-notch science research staff is spread amongst three branches in five buildings at ARC. Naturally, it can thus be difficult to remain abreast of what fellow scientific researchers pursue actively, and then what may present and/or offer regarding inter-Branch, intra-Division future collaborative efforts. In organizing this annual jamboree, the goals are to offer a wholesome, one-venue opportunity to sense the active scientific research and spacecraft mission involvement within the Division; and to facilitate communication and collaboration amongst our research scientists. Annually, the Division honors one senior research scientist with a Pollack Lecture, and one early career research scientist with an Outstanding Early Career Space Scientist Lecture. For the Pollack Lecture, the honor is bestowed upon a senior researcher who has made significant contributions within any area of research aligned with space science and/or astrobiology. This year we are pleased to honor Linda Jahnke. With the Early Career Lecture, the honor is bestowed upon an early-career researcher who has substantially demonstrated great promise for significant contributions within space science, astrobiology, and/or, in support of spacecraft missions addressing such

  1. (New) NASA Director Sean O'Keefe comes to Ames for employee briefing and tour. Meets with Roberto

    2002-01-01

    (New) NASA Director Sean O'Keefe comes to Ames for employee briefing and tour. Meets with Roberto Cruz, National Hispanic University (seated, right) and Ames Center Director Dr. Henry McDonald follow the signing of the educational MOU between NHU and Ames.

  2. NASA Ames Research Center 60 MW Power Supply Modernization

    Choy, Yuen Ching; Ilinets, Boris V.; Miller, Ted; Nagel, Kirsten (Technical Monitor)

    2001-01-01

    The NASA Ames Research Center 60 MW DC Power Supply was built in 1974 to provide controlled DC power for the Thermophysics Facility Arc Jet Laboratory. The Power Supply has gradually losing reliability due to outdated technology and component life limitation. NASA has decided to upgrade the existing rectifier modules with contemporary high-power electronics and control equipment. NASA plans to complete this project in 2001. This project includes a complete replacement of obsolete thyristor stacks in all six rectifier modules and rectifier bridge control system. High power water-cooled thyristors and freewheeling diodes will be used. The rating of each of the six modules will be 4000 A at 5500 V. The control firing angle signal will be sent from the Facility Control System to six modules via fiberoptic cable. The Power Supply control and monitoring system will include a Master PLC in the Facility building and a Slave PLC in each rectifier module. This system will also monitor each thyristor level in each stack and the auxiliary equipment.

  3. Ethnography in qualitative educational research: AMEE Guide No. 80.

    Reeves, Scott; Peller, Jennifer; Goldman, Joanne; Kitto, Simon

    2013-08-01

    Ethnography is a type of qualitative research that gathers observations, interviews and documentary data to produce detailed and comprehensive accounts of different social phenomena. The use of ethnographic research in medical education has produced a number of insightful accounts into its role, functions and difficulties in the preparation of medical students for clinical practice. This AMEE Guide offers an introduction to ethnography - its history, its differing forms, its role in medical education and its practical application. Specifically, the Guide initially outlines the main characteristics of ethnography: describing its origins, outlining its varying forms and discussing its use of theory. It also explores the role, contribution and limitations of ethnographic work undertaken in a medical education context. In addition, the Guide goes on to offer a range of ideas, methods, tools and techniques needed to undertake an ethnographic study. In doing so it discusses its conceptual, methodological, ethical and practice challenges (e.g. demands of recording the complexity of social action, the unpredictability of data collection activities). Finally, the Guide provides a series of final thoughts and ideas for future engagement with ethnography in medical education. This Guide is aimed for those interested in understanding ethnography to develop their evaluative skills when reading such work. It is also aimed at those interested in considering the use of ethnographic methods in their own research work.

  4. Mobile technologies in medical education: AMEE Guide No. 105.

    Masters, Ken; Ellaway, Rachel H; Topps, David; Archibald, Douglas; Hogue, Rebecca J

    2016-06-01

    Mobile technologies (including handheld and wearable devices) have the potential to enhance learning activities from basic medical undergraduate education through residency and beyond. In order to use these technologies successfully, medical educators need to be aware of the underpinning socio-theoretical concepts that influence their usage, the pre-clinical and clinical educational environment in which the educational activities occur, and the practical possibilities and limitations of their usage. This Guide builds upon the previous AMEE Guide to e-Learning in medical education by providing medical teachers with conceptual frameworks and practical examples of using mobile technologies in medical education. The goal is to help medical teachers to use these concepts and technologies at all levels of medical education to improve the education of medical and healthcare personnel, and ultimately contribute to improved patient healthcare. This Guide begins by reviewing some of the technological changes that have occurred in recent years, and then examines the theoretical basis (both social and educational) for understanding mobile technology usage. From there, the Guide progresses through a hierarchy of institutional, teacher and learner needs, identifying issues, problems and solutions for the effective use of mobile technology in medical education. This Guide ends with a brief look to the future.

  5. Making Stuff Outreach at the Ames Laboratory and Iowa State University

    Ament, Katherine; Karsjen, Steven; Leshem-Ackerman, Adah; King, Alexander

    2011-04-01

    The U. S. Department of Energy's Ames Laboratory in Ames, Iowa was a coalition partner for outreach activities connected with NOVA's Making Stuff television series on PBS. Volunteers affiliated with the Ames Laboratory and Iowa State University, with backgrounds in materials science, took part in activities including a science-themed Family Night at a local mall, Science Cafes at the Science Center of Iowa, teacher workshops, demonstrations at science nights in elementary and middle schools, and various other events. We describe a selection of the activities and present a summary of their outcomes and extent of their impact on Ames, Des Moines and the surrounding communities in Iowa. In Part 2, results of a volunteer attitude survey are presented, which shed some light on the volunteer experience and show how the volunteers participation in outreach activities has affected their views of materials education.

  6. Acquisition of steady-state operant behavior in long-living Ames Dwarf mice.

    Derenne, Adam; Brown-Borg, Holly; Feltman, Kathryn; Corbett, Grant; Lackman, Serena

    2011-10-24

    Ames dwarf mice have a Prop-1 mutation that has been identified with increased levels of IGF-I in the central nervous system, upregulation of neuroprotective systems, and increased lifespan. To elucidate the behavioral effects of the Prop-1 mutation, 8 Ames dwarf and 7 normal mice (all of whom were 8 months of age or younger) were compared on a differential-reinforcement-of-low-rate-of-responding schedule of reinforcement and a matching-to-sample task. On both tasks, nosepokes were reinforced with access to a saccharin solution. Comparisons were based on several measures of behavioral efficiency: pause durations, intertrial intervals, and numbers of responses. Ames dwarf mice were generally less efficient than normal mice. One possible cause of this outcome is that relatively young Ames dwarf mice show less cognitive development than age-matched normal mice. Copyright © 2011 Elsevier Inc. All rights reserved.

  7. Analysis of Hexanitrostilbene (HNS) and Dipicryethane (DPE) for Mutagenicity by the Ames/Salmonella Assay

    Wu, R; Felton, J

    2007-10-12

    The Ames/Salmonella assay, developed by Professor Bruce Ames at the University of California, Berkeley, is a rapid and sensitive assay for detecting mutagenicity of various chemical compounds (Maron and Ames, 1983). It is a widely accepted short-term assay for detecting chemicals that induce mutations in the histidine (his) gene of Salmonella typhimurium. This is a reverse mutation assay that detects the mutational reversion of his-dependent Salmonella to the his-independent counterpart. Thereby, mutagenic compounds will increase the frequency of occurrence of his-independent bacterial colonies. The assay utilizes the specific genetically constructed strains of bacteria either with or without mammalian metabolic activation enzymes (S9), Aroclor induced rat liver homogenate to assess the mutagenicity of different compounds. In this study, we will use the Ames/Salmonella assay to investigate the mutagenicity of Hexanitrostilbene (HNS) from both Bofors and Pantex, and Dipicryethane (DPE).

  8. 3rd Annual NASA Ames Space Science and Astrobiology Jamboree

    Dotson, Jessie

    2015-01-01

    The Space Science and Astrobiology Division at NASA Ames Research Center consists of over 50 civil servants and more than 110 contractors, co-­-ops, post-­-docs and associates. Researchers in the division are pursuing investigations in a variety of fields including exoplanets, planetary science, astrobiology and astrophysics. In addition, division personnel support a wide variety of NASA missions including (but not limited to) Kepler, SOFIA, LADEE, JWST, and New Horizons. With such a wide variety of interesting research going on, distributed among three branches in at least 5 different buildings, it can be difficult to stay abreast of what one's fellow researchers are doing. Our goal in organizing this symposium is to facilitate communication and collaboration among the scientists within the division, and to give center management and other ARC researchers and engineers an opportunity to see what scientific research and science mission work is being done in the division. We are also continuing the tradition within the Space Science and Astrobiology Division to honor one senior and one early career scientist with the Pollack Lecture and the Early Career Lecture, respectively. With the Pollack Lecture, our intent is to select a senior researcher who has made significant contributions to any area of research within the space sciences, and we are pleased to honor Dr. William Borucki this year. With the Early Career Lecture, our intent is to select a young researcher within the division who, by their published scientific papers, shows great promise for the future in any area of space science research, and we are pleased to honor Dr. Melinda Kahre this year

  9. Promoting increased Chlorella sorokiniana Shih. et Krauss ...

    Prof. Nweze

    2014-12-31

    Dec 31, 2014 ... Also, the extract obtained from the leaves of Moringa in 80% ethanol contains growth enhancing principles for higher plants. (Makkar and Becker, 1996). In view of the fact that. Chlorella biomass is much sought after for use as health food supplement and for biofuels among other uses, enhanced production ...

  10. The Ame2012 atomic mass evaluation. Pt. 1. Evaluation of input data, adjustment procedures

    Audi, G; Wang, M.; Wapstra, A.H.; Kondev, F.G.; MacCormick, M.; Xu, X.; Pfeiffer, B.

    2012-01-01

    This paper is the first of two articles (Part I and Part II) that presents the results of the new atomic mass evaluation, Ame2012. It includes complete information on the experimental input data (including not used and rejected ones), as well as details on the evaluation procedures used to derive the tables with recommended values given in the second part. This article describes the evaluation philosophy and procedures that were implemented in the selection of specific nuclear reaction, decay and mass-spectrometer results. These input values were entered in the least-squares adjustment procedure for determining the best values for the atomic masses and their uncertainties. Calculation procedures and particularities of the AME are then described. All accepted and rejected data, including outweighed ones, are presented in a tabular format and compared with the adjusted values (obtained using the adjustment procedure). Differences with the previous Ame2003 evaluation are also discussed and specific information is presented for several cases that may be of interest to various AME users. The second Ame2012 article, the last one in this issue, gives a table with recommended values of atomic masses, as well as tables and graphs of derived quantities, along with the list of references used in both this Ame2012 evaluation and the Nubase2012 one (the first paper in this issue). (authors)

  11. Mitochondrial electron transport chain functions in long-lived Ames dwarf mice

    Choksi, Kashyap B.; Nuss, Jonathan E.; DeFord, James H.; Papaconstantinou, John

    2011-01-01

    The age-associated decline in tissue function has been attributed to ROS-mediated oxidative damage due to mitochondrial dysfunction. The long-lived Ames dwarf mouse exhibits resistance to oxidative stress, a physiological characteristic of longevity. It is not known, however, whether there are differences in the electron transport chain (ETC) functions in Ames tissues that are associated with their longevity. In these studies we analyzed enzyme activities of ETC complexes, CI-CV and the coupled CI-CII and CII-CIII activities of mitochondria from several tissues of young, middle aged and old Ames dwarf mice and their corresponding wild type controls to identify potential mitochondrial prolongevity functions. Our studies indicate that post-mitotic heart and skeletal muscle from Ames and wild-type mice show similar changes in ETC complex activities with aging, with the exception of complex IV. Furthermore, the kidney, a slowly proliferating tissue, shows dramatic differences in ETC functions unique to the Ames mice. Our data show that there are tissue specific mitochondrial functions that are characteristic of certain tissues of the long-lived Ames mouse. We propose that this may be a factor in the determination of extended lifespan of dwarf mice. PMID:21934186

  12. Hepatic response to oxidative injury in long-lived Ames dwarf mice.

    Sun, Liou Y; Bokov, Alex F; Richardson, Arlan; Miller, Richard A

    2011-01-01

    Multiple stress resistance pathways were evaluated in the liver of Ames dwarf mice before and after exposure to the oxidative toxin diquat, seeking clues to the exceptional longevity conferred by this mutation. Before diquat treatment, Ames dwarf mice, compared with nonmutant littermate controls, had 2- to 6-fold higher levels of expression of mRNAs for immediate early genes and 2- to 5-fold higher levels of mRNAs for genes dependent on the transcription factor Nrf2. Diquat led to a 2-fold increase in phosphorylation of the stress kinase ERK in control (but not Ames dwarf) mice and to a 50% increase in phosphorylation of the kinase JNK2 in Ames dwarf (but not control) mice. Diquat induction of Nrf2 protein was higher in dwarf mice than in controls. Of 6 Nrf2-responsive genes evaluated, 4 (HMOX, NQO-1, MT-1, and MT-2) remained 2- to 10-fold lower in control than in dwarf liver after diquat, and the other 2 (GCLM and TXNRD) reached levels already seen in dwarf liver at baseline. Thus, livers of Ames dwarf mice differ systematically from controls in multiple stress resistance pathways before and after exposure to diquat, suggesting mechanisms for stress resistance and extended longevity in Ames dwarf mice.

  13. Ames-2016 line lists for 13 isotopologues of CO2: Updates, consistency, and remaining issues

    Huang (黄新川), Xinchuan; Schwenke, David W.; Freedman, Richard S.; Lee, Timothy J.

    2017-12-01

    A new 626-based Ames-2 PES refinement and Ames-2016 line lists for 13 CO2 isotopologues are reported. A consistent σRMS = ±0.02 cm-1 is established for hundreds of isotopologue band origins using the Ames-2 PES. Ames-2016 line lists are computed at 296 K, 1000 K and 4000 K using the Ames-2 PES and the same DMS-N2 dipole surface used previously, with J up to 150, E‧ up to 24,000 cm-1 or 18,000 cm-1 and appropriate intensity cutoffs. The lists are compared to the CDSD-296, CDSD-4000 databases, UCL line lists, and a few recent highly accurate CO2 intensity measurements. Both agreements and discrepancies are discussed. Compared to the old Ames CO2 lists, the Ames-2016 line lists have line position deviations reduced by 50% or more, which consequently leads to more reliable intensities. The line shape parameters in the Ames-2016 line lists are predicted using the newly assigned conventional vibrational polyad quantum numbers for rovibrational levels below 12,000 cm-1 so the quality of the line shape parameters is similar to that of CDSD or HITRAN. This study further proves that a semi-empirically refined PES (Ames-1 and Ames-2) coupled with a high quality ab initio DMS (DMS-N2 and UCL) may generate IR predictions with consistent accuracy and is thus helpful in the analysis of laboratory spectra and simulations of various isotopologues. The Ames-2016 lists based on DMS-N2 have reached the ∼1% intensity prediction accuracy level for the recent 626 30013-00001 and 20013-00001 bands, but further quantification and improvements require sub-percent or sub-half-percent accurate experimental intensities. The inter-isotopologue consistency of the intensity prediction accuracies should have reached better than 1-3% for regular bands not affected by resonances. Since the Effective Dipole Models (EDM) in CDSD and HITRAN have 1-20% or even larger uncertainties, we show that the Ames lists can provide better alternative IR data for many hard-to-determine isotopologue bands

  14. Resolution of contradiction between in silico predictions and Ames test results for four pharmaceutically relevant impurities.

    Gunther, William C; Kenyon, Michelle O; Cheung, Jennifer R; Dugger, Robert W; Dobo, Krista L

    2017-12-01

    The ICH M7 Guideline requires low level control of mutagenic impurities in pharmaceutical products to minimize cancer risk in patients (ICHM7, 2014). Bacterial mutagenicity (Ames) data is generally used to determine mutagenic and possible carcinogenic potential of compounds. Recently, a publication on experiences of using two in silico systems to identify potentially mutagenic impurities highlighted the importance of performing a critical review of published Ames data utilized as part of a mutagenicity assessment of impurities (Greene et al., 2015). Four compounds (2-amino-5-hydroxybenzoic acid, 2-amino-3-chlorobenzoic acid, methyl 2-amino-4-chlorobenzoate and 4-morpholinopyridine) reported mutagenic were identified in a two system in silico assessment and expert review of the structuresas non-mutagenic. Likely reasons for mutagenicity could not be identified and the purity of the compounds tested was proposed. In the current investigation, the purest available sample of the four compounds was tested in an OECD-compliant Ames test. The compounds were all found to be non-mutagenic. Possible reasons for the discrepancy between previously reported and current results are discussed. Additionally, important points to consider when conducting an expert review of available Ames data are provided particularly in cases where reported Ames results are discrepant with a two system in silico assessment. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. The Ame2012 atomic mass evaluation. Pt. 2. Tables, graphs and references

    Wang, M.; Audi, G.; Wapstra, A.H.; Kondev, F.G.; MacCormick, M.; Xu, X.; Pfeiffer, B.

    2012-01-01

    This paper is the second part of the new evaluation of atomic masses, Ame2012. From the results of a least-squares calculation, described in Part I, for all accepted experimental data, we derive here tables and graphs to replace those of Ame2003. The first table lists atomic masses. It is followed by a table of the influences of data on primary nuclides, a table of separation energies and reaction energies, and finally, a series of graphs of separation and decay energies. The last section in this paper lists all references to the input data used in Part I of this Ame2012 and also to the data included in the Nubase2012 evaluation (first paper in this issue). (authors)

  16. Corrective Action Plan in response to the March 1992 Tiger Team Assessment of the Ames Laboratory

    1992-01-01

    On March 5, 1992, a Department of Energy (DOE) Tiger Team completed an assessment of the Ames Laboratory, located in Ames, Iowa. The purpose of the assessment was to provide the Secretary of Energy with a report on the status and performance of Environment, Safety and Health (ES ampersand H) programs at Ames Laboratory. Detailed findings of the assessment are presented in the report, DOE/EH-0237, Tiger Team Assessment of the Ames Laboratory. This document, the Ames Laboratory Corrective Action Plan (ALCAP), presents corrective actions to overcome deficiencies cited in the Tiger Team Assessment. The Tiger Team identified 53 Environmental findings, from which the Team derived four key findings. In the Safety and Health (S ampersand H) area, 126 concerns were identified, eight of which were designated Category 11 (there were no Category I concerns). Seven key concerns were derived from the 126 concerns. The Management Subteam developed 19 findings which have been summarized in four key findings. The eight S ampersand H Category 11 concerns identified in the Tiger Team Assessment were given prompt management attention. Actions to address these deficiencies have been described in individual corrective action plans, which were submitted to DOE Headquarters on March 20, 1992. The ALCAP includes actions described in this early response, as well as a long term strategy and framework for correcting all remaining deficiencies. Accordingly, the ALCAP presents the organizational structure, management systems, and specific responses that are being developed to implement corrective actions and to resolve root causes identified in the Tiger Team Assessment. The Chicago Field Office (CH), IowaState University (ISU), the Institute for Physical Research and Technology (IPRT), and Ames Laboratory prepared the ALCAP with input from the DOE Headquarters, Office of Energy Research (ER)

  17. Identification of Radiation Effects on Carcinogenic Food Estimated by Ames Test

    Afifi, M.; Eid, I.; El - Nagdy, M.; Zaher, R.; Abd El-Karem, H.; Abd EL Karim, A.

    2016-01-01

    A major concern in studies related to carcinogenesis is the exposure to the exogenous carcinogens that may occur in food in both natural and polluted human environments. The purpose of the present study is to examine some of food products by Ames test to find out if food products carcinogenic then expose food to gamma radiation to find out the effect of radiation on it as a treatment. In this study, the food samples were examined by Ames test (Salmonella typhimurium mutagenicity test) to find out that a food product could be carcinogenic or highly mutated. Testing of chemicals for mutagenicity is based on the knowledge that a substance which is mutagenic in the bacterium is more likely than not to be a carcinogen in laboratory animals, and thus , by extension, present a risk of cancer to humans. After that food products that showed mutagenicity exposed to gamma radiation at different doses to examine the effect of gamma radiation on food products. This study represent γ radiation effect on carcinogenic food by using Ames test in the following steps: Detect food by Ames test using Salmonella typhimurium strains in which the colony count /plate for each food sample will show if food is slightly mutated or highly mutated or carcinogenic. If food is highly mutated or carcinogenic with high number of colonies /plate, then the carcinogenic food or highly mutated food exposed to different doses of radiation The applied doses in this study were 0, 2.5, 5, and 10 (KGy). Detect the radiation effect on food samples by Ames test after irradiation. The study shows that mutated and carcinogenic food products estimated by Ames test could be treated by irradiation

  18. A Survey of Knowledge Management Research & Development at NASA Ames Research Center

    Keller, Richard M.; Clancy, Daniel (Technical Monitor)

    2002-01-01

    This chapter catalogs knowledge management research and development activities at NASA Ames Research Center as of April 2002. A general categorization scheme for knowledge management systems is first introduced. This categorization scheme divides knowledge management capabilities into five broad categories: knowledge capture, knowledge preservation, knowledge augmentation, knowledge dissemination, and knowledge infrastructure. Each of nearly 30 knowledge management systems developed at Ames is then classified according to this system. Finally, a capsule description of each system is presented along with information on deployment status, funding sources, contact information, and both published and internet-based references.

  19. Mixing alcohol with energy drink (AMED) and total alcohol consumption : a systematic review and meta-analysis

    Verster, Joris C|info:eu-repo/dai/nl/241442702; Benson, Sarah; Johnson, Sean J; Scholey, Andrew; Alford, Chris

    It has been suggested that consuming alcohol mixed with energy drink (AMED) may increase total alcohol consumption. Aims of this systematic review and meta-analysis were (i) to compare alcohol consumption of AMED consumers with alcohol only (AO) consumers (between-group comparisons), and (ii) to

  20. Ames collaborative study of cosmic-ray neutrons. II. Low- and mid-latitude flights

    Stephens, L.D.; McCaslin, J.B.; Smith, A.R.; Thomas, R.H.; Hewitt, J.E.; Hughes, L.

    1978-01-01

    The continuing progress of the Ames Collaborative Study of Cosmic Ray Neutrons is described. Data obtained aboard flights from Hawaii at altitudes of 41,000 and 45,000 feet, and in the range of geomagnetic latitude 17 0 N less than or equal to lambda less than or equal to 21 0 N are reported. Preliminary estimates of neutron spectra were made

  1. Assaying the Mutagenic Potential of ELF Radiation through Reverse Mutagenesis via the Ames Test

    Moga, Paul

    1996-01-01

    ...) on certain strains of Salmonella typhimurium. The strain of S-typhimurium used in the Ames test has a mutation on one gene of the histidine operon which prevents it from growing and replicating without the presence of histidine in the media...

  2. Ames hypopituitary dwarf mice demonstrate imbalanced myelopoiesis between bone marrow and spleen.

    Capitano, Maegan L; Chitteti, Brahmananda R; Cooper, Scott; Srour, Edward F; Bartke, Andrzej; Broxmeyer, Hal E

    2015-06-01

    Ames hypopituitary dwarf mice are deficient in growth hormone, thyroid-stimulating hormone, and prolactin. The phenotype of these mice demonstrates irregularities in the immune system with skewing of the normal cytokine milieu towards a more anti-inflammatory environment. However, the hematopoietic stem and progenitor cell composition of the bone marrow (BM) and spleen in Ames dwarf mice has not been well characterized. We found that there was a significant decrease in overall cell count when comparing the BM and spleen of 4-5 month old dwarf mice to their littermate controls. Upon adjusting counts to differences in body weight between the dwarf and control mice, the number of granulocyte-macrophage progenitors, confirmed by immunophenotyping and colony-formation assay was increased in the BM. In contrast, the numbers of all myeloid progenitor populations in the spleen were greatly reduced, as confirmed by colony-formation assays. This suggests that there is a shift of myelopoiesis from the spleen to the BM of Ames dwarf mice; however, this shift does not appear to involve erythropoiesis. The reasons for this unusual shift in spleen to marrow hematopoiesis in Ames dwarf mice are yet to be determined but may relate to the decreased hormone levels in these mice. Copyright © 2015. Published by Elsevier Inc.

  3. The AME2003 atomic mass evaluation (I). Evaluation of input data, adjustment procedures

    Wapstra, A.H.; Audi, G.; Thibault, C.

    2003-01-01

    This paper is the first of two parts presenting the result of a new evaluation of atomic masses (AME2003). In this first part we give full information on the used and rejected input data and on the procedures used in deriving the tables in the second part. We first describe the philosophy and procedures used in selecting nuclear-reaction, decay, and mass spectrometric results as input values in a least-squares evaluation of best values for atomic masses. The calculation procedures and particularities of the AME are then described. All accepted data, and rejected ones with a reported precision still of interest, are presented in a table and compared there with the adjusted values. The differences with the earlier evaluation are briefly discussed and information is given of interest for the users of this AME. The second paper for the AME2003, last in this issue, gives a table of atomic masses, tables and graphs of derived quantities, and the list of references used in both this evaluation and the NUBASE2003 table (first paper in this issue). AMDC: http://csnwww.in2p3.fr/AMDC/

  4. Mutagenic and antimutagenic activities of bioflavonoids and structural analogues in the Ames/Salmonella test

    Mohn GR; Van der Stel JJ; Stavenuiter JFC; Hamzink MRJ; Kreijl CF; LEO; LBO

    1996-01-01

    The mutagenic and antimutagenic properties of bioflavonoids were determined in the bacterial mutagenicity test of Ames, using Salmonella typhimurium strains TA98 and TA100. The decreasing order of mutagenic activity found in both strains was quercetin>myricetin-kaempferol>morin hydrate. The

  5. The NASA Ames Polycyclic Aromatic Hydrocarbon Infrared Spectroscopic Database : The Computed Spectra

    Bauschlicher, C. W.; Boersma, C.; Ricca, A.; Mattioda, A. L.; Cami, J.; Peeters, E.; de Armas, F. Sanchez; Saborido, G. Puerta; Hudgins, D. M.; Allamandola, L. J.

    The astronomical emission features, formerly known as the unidentified infrared bands, are now commonly ascribed to polycyclic aromatic hydrocarbons (PAHs). The laboratory experiments and computational modeling done at the NASA Ames Research Center to create a collection of PAH IR spectra relevant

  6. Exploration of a steamship wreck off Amee shoals, Goa, India: A preliminary report

    Tripati, S.; Gaur, A; Sundaresh

    Recent explorations off Amee shoals, Goa, have brought to light the remains of a steel-hulled steam-engine shipwreck, scattered over a large area. Though sparse and heavily salvaged, this site represents the first discovery of a steamship wreck...

  7. Mutagenicity of anthraquinone and hydroxylated anthraquinones in the Ames/Salmonella microsome system.

    Liberman, D F; Fink, R C; Schaefer, F L; Mulcahy, R J; Stark, A A

    1982-01-01

    The mutagenicity of anthracene, anthraquinone, and four structurally similar compounds of each was evaluated in the Ames/Salmonella microsome assay. Anthraquinone was shown to be mutagenic for strains TA1537, TA1538, and TA98 in the absence of rat liver homogenate. The four anthraquinone derivatives tested were mutagenic for TA1537 exclusively. None of the anthracenes exhibited mutagenic activity. PMID:7103489

  8. Mutagenicity of anthraquinone and hydroxylated anthraquinones in the Ames/Salmonella microsome system.

    Liberman, D F; Fink, R C; Schaefer, F L; Mulcahy, R J; Stark, A A

    1982-01-01

    The mutagenicity of anthracene, anthraquinone, and four structurally similar compounds of each was evaluated in the Ames/Salmonella microsome assay. Anthraquinone was shown to be mutagenic for strains TA1537, TA1538, and TA98 in the absence of rat liver homogenate. The four anthraquinone derivatives tested were mutagenic for TA1537 exclusively. None of the anthracenes exhibited mutagenic activity.

  9. LYRA and other projects on RPV steel embrittlement study and mitigation of the AMES network

    Debarberis, L.; Estorff, U. von; Crutzen, S.; Beers, M.; Stamm, H.; Vries, M.I. de; Tjoa, G.L.

    1998-01-01

    Within the framework of the European Network AMES, Ageing Materials evaluation and Studies, a number of experimental works on RPV materials embrittlement are carried out at the Institute of Advanced Materials (AIM) of the Joint Research Centre (JRC) of the European Commission (EC). The objectives of AMES are mainly the understanding of the property degradation phenomena of RPV western reference steels like JRQ and HSST, eastern RPV steels like 15X2mFA and 15H2X15, and annealing possibilities. In order to conduct a very high quality irradiation rig, LYRA facility, has been designed and developed at the High Flux Reactor (HFR) Petten. An other dedicated rig, named LIMA, has been developed at the HFR Petten in order to irradiate RPV steels, internals and in-core materials under typical BWR/PWR conditions. The samples can be irradiated in pressurised water up to 160 bar, 320 deg. C, and the water chemistry fully controlled. For irradiation of standard or miniaturised LWR related materials samples, another group of well experienced irradiation devices with inert gas or liquid metals environment are employed. These devices are tailored to their various specific applications. This paper is intended to give information about the structure and the objectives of the existing European network AMES, and to present the various AMES main and spin-off projects, including a brief description on he modelling activities related to RPV materials embrittlement. (author)

  10. Cultivating a Grassroots Aerospace Innovation Culture at NASA Ames Research Center

    D'Souza, Sarah; Sanchez, Hugo; Lewis, Ryan

    2017-01-01

    This paper details the adaptation of specific 'knowledge production' methods to implement a first of its kind, grassroots event that provokes a cultural change in how the NASA Ames civil servant community engages in the creation and selection of innovative ideas. Historically, selection of innovative proposals at NASA Ames Research Center is done at the highest levels of management, isolating the views and perspectives of the larger civil servant community. Additionally, NASA innovation programs are typically open to technical organizations and do not engage non-technical organizations to bring forward innovative processes/business practices. Finally, collaboration on innovative ideas and associated solutions tend to be isolated to organizational silos. In this environment, not all Ames employees feel empowered to innovate and opportunities for employee collaboration are limited. In order to address these issues, the 'innovation contest' method was adapted to create the NASA Ames Innovation Fair, a unique, grassroots innovation opportunity for the civil servant community. The Innovation Fair consisted of a physical event with a virtual component. The physical event provided innovators the opportunity to collaborate and pitch their innovations to the NASA Ames community. The civil servant community then voted for the projects that they viewed as innovative and would contribute to NASA's core mission, making this event a truly grassroots effort. The Innovation Fair website provided a location for additional knowledge sharing, discussion, and voting. On March 3rd, 2016, the 'First Annual NASA Ames Innovation Fair' was held with 49 innovators and more than 300 participants collaborating and/or voting for the best innovations. Based on the voting results, seven projects were awarded seed funding for projects ranging from innovative cost models to innovations in aerospace technology. Surveys of both innovators and Fair participants show the Innovation Fair was successful

  11. Expression of oxidative phosphorylation components in mitochondria of long-living Ames dwarf mice.

    Brown-Borg, Holly M; Johnson, W Thomas; Rakoczy, Sharlene G

    2012-02-01

    Reduced signaling of the growth hormone (GH)/insulin-like growth factor-1 (IGF-1) pathway is associated with extended life span in several species. Ames dwarf mice are GH-deficient and live >50% longer than wild-type littermates. Previously, we have shown that tissues from Ames mice exhibit elevated levels of antioxidative enzymes, less H(2)O(2) production, and lower oxidative damage suggesting that mitochondrial function may differ between genotypes. To explore the relationship between hormone deficiency and mitochondria in mice with extended longevity, we evaluated activity, protein, and gene expression of oxidative phosphorylation components in dwarf and wild-type mice at varying ages. Liver complex I + III activity was higher in dwarf mice compared to wild-type mice. The activity of I + III decreased between 3 and 20 months of age in both genotypes with greater declines in wild-type mice in liver and skeletal muscle. Complex IV activities in the kidney were elevated in 3- and 20-month-old dwarf mice relative to wild-type mice. In Ames mice, protein levels of the 39 kDa complex I subunit were elevated at 20 months of age when compared to wild-type mouse mitochondria for every tissue examined. Kidney and liver mitochondria from 20-month-old dwarf mice had elevated levels of both mitochondrially-encoded and nuclear-encoded complex IV proteins compared to wild-type mice (p dwarf mice. Overall, we found that several components of the oxidative phosphorylation (OXPHOS) system were elevated in Ames mice. Mitochondrial to nuclear DNA ratios were not different between genotypes despite the marked increase in PGC-1α levels in dwarf mice. The increased OXPHOS activities, along with lower ROS production in dwarf mice, predict enhanced mitochondrial function and efficiency, two factors likely contributing to long-life in Ames mice.

  12. Endothelial function and vascular oxidative stress in long-lived GH/IGF-deficient Ames dwarf mice.

    Csiszar, Anna; Labinskyy, Nazar; Perez, Viviana; Recchia, Fabio A; Podlutsky, Andrej; Mukhopadhyay, Partha; Losonczy, Gyorgy; Pacher, Pal; Austad, Steven N; Bartke, Andrzej; Ungvari, Zoltan

    2008-11-01

    Hypopituitary Ames dwarf mice have low circulating growth hormone (GH)/IGF-I levels, and they have extended longevity and exhibit many symptoms of delayed aging. To elucidate the vascular consequences of Ames dwarfism we compared endothelial O2(-) and H2O2 production, mitochondrial reactive oxygen species (ROS) generation, expression of antioxidant enzymes, and nitric oxide (NO) production in aortas of Ames dwarf and wild-type control mice. In Ames dwarf aortas endothelial O2(-) and H2O2 production and ROS generation by mitochondria were enhanced compared with those in vessels of wild-type mice. In Ames dwarf aortas there was a less abundant expression of Mn-SOD, Cu,Zn-SOD, glutathione peroxidase (GPx)-1, and endothelial nitric oxide synthase (eNOS). NO production and acetylcholine-induced relaxation were also decreased in aortas of Ames dwarf mice. In cultured wild-type mouse aortas and in human coronary arterial endothelial cells treatment with GH and IGF significantly reduced cellular O2(-) and H2O2 production and ROS generation by mitochondria and upregulated expression of Mn-SOD, Cu,Zn-SOD, GPx-1, and eNOS. Thus GH and IGF-I promote antioxidant phenotypic changes in the endothelial cells, whereas Ames dwarfism leads to vascular oxidative stress.

  13. A non-randomized [corrected] controlled trial of the active music engagement (AME) intervention on children with cancer.

    Robb, Sheri L; Clair, Alicia A; Watanabe, Masayo; Monahan, Patrick O; Azzouz, Faouzi; Stouffer, Janice W; Ebberts, Allison; Darsie, Emily; Whitmer, Courtney; Walker, Joey; Nelson, Kirsten; Hanson-Abromeit, Deanna; Lane, Deforia; Hannan, Ann

    2008-07-01

    Coping theorists argue that environmental factors affect how children perceive and respond to stressful events such as cancer. However, few studies have investigated how particular interventions can change coping behaviors. The active music engagement (AME) intervention was designed to counter stressful qualities of the in-patient hospital environment by introducing three forms of environmental support. The purpose of this multi-site randomized controlled trial was to determine the efficacy of the AME intervention on three coping-related behaviors (i.e. positive facial affect, active engagement, and initiation). Eighty-three participants, ages 4-7, were randomly assigned to one of three conditions: AME (n = 27), music listening (ML; n = 28), or audio storybooks (ASB; n = 28). Conditions were videotaped to facilitate behavioral data collection using time-sampling procedures. After adjusting for baseline differences, repeated measure analyses indicated that AME participants had a significantly higher frequency of coping-related behaviors compared with ML or ASB. Positive facial affect and active engagement were significantly higher during AME compared with ML and ASB (p<0.0001). Initiation was significantly higher during AME than ASB (p<0.05). This study supports the use of the AME intervention to encourage coping-related behaviors in hospitalized children aged 4-7 receiving cancer treatment. (c) 2007 John Wiley & Sons, Ltd.

  14. Use of the modified Ames test as an indicator of the carcinogenicity of residual aromatic extracts

    Boogaard, P.; Hedelin, A.; Riley, A.; Rushton, E.; Vaissiere, M.; Minsavage, G.; Rohde, A.; Dalbey, W.

    2013-01-15

    Existing data demonstrate that residual aromatic extracts (RAEs) can be either carcinogenic or non-carcinogenic. CONCAWE had previously concluded that 'Although limited data available indicate that some RAEs are weakly carcinogenic, it is not possible to provide a general recommendation. Classify on a case-by-case basis' (CONCAWE 2005). Therefore CONCAWE's Health/Toxicology Subgroup (H/TSG) has developed a proposal for the use of the modified Ames test as a short-term predictive screening tool for decisions on the classification of RAEs for carcinogenicity. The relationship between RAE chemistry and carcinogenic potential is not as well understood as it is for some other categories of substances, e.g. Other Lubricant Base Oils (OLBO). However, a correlation has been found between the results of the skin carcinogenicity bioassay and the mutagenicity index (MI) obtained from the modified Ames test. Data supporting this correlation are summarised in this report. The H/TSG confirmed that the modified Ames test can be used as a predictive screening tool and that a cut-off value can be established to make a distinction between carcinogenic and non-carcinogenic products. RAEs with a MI > 0.4 demonstrated carcinogenic potential upon dermal application to mouse skin with chronic exposure. RAEs with a MI > 0.4 did not demonstrate a carcinogenic potential. To justify the use of the modified Ames test with RAEs, additional analysis of the repeatability of the test with RAEs was required. With this objective, CONCAWE sponsored a round robin study with different samples of RAEs from member companies, at three different laboratories. The repeatability demonstrated in the round robin study with RAEs support the proposed use of the modified Ames test. As part of the tools available for use by member companies, the H/TSG proposed a standard operating procedure (SOP) (included as an Appendix to this report) on the conduct of the modified Ames test with RAEs. The H

  15. Aerial radiological survey of US Department of Energy sites in Ames, Iowa. Date of survey: May 1977

    1979-07-01

    An aerial radiological survey to measure terrestrial gamma radiation was carried out over five areas totaling 10 km 2 within the town of Ames, Iowa. Gamma ray data were measured over Ames Laboratory, several sections of downtown Ames, and the surrounding area. This was accomplished by flying parallel east-west lines 61 m apart. Processed data indicated that three areas showed increased activity levels of at least twice average background: the reactor, the waste treatment area, and a small area near the airport runway

  16. The AMES Laboratory chemical disposal site removal action: Source removal, processing, and disposal

    Shirley, R.S.

    1996-01-01

    The Ames Laboratory has historically supported the U.S. Department of Energy (USDOE) and its predecessor agencies by providing research into the purification and manufacturing of high purity uranium, thorium, and yttrium metals. Much of this work was accomplished in the late 1950s and early 1960s prior to the legislation of strict rules and regulations covering the disposal of radioactive and chemical wastes. As a result, approximately 800 cubic meters of low-level radioactive wastes, chemical wastes, and contaminated debris were disposed in nine near surface cells located in a 0.75 hectare plot of land owned by Iowa State University in Ames, Iowa. Under a national contract with the U.S. Army Corps of Engineers (USACE), OHM Remediation Services Corp (OHM) was tasked with providing turnkey environmental services to remove, process, package, transport, and coordinate the disposal of the waste materials and contaminated environmental media

  17. The NASA Ames Life Sciences Data Archive: Biobanking for the Final Frontier

    Rask, Jon; Chakravarty, Kaushik; French, Alison J.; Choi, Sungshin; Stewart, Helen J.

    2017-01-01

    The NASA Ames Institutional Scientific Collection involves the Ames Life Sciences Data Archive (ALSDA) and a biospecimen repository, which are responsible for archiving information and non-human biospecimens collected from spaceflight and matching ground control experiments. The ALSDA also manages a biospecimen sharing program, performs curation and long-term storage operations, and facilitates distribution of biospecimens for research purposes via a public website (https:lsda.jsc.nasa.gov). As part of our best practices, a tissue viability testing plan has been developed for the repository, which will assess the quality of samples subjected to long-term storage. We expect that the test results will confirm usability of the samples, enable broader science community interest, and verify operational efficiency of the archives. This work will also support NASA open science initiatives and guides development of NASA directives and policy for curation of biological collections.

  18. Long-lived ames dwarf mice are resistant to chemical stressors.

    Bokov, Alex F; Lindsey, Merry L; Khodr, Christina; Sabia, Marian R; Richardson, Arlan

    2009-08-01

    To probe the connection between longevity and stress resistance, we compared the sensitivity of Ames long-lived dwarf mice and control littermates with paraquat, diquat, and dobutamine. In young adult animals, 95% of male and 39% of female controls died after paraquat administration, but no dwarf animals died. When the experiment was repeated at an older age or a higher dosage of paraquat, dwarf mice still showed greater resistance. Dwarf mice also were more resistant to diquat; 80% of male and 60% of female controls died compared with 40% and 20% of dwarf mice, despite greater sensitivity of dwarf liver to diquat. Dwarf mice were also less sensitive to dobutamine-induced cardiac stress and had lower levels of liver and lung F(2)-isoprostanes. This is the first direct in vivo evidence that long-lived Ames dwarf mice have enhanced resistance to chemical insult, particularly oxidative stressors.

  19. Antimutagenic components in Glycyrrhiza against N-methyl-N-nitrosourea in the Ames assay.

    Inami, Keiko; Mine, Yusuke; Kojo, Yukiko; Tanaka, Satomi; Ishikawa, Satoko; Mochizuki, Masataka

    2017-03-01

    Antimutagenesis against N-nitroso compounds contribute to prevention of human cancer. We have found that Glycyrrhiza aspera ethanolic extract exhibits antimutagenic activity against N-methyl-N-nitrosourea (MNU) using the Ames assay with Salmonella typhimurium TA1535. In the present study, eight purified components from Glycyrrhiza, namely glabridin, glycyrrhetinic acid, glycyrrhizin, licochalcone A, licoricesaponin H2, licoricesaponin G2, liquiritigenin and liquiritin were evaluated for their antimutagenicity against MNU in the Ames assay with S. typhimurium TA1535. Glycyrrhetinic acid, glycyrrhizin, licoricesaponin G2, licoricesaponin H2 and liquiritin did not show the antimutagenicity against MNU in S. typhimurium TA1535. Glabridin, licochalcone A and liquiritigenin reduced revertant colonies derived from MNU in S. typhimurium TA1535 without showing cytotoxic effects, indicating that these compounds possess antimutagenic activity against MNU. The inhibitory activity of glabridin and licochalcone A was more effective than that of liquiritigenin. Thus, Glycyrrhiza contains antimutagenic components against DNA alkylating, direct-acting carcinogens.

  20. The Ames Laboratory Chemical Disposal Site removal action: Source removal, processing, and disposal

    Shirley, R.S.

    1995-01-01

    The Ames Laboratory has historically supported the US Department of Energy (USDOE) and its predecessor agencies by providing research into the purification and manufacturing of high purity uranium, thorium, and yttrium metals. Much of this work was accomplished in the late 1950s and early 1960s prior to the legislation of strict rules and regulations covering the disposal of radioactive and chemical wastes. As a result, approximately 800 cubic meters of low-level radioactive wastes, mixed wastes, and contaminated debris were disposed in nine near surface cells located in a 0.75 hectare plot of land owned by Iowa State University in Ames, Iowa. Under a national contract with the US Army Corps of Engineers (USACE), OHM Remediation Services Corp. (OHM) was tasked with providing turnkey environmental services to remove, process, package, transport, and coordinate the disposal of the waste materials and contaminated environmental media

  1. Shock Tube and Ballistic Range Facilities at NASA Ames Research Center

    Grinstead, Jay H.; Wilder, Michael C.; Reda, Daniel C.; Cornelison, Charles J.; Cruden, Brett A.; Bogdanoff, David W.

    2010-01-01

    The Electric Arc Shock Tube (EAST) facility and the Hypervelocity Free Flight Aerodynamic Facility (HFFAF) at NASA Ames Research Center are described. These facilities have been in operation since the 1960s and have supported many NASA missions and technology development initiatives. The facilities have world-unique capabilities that enable experimental studies of real-gas aerothermal, gas dynamic, and kinetic phenomena of atmospheric entry.

  2. Early management of sepsis with emphasis on early goal directed therapy: AME evidence series 002

    Zhang, Zhongheng; Hong, Yucai; Smischney, Nathan J.; Kuo, Han-Pin; Tsirigotis, Panagiotis; Rello, Jordi; Kuan, Win Sen; Jung, Christian; Robba, Chiara; Taccone, Fabio Silvio; Leone, Marc; Spapen, Herbert; Grimaldi, David; Van Poucke, Sven; Simpson, Steven Q.

    2017-01-01

    Severe sepsis and septic shock are major causes of morbidity and mortality in patients entering the emergency department (ED) or intensive care unit (ICU). Despite substantial efforts to improve patient outcome, treatment of sepsis remains challenging to clinicians. In this context, early goal directed therapy (EGDT) represents an important concept emphasizing both early recognition of sepsis and prompt initiation of a structured treatment algorithm. As part of the AME evidence series on seps...

  3. 2-Hydroxypyridine-N-oxide (HOPO): Equivocal in the ames assay.

    Dobo, Krista L; Cheung, Jennifer R; Gunther, William C; Kenyon, Michelle O

    2018-05-01

    2-Hydroxypyridine-N-oxide (HOPO) is a useful coupling reagent for synthesis of active pharmaceutical ingredients. It has been reported to be weakly mutagenic in the Ames assay (Ding W et al. []: J Chromatogr A 1386:47-52). According to the ICH M7 guidance (2014) regarding control of mutagenic impurities to limit potential carcinogenic risk, mutagens require control in drug substances such that exposure not exceeds the threshold of toxicological concern. Given the weak response observed in the Ames assay and the lack of any obvious structural features that could confer DNA reactivity we were interested to determine if the results were reproducible and investigate the role of potentially confounding experimental parameters. Specifically, Ames tests were conducted to assess the influence of compound purity, solvent choice, dose spacing, toxicity, type of S9 (aroclor vs phenobarbital/β-napthoflavone), and lot variability on the frequency of HOPO induced revertant colonies. Initial extensive testing using one lot of HOPO produced no evidence of mutagenic potential in the Ames assays. Subsequent studies with four additional lots produced conflicting results, with an ∼2.0-fold increase in revertant colonies observed. Given the rigor of the current investigation, lack of reproducibility between lots, and the weak increase in revertants, it is concluded that HOPO is equivocal in the bacterial reverse mutation assay. It is highly unlikely that HOPO poses a mutagenic risk in vivo; therefore, when it is used as a reagent in pharmaceutical synthesis, it should not be regarded as a mutagenic impurity, but rather a normal process related impurity. Environ. Mol. Mutagen. 59:312-321, 2018. © 2018 Wiley Periodicals, Inc. © 2018 Wiley Periodicals, Inc.

  4. Microplate Ames MPF™ test use in assessment of mutagenic properties of dust pollution

    Agnieszka Kozłowska

    2012-09-01

    Full Text Available Background: Highly industrialized Upper Silesia Region is particularly polluted by both anthropogenic and natural airborne particulate matters, which may lead to negative health effects in human. Materials and methods: The aim of the study was to assess the mutagenic properties of dust extracts which were collected in six cities in the Silesian Voivodeship. Dust samples were collected on glass fiber filters by the aspirator with air flow ca. 1 m3/min. Extraction of pollution was carried out using dichlorometane. The extracted samples were dissolved in dimethylsulfoxide (DMSO. The mutagenic properties were assessed using microplate Ames assay MPFTM with the use of bacteria Salmonella typhimurium strain TA98 and TA100. Results: In microplate Ames assay MPFTM there was observed a linear dose-response relationship in both metabolic variants of TA98 strain. Similar relationship was observed for TA100 strain with metabolic activation (S9. Mutagenic activity (AM of 100% extracts for TA98 strain in both metabolic variants (S9 exceeded 2, what indicate highly mutagenic effects of dust extracts. There was no mutagenic activity observed in the assay with TA100 (S9, AM 1. In the variant with exogenous metabolic activation (S9 in TA100 strain AM values ranged from AM1,160,15 to AM9,671,02. Mutagenic activity varied between different cities. Conclusions: The study demonstrated that microplate Ames assay MPFTM is fast and complex method of assessing the mutagenic properties of dust pollution, which exert toxic effect on organisms. The use of microplate Ames assay MPFTM together with chemical analyses of air dust pollution may evaluate the level of exposure in the environment and enable to perform health risk assessment in populations exposed to mutagenic, toxic and cytotoxic substances.

  5. Consolidated Laser-Induced Fluorescence Diagnostic Systems for the NASA Ames Arc Jet Facilities

    Grinstead, Jay; Wilder, Michael C.; Porter, Barry; Brown, Jeff; Yeung, Dickson; Battazzo, Steve; Brubaker, Tim

    2016-01-01

    The spectroscopic diagnostic technique of two photon absorption laser-induced fluorescence (TALIF) of atomic species for non-intrusive arc jet flow property measurement was first implemented at NASA Ames in the mid-1990s. Use of TALIF expanded at NASA Ames and to NASA Johnsons arc jet facility in the late 2000s. In 2013-2014, NASA combined the agency's large-scale arc jet test capabilities at NASA Ames. Concurrent with that effort, the agency also sponsored a project to establish two comprehensive LIF diagnostic systems for the Aerodynamic Heating Facility (AHF) and Interaction Heating Facility (IHF) arc jets. The scope of the project enabled further engineering development of the existing IHF LIF system as well as the complete reconstruction of the original AHF LIF system. The updated LIF systems are identical in design and capability. They represent the culmination of over 20 years of development experience in transitioning a specialized laboratory research tool into a measurement system for large-scale, high-demand test facilities. This paper documents the overall system design from measurement requirements to implementation. Representative data from the redeveloped AHF and IHF LIF systems are also presented.

  6. NASA Ames DEVELOP Interns: Helping the Western United States Manage Natural Resources One Project at a Time

    Justice, Erin; Newcomer, Michelle

    2010-01-01

    The western half of the United States is made up of a number of diverse ecosystems ranging from arid desert to coastal wetlands and rugged forests. Every summer for the past 7 years students ranging from high school to graduate level gather at NASA Ames Research Center (ARC) as part of the DEVELOP Internship Program. Under the guidance of Jay Skiles [Ames Research Center (ARC) - Ames DEVELOP Manager] and Cindy Schmidt [ARC/San Jose State University Ames DEVELOP Coordinator] they work as a team on projects exploring topics including: invasive species, carbon flux, wetland restoration, air quality monitoring, storm visualizations, and forest fires. The study areas for these projects have been in Washington, Utah, Oregon, Nevada, Hawaii, Alaska and California. Interns combine data from NASA and partner satellites with models and in situ measurements to complete prototype projects demonstrating how NASA data and resources can help communities tackle their Earth Science related problems.

  7. State of the Art High-Throughput Approaches to Genotoxicity: Flow Micronucleus, Ames II, GreenScreen and Comet

    State of the Art High-Throughput Approaches to Genotoxicity: Flow Micronucleus, Ames II, GreenScreen and Comet (Presented by Dr. Marilyn J. Aardema, Chief Scientific Advisor, Toxicology, Dr. Leon Stankowski, et. al. (6/28/2012)

  8. Ames S-32 O-16 O-18 Line List for High-Resolution Experimental IR Analysis

    Huang, Xinchuan; Schwenke, David W.; Lee, Timothy J.

    2016-01-01

    By comparing to the most recent experimental data and spectra of the SO2 628 ?1/?3 bands (see Ulenikov et al., JQSRT 168 (2016) 29-39), this study illustrates the reliability and accuracy of the Ames-296K SO2 line list, which is accurate enough to facilitate such high-resolution spectroscopic analysis. The SO2 628 IR line list is computed on a recently improved potential energy surface (PES) refinement, denoted Ames-Pre2, and the published purely ab initio CCSD(T)/aug-cc-pVQZ dipole moment surface. Progress has been made in both energy level convergence and rovibrational quantum number assignments agreeing with laboratory analysis models. The accuracy of the computed 628 energy levels and line list is similar to what has been achieved and reported for SO2 626 and 646, i.e. 0.01-0.03 cm(exp -1) for bands up to 5500 cm(exp -1). During the comparison, we found some discrepancies in addition to overall good agreements. The three-IR-list based feature-by-feature analysis in a 0.25 cm(exp -1) spectral window clearly demonstrates the power of the current Ames line lists with new assignments, correction of some errors, and intensity contributions from varied sources including other isotopologues. We are inclined to attribute part of detected discrepancies to an incomplete experimental analysis and missing intensity in the model. With complete line position, intensity, and rovibrational quantum numbers determined at 296 K, spectroscopic analysis is significantly facilitated especially for a spectral range exhibiting such an unusually high density of lines. The computed 628 rovibrational levels and line list are accurate enough to provide alternatives for the missing bands or suspicious assignments, as well as helpful to identify these isotopologues in various celestial environments. The next step will be to revisit the SO2 828 and 646 spectral analyses.

  9. Feature combination networks for the interpretation of statistical machine learning models: application to Ames mutagenicity.

    Webb, Samuel J; Hanser, Thierry; Howlin, Brendan; Krause, Paul; Vessey, Jonathan D

    2014-03-25

    A new algorithm has been developed to enable the interpretation of black box models. The developed algorithm is agnostic to learning algorithm and open to all structural based descriptors such as fragments, keys and hashed fingerprints. The algorithm has provided meaningful interpretation of Ames mutagenicity predictions from both random forest and support vector machine models built on a variety of structural fingerprints.A fragmentation algorithm is utilised to investigate the model's behaviour on specific substructures present in the query. An output is formulated summarising causes of activation and deactivation. The algorithm is able to identify multiple causes of activation or deactivation in addition to identifying localised deactivations where the prediction for the query is active overall. No loss in performance is seen as there is no change in the prediction; the interpretation is produced directly on the model's behaviour for the specific query. Models have been built using multiple learning algorithms including support vector machine and random forest. The models were built on public Ames mutagenicity data and a variety of fingerprint descriptors were used. These models produced a good performance in both internal and external validation with accuracies around 82%. The models were used to evaluate the interpretation algorithm. Interpretation was revealed that links closely with understood mechanisms for Ames mutagenicity. This methodology allows for a greater utilisation of the predictions made by black box models and can expedite further study based on the output for a (quantitative) structure activity model. Additionally the algorithm could be utilised for chemical dataset investigation and knowledge extraction/human SAR development.

  10. High-speed research program systems analysis activities at Ames Research Center

    Kidwell, George H.

    1992-01-01

    The Ames Systems Analysis Branch has been working to support the High Speed Research Program (HSRP) for nearly one year. Both the status of methodology development activities and the results of studies are presented whether completed or underway. The discussion involves the conceptual design synthesis program used for High Speed Civil Transport (HSCT) studies, ACSYNT (aircraft synthesis), and enhancements that have been made especially for HSRP. Some results are presented for one study that has been completed and two that are underway. These are the advanced controls integration study, the fuel cost impact study, and the oblique wing configuration evaluation that is part of a larger innovative concepts study.

  11. Urine recovery experiments with quercetin and other mutagens using the Ames test

    Busch, D.B.; Hatcher, J.F.; Bryan, G.T.

    1986-01-01

    Recovery from urine of the mutagenic activity of 2-anthramine, cyclophosphamide, 7,12-dimethylbenz(a)anthracene, 6-chloro-9-((3-(2-chloroethylamino)-propyl)amino)-2-methoxyacridine dihydrochloride (ICR-191), mitomycin-C, nitrofurantoin, and quercetin was studied with several of the Ames tester strains using acetone-extracted XAD-2 columns with yields ranging from 27% to 79%. Dose responses of the pure chemicals were also studied, and results showed TA 97 to be far more susceptible to quercetin mutagenesis than TA 1537. Reducing pour plate agar volume enhanced mutagenesis.

  12. Comparison of Amerlex, NML, and Ames total thyroxine and triiodothyronine radioimmunoassay kits

    Wilke, T J; Turnbull, P A [Commonwealth Pathology Lab., Toowoomba (Australia). Dept. of Endocrinology

    1982-03-01

    An evaluation of the Amerlex system for determination of total thyroxine (T4) and total triiodothyronine (T3) is described. The within- and between-batch precisions were acceptable, and analyses of quality control material and linearity studies demonstrated good accuracy at the clinical decision levels. The correlations obtained with NML and Ames T4 and T3 kit methods were highly significant. The Amerlex T4 and T3 methods are rapid, technically simple, and, coupled with excellent precision and accuracy, present significant advantages.

  13. Comparison of Amerlex, NML, and Ames total thyroxine and triiodothyronine radioimmunoassay kits

    Wilke, T.J.; Turnbull, P.A.

    1982-01-01

    An evaluation of the Amerlex system for determination of total thyroxine (T4) and total triiodothyronine (T3) is described. The within- and between-batch precisions were acceptable, and analyses of quality control material and linearity studies demonstrated good accuracy at the clinical decision levels. The correlations obtained with NML and Ames T4 and T3 kit methods were highly significant. The Amerlex T4 and T3 methods are rapid, technically simple, and, coupled with excellent precision and accuracy, present significant advantages. (author)

  14. Ames Mutagenicity Assessment of Flavored Water Pipe Tobacco Products :A Cross Sectional Study in Tehran

    Shahrzad Sadri

    2016-12-01

    Full Text Available Waterpipe smoking has become a global youth trend especially in the Middle East countries and Iran . The aim of this study was to determine the mutagenic effects of three most popular flavored tobaccos by four different salmonella typhimurium strains and compare the possible mutagenic effects of the test samples. Ames mutagenicity assessment was conducted according to the OECD guideline using TA100, TA98 , YG1024 and YG1029 strains. Charcoal burned flavored tobaccos of three different flavors including Orange, Double Apple, and Lime Mint were filtered and exposed to all strains after strain identification tests and MIC ,MBC determinations. The Ames test results indicated significant mutagenic effects of tobacco samples in all four test strains when compared with negative control (p≤0.0001. The highest Mutagenic Factor (MF was seen in Double Apple samples using TA 98 (MF=11.5±3.3 . In all experiments, TA strains showed higher sensitivity to the samples than YG strains which suggest these two strains for further regulatory toxicity tests ,policy making purposes and tobacco control programs . Present results represents an important step in understanding the genotoxic potentials of three most popular flavored tobaccos samples of a famous brand in the global markets .

  15. Low body temperature in long-lived Ames dwarf mice at rest and during stress.

    Hunter, W S; Croson, W B; Bartke, A; Gentry, M V; Meliska, C J

    1999-09-01

    Among homeothermic animals, larger species generally have lower metabolic rates and live longer than do smaller species. Because Ames dwarf mice (dwarfs) live approximately 1 year longer than their larger normal sex- and age-matched siblings (normals), we hypothesized that they would have lower body core temperature (Tco). We, therefore, measured Tco of six dwarfs and six normals during 24-h periods of ad lib feeding, 24-h food deprivation, and emotional stress induced by cage switching. With ad lib feeding, Tco of dwarfs averaged 1.6 degrees C lower than normals; during food deprivation, Tco of both dwarfs and controls was significantly lower than when food was available ad lib; and following cage switch, Tco was elevated in both groups. However, during all three experiments, Tco was significantly lower in dwarfs than in normals. These data support the hypothesis that Ames dwarf mice, which live longer than normal size controls, maintain lower Tco than normals. Because dwarfs are deficient in thyroid stimulating hormone (TSH) and growth hormone (GH), their low Tco may be a result of reduced thermogenesis due to lack of those hormones. However, whether low Tco per se is related to the increased longevity of the dwarf mice remains an interesting possibility to be investigated.

  16. Thyroxine modifies the effects of growth hormone in Ames dwarf mice.

    Do, Andrew; Menon, Vinal; Zhi, Xu; Gesing, Adam; Wiesenborn, Denise S; Spong, Adam; Sun, Liou; Bartke, Andrzej; Masternak, Michal M

    2015-04-01

    Ames dwarf (df/df) mice lack growth hormone (GH), thyroid stimulating hormone and prolactin. Treatment of juvenile df/df mice with GH alone stimulates somatic growth, reduces insulin sensitivity and shortens lifespan. Early-life treatment with thyroxine (T4) alone produces modest growth stimulation but does not affect longevity. In this study, we examined the effects of treatment of juvenile Ames dwarf mice with a combination of GH + T4 and compared them to the effects of GH alone. Treatment of female and male dwarfs with GH + T4 between the ages of 2 and 8 weeks rescued somatic growth yet did not reduce lifespan to match normal controls, thus contrasting with the previously reported effects of GH alone. While the male dwarf GH + T4 treatment group had no significant effect on lifespan, the female dwarfs undergoing treatment showed a decrease in maximal longevity. Expression of genes related to GH and insulin signaling in the skeletal muscle and white adipose tissue (WAT) of female dwarfs was differentially affected by treatment with GH + T4 vs. GH alone. Differences in the effects of GH + T4 vs. GH alone on insulin target tissues may contribute to the differential effects of these treatments on longevity.

  17. Genotoxic and cytotoxic potential of whole plant extracts of Kalanchoe laciniata by Ames and MTT assay.

    Sharif, Ali; Akhtar, Muhammad Furqan; Akhtar, Bushra; Saleem, Ammara; Manan, Maria; Shabbir, Maryam; Ashraf, Muneeb; Peerzada, Sohaib; Ahmed, Shoaib; Raza, Moosa

    2017-01-01

    Lack of data on safety of herbal medicines have endangered human health and life. The present study evaluated the genotoxic and mutagenic effect of Kalanchoe laciniata to access the safety and usefulness of the medicinal plant. Aqua-methanolic and n-hexane extracts of K. laciniata were evaluated for the genotoxic potential using Ames assay and cytotoxicity was evaluated using MTT assay. Ames assay was conducted using two strains of Salmonella typhimurium TA-100 and TA-102 whereas MTT assay was performed on baby hamster kidney cell line BHK-21. Aqua-methanolic extract of K. laciniata exhibited significant mutagenicity when exposed to TA-102 strain with a mutagenic index of 50.66 and 54.74 at maximum dose 150 mg/plate. The extract was also mutagenic to TA-100 strain but to a lesser extent. M.I of n-hexane extract was 12.15 and 15.51 for TA-100 and TA-102 respectively. n-hexane extract was mutagenic but little difference was observed between results of two strains. Both extracts were found to be cytotoxic with an IC 50 of 321.9 and 638.5 µg/mL for aqua-methanolic and n-hexane extracts respectively. On the basis of results it was concluded that aqua-methanolic and n-hexane extracts of K. laciniata possess mutagenic and cytotoxic potential. It is suggested to explore the plant further to evaluate its safety in rodents and other species.

  18. Application of the Ames mutagenicity test to food processed by physical preservation methods

    Kooij, J.G. van; Leveling, H.B.; Schubert, J.

    1978-01-01

    An irradiated (380 krad) mixture of four fresh vegetables - leek, celery, carrot, and cauliflower - was examined for mutagenicity by the Ames mutagenicity test using four different histidine-deficient strains of Salmonellae. Water extracts were prepared from the irradiated and unirradiated vegetables - a freeze dried extract (FDE) and a boiled extract (BE). Several problems were overcome in the mutagenicity testing of a complex substance such as food which contains free histidine, different species of bacteria, and a mixture of low and high molecular weight chemicals. In addition, we eliminated an omission in the usual protocols of the Ames test by testing the positive mutagen controls in the presence and absence of the test samples, thus reducing the possible incidence of false negatives and false positives. The induction and expression of mutagenesis by sodium azide (SA) and ethidium bromide (EB) in TA 100 and TA 98 mutant strains, respectively, decreased with increasing amounts of FDE, while increasing levels of BE suppressed the number of revertants in TA 98 in the presence of EB, but exerted little influence on the mutagenicity of SA in TA 100. No difference was observed in the antimutagenic action between the irradiated and unirradiated vegetable extracts. Both the FDE and BE preparations suppressed the action of a frameshift mutagen, but with a base-pair mutagen only the FDE or uncooked vegetable extracts produced suppression. (author)

  19. Are effects of common ragwort in the Ames test caused by pyrrolizidine alkaloids?

    Bovee, Toine F H; Helsdingen, Richard J R; Hoogenboom, Ron L A P; de Nijs, Monique W C M; Liu, Xiaojie; Vrieling, Klaas; Klinkhamer, Peter G L; Peijnenburg, Ad A C M; Mulder, Patrick P J

    2015-08-01

    It has previously been demonstrated by others that acetone extracts of Senecio jacobaea (syn. Jacobaea vulgaris, common or tansy ragwort) test positive in the Salmonella/microsome mutagenicity test (Ames test). Pyrrolizidine alkaloids (PAs) are thought to be responsible for these mutagenic effects. However, it was also observed that the major PA present in common ragwort, jacobine, produced a negative response (with and without the addition of rat liver S9) in Salmonella test strains TA98, TA100, TA1535 and TA1537. To investigate which compounds in the plant extracts were responsible for the positive outcome, the present study investigated the contents and mutagenic effects of methanol and acetone extracts prepared from dried ground S. jacobaea and Senecio inaequidens (narrow-leafed ragwort). Subsequently, a fractionation approach was set up in combination with LC-MS/MS analysis of the fractions. It was shown that the positive Ames test outcomes of S. jacobaea extracts are unlikely to be caused by PAs, but rather by the flavonoid quercetin. This study also demonstrates the importance of identifying compounds responsible for positive test results in bioassays. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Assessment of diphenylcyclopropenone for photochemically induced mutagenicity in the Ames assay

    Wilkerson, M.G.; Connor, T.H.; Henkin, J.; Wilkin, J.K.; Matney, T.S.

    1987-10-01

    The photochemical conversion of diphenylcyclopropenone to diphenylacetylene has recently been reported. Diphenylcyclopropenone is used in the treatment of alopecia areata and is nonmutagenic in a limited Ames assay. We examined diphenylcyclopropenone and diphenylacetylene, as well as synthetic precursors of diphenylcyclopropenone--dibenzylketone and alpha,alpha'-dibromodibenzylketone--for mutagenicity against TA100, TA98, TA102, UTH8413, and UTH8414. All compounds were nonmutagenic except alpha,alpha'-dibromodibenzylketone, which was a potent mutagen in TA100 with and without S-9 activation. The effect of photochemical activation of diphenylcyclopropenone in the presence of bacteria demonstrated mutagenicity in UTH8413 (two times background) at 10 micrograms/plate with S-9 microsomal activation. 8-Methoxypsoralen produces a mutagenic response in TA102 at 0.1 microgram/plate with 60 seconds of exposure to 350 nm light. In vitro photochemically activated Ames assay with S-9 microsomal fraction may enhance the trapping of short-lived photochemically produced high-energy mutagenic intermediates. This technique offers exciting opportunities to trap high-energy intermediates that may play an important role in mutagenesis. This method can be applied to a variety of topically applied dermatologic agents, potentially subjected to photochemical changes in normal use.

  1. Mutagenic activity of a fluorinated analog of the beta-adrenoceptor ligand carazolol in the Ames test

    Doze, P. E-mail: P.Doze@pet.azg.nl; Elsinga, P.H.; Vries, E.F.J. de; Waarde, A. van; Vaalburg, W

    2000-04-01

    S-1'[{sup 18}F]-Fluorocarazolol (FCAR) is a fluorinated analog of the nonmutagenic beta-blocker carazolol (CAR). In former studies FCAR proved to be suitable for quantification of beta-adrenoceptors in vivo with positron emission tomography (PET). We report here that FCAR displays no acute toxicity in either rats or mice. However, FCAR induces a strong dose-related increase in the number of revertants in the Ames test. We conclude that FCAR yields mutagenic activity as measured by the Ames test.

  2. The Use of the Ames Test as a Tool for Addressing Problem-Based Learning in the Microbiology Lab

    Eliana Rodríguez

    2012-08-01

    Full Text Available Our environment is full of potential carcinogens such as UV light, industrial pollutants, pesticides, and food additives, among others. It is estimated that 90% of all carcinogens are also mutagens. The Ames test is one of the most common tests for mutagens. In this problem-based learning activity, undergraduate biology students used the Ames test to screen a substance they provided, to see if it could be considered a mutagen. The idea of surveying substances used in everyday life appealed to our students, and helped engage them in this activity.

  3. Investigating the intra-nuclear cascade process using the reaction 136Xe on deuterium at 500 AMeV

    Rejmund F.

    2010-10-01

    Full Text Available More than 600 residual nuclei, formed in the spallation of 136Xe projectiles impinging on deuterium at 500 AMeV of incident energy, have been unambiguously identified and their production cross sections have been determined with high accuracy. By comparing these data to others previously measured for the reactions 136Xe  +  p at 1 AGeV and 136Xe  +  p at 500 AMeV we investigated the role that neutrons play in peripheral collisions and to understand the energy dissipation in frontal collisions in spallation reactions.

  4. Development and operation of a real-time simulation at the NASA Ames Vertical Motion Simulator

    Sweeney, Christopher; Sheppard, Shirin; Chetelat, Monique

    1993-01-01

    The Vertical Motion Simulator (VMS) facility at the NASA Ames Research Center combines the largest vertical motion capability in the world with a flexible real-time operating system allowing research to be conducted quickly and effectively. Due to the diverse nature of the aircraft simulated and the large number of simulations conducted annually, the challenge for the simulation engineer is to develop an accurate real-time simulation in a timely, efficient manner. The SimLab facility and the software tools necessary for an operating simulation will be discussed. Subsequent sections will describe the development process through operation of the simulation; this includes acceptance of the model, validation, integration and production phases.

  5. THE NASA AMES POLYCYCLIC AROMATIC HYDROCARBON INFRARED SPECTROSCOPIC DATABASE: THE COMPUTED SPECTRA

    Bauschlicher, C. W.; Ricca, A.; Boersma, C.; Mattioda, A. L.; Cami, J.; Peeters, E.; Allamandola, L. J.; Sanchez de Armas, F.; Puerta Saborido, G.; Hudgins, D. M.

    2010-01-01

    The astronomical emission features, formerly known as the unidentified infrared bands, are now commonly ascribed to polycyclic aromatic hydrocarbons (PAHs). The laboratory experiments and computational modeling done at the NASA Ames Research Center to create a collection of PAH IR spectra relevant to test and refine the PAH hypothesis have been assembled into a spectroscopic database. This database now contains over 800 PAH spectra spanning 2-2000 μm (5000-5 cm -1 ). These data are now available on the World Wide Web at www.astrochem.org/pahdb. This paper presents an overview of the computational spectra in the database and the tools developed to analyze and interpret astronomical spectra using the database. A description of the online and offline user tools available on the Web site is also presented.

  6. Development of Implicit Methods in CFD NASA Ames Research Center 1970's - 1980's

    Pulliam, Thomas H.

    2010-01-01

    The focus here is on the early development (mid 1970's-1980's) at NASA Ames Research Center of implicit methods in Computational Fluid Dynamics (CFD). A class of implicit finite difference schemes of the Beam and Warming approximate factorization type will be addressed. The emphasis will be on the Euler equations. A review of material pertinent to the solution of the Euler equations within the framework of implicit methods will be presented. The eigensystem of the equations will be used extensively in developing a framework for various methods applied to the Euler equations. The development and analysis of various aspects of this class of schemes will be given along with the motivations behind many of the choices. Various acceleration and efficiency modifications such as matrix reduction, diagonalization and flux split schemes will be presented.

  7. Reduction of Background Noise in the NASA Ames 40- by 80-Foot Wind Tunnel

    Jaeger, Stephen M.; Allen, Christopher S.; Soderman, Paul T.; Olson, Larry E. (Technical Monitor)

    1995-01-01

    Background noise in both open-jet and closed wind tunnels adversely affects the signal-to-noise ratio of acoustic measurements. To measure the noise of increasingly quieter aircraft models, the background noise will have to be reduced by physical means or through signal processing. In a closed wind tunnel, such as the NASA Ames 40- by 80- Foot Wind Tunnel, the principle background noise sources can be classified as: (1) fan drive noise; (2) microphone self-noise; (3) aerodynamically induced noise from test-dependent hardware such as model struts and junctions; and (4) noise from the test section walls and vane set. This paper describes the steps taken to minimize the influence of each of these background noise sources in the 40 x 80.

  8. Prominent transverse flow of clusters in stopped Au(150AMeV)+Au reactions

    Coffin, J.P.; Kuhn, C.; Roy, C.; Cerruti, C.; Crochet, P.; Fintz, P.; Guillaume, G.; Houari, A.; Jundt, F.; Rami, F.; Tizniti, L.; Wagner, P.; Konopka, J.; Stoecker, H.

    1995-01-01

    Stopped Au(150AMeV)+Au collisions have been measured with the FOPI-Detector at GSI by imposing an upper limit on the ratio of the global longitudinal momentum to the collected charge within an event. The ejectiles, in particular those with Z>3, have a rapidity close to mid-rapidity and exhibit angular distributions in the centre-of-mass strongly peaking around 90 thus suggesting an enhancement of the flow in the transverse direction. Fits to the data and comparisons with QMD calculations indicate an averaged collective velocity in the transverse direction equal to 0.12c. Significance of the determined velocity and temperature values is discussed. ((orig.))

  9. New Diagnostic, Launch and Model Control Techniques in the NASA Ames HFFAF Ballistic Range

    Bogdanoff, David W.

    2012-01-01

    This report presents new diagnostic, launch and model control techniques used in the NASA Ames HFFAF ballistic range. High speed movies were used to view the sabot separation process and the passage of the model through the model splap paper. Cavities in the rear of the sabot, to catch the muzzle blast of the gun, were used to control sabot finger separation angles and distances. Inserts were installed in the powder chamber to greatly reduce the ullage volume (empty space) in the chamber. This resulted in much more complete and repeatable combustion of the powder and hence, in much more repeatable muzzle velocities. Sheets of paper or cardstock, impacting one half of the model, were used to control the amplitudes of the model pitch oscillations.

  10. The Intermediate Velocity Source in the 40Ca + 197Au Reaction at 35 AMeV

    Planeta, R.; Sosin, Z.; Hachaj, P.

    2001-01-01

    The creation of hot Ca-like fragments and the emission of intermediate velocity particles was studied in the 40 Ca+ 197 Au reaction at 35 AMeV. For peripheral collisions the primary projectile-like fragment was reconstructed using the AMPHORA 4π detector system. The particle distributions are compared with the predictions of a Monte Carlo code which calculates the nucleon transfer and clustering probabilities according to the system density of states. The velocity distributions of charged particles projected on the beam direction can be explained if emissions from the hot projectile-like fragment and the target-like fragment are supplemented by an emission from an intermediate velocity source located between them. The properties of the intermediate velocity source are properly described, including the 2 D/ 3 T/ 3 He effect. (author)

  11. Preliminary data from lithium hydride ablation tests conducted by NASA, Ames Research Center

    Elliott, R.D.

    1970-01-01

    A series of ablation tests of lithium hydride has been made by NASA-Ames in one of their high-enthalpy arc-heated wind tunnels. Two-inch diameter cylindrical samples of the hydride, supplied by A. I., were subjected to heating on their ends for time periods up to 10 seconds. After each test, the amount of material removed from each sample was measured. The rates of loss of material were correlated with the heat input rates in terms of a heat of ablation, which ranged from 2100 to 3500 Btu/lb. The higher values were obtained when the hydride contained a matrix such as steel honeycomb of steel wool. (U.S.)

  12. Updates on Modeling the Water Cycle with the NASA Ames Mars Global Climate Model

    Kahre, M. A.; Haberle, R. M.; Hollingsworth, J. L.; Montmessin, F.; Brecht, A. S.; Urata, R.; Klassen, D. R.; Wolff, M. J.

    2017-01-01

    Global Circulation Models (GCMs) have made steady progress in simulating the current Mars water cycle. It is now widely recognized that clouds are a critical component that can significantly affect the nature of the simulated water cycle. Two processes in particular are key to implementing clouds in a GCM: the microphysical processes of formation and dissipation, and their radiative effects on heating/ cooling rates. Together, these processes alter the thermal structure, change the dynamics, and regulate inter-hemispheric transport. We have made considerable progress representing these processes in the NASA Ames GCM, particularly in the presence of radiatively active water ice clouds. We present the current state of our group's water cycle modeling efforts, show results from selected simulations, highlight some of the issues, and discuss avenues for further investigation.­

  13. X-ray K-edge analysis of drain lines in Wilhelm Hall, Ames Laboratory

    Jensen, T.; Whitmore, C.; Iowa State Univ., Ames, IA

    1999-01-01

    From August 12--27, 1998 X-ray K-edge measurements were made on drain lines in seven rooms in Wilhelm Hall, Ames Laboratory. The purpose of these measurements was to determine the extent of thorium (and other heavy metal) contamination inside these pipes. The K-edge method is a noninvasive inspection technique that can provide accurate quantification of heavy metal contamination interior to an object. Of the seven drain lines inspected, one was found to have no significant contamination, three showed significant thorium deposits, two showed mercury contamination, and one line was found to contain mercury, thorium and uranium. The K-edge measurements were found to be consistent with readings from hand-held survey meters, and provided much greater detail on the location and amount of heavy metal contamination

  14. How to write an educational research grant: AMEE Guide No. 101.

    Blanco, Maria A; Gruppen, Larry D; Artino, Anthony R; Uijtdehaage, Sebastian; Szauter, Karen; Durning, Steven J

    2016-01-01

    Writing an educational research grant in health profession education is challenging, not only for those doing it for the first time but also for more experienced scholars. The intensity of the competition, the peculiarities of the grant format, the risk of rejection, and the time required are among the many obstacles that can prevent educational researchers with interesting and important ideas from writing a grant, that could provide the funding needed to turn their scholarly ideas into reality. The aim of this AMEE Guide is to clarify the grant-writing process by (a) explaining the mechanics and structure of a typical educational research grant proposal, and (b) sharing tips and strategies for making the process more manageable.

  15. The NASA Ames Research Center Institutional Scientific Collection: History, Best Practices and Scientific Opportunities

    Rask, Jon C.; Chakravarty, Kaushik; French, Alison; Choi, Sungshin; Stewart, Helen

    2017-01-01

    The NASA Ames Life Sciences Institutional Scientific Collection (ISC), which is composed of the Ames Life Sciences Data Archive (ALSDA) and the Biospecimen Storage Facility (BSF), is managed by the Space Biosciences Division and has been operational since 1993. The ALSDA is responsible for archiving information and animal biospecimens collected from life science spaceflight experiments and matching ground control experiments. Both fixed and frozen spaceflight and ground tissues are stored in the BSF within the ISC. The ALSDA also manages a Biospecimen Sharing Program, performs curation and long-term storage operations, and makes biospecimens available to the scientific community for research purposes via the Life Science Data Archive public website (https:lsda.jsc.nasa.gov). As part of our best practices, a viability testing plan has been developed for the ISC, which will assess the quality of archived samples. We expect that results from the viability testing will catalyze sample use, enable broader science community interest, and improve operational efficiency of the ISC. The current viability test plan focuses on generating disposition recommendations and is based on using ribonucleic acid (RNA) integrity number (RIN) scores as a criteria for measurement of biospecimen viablity for downstream functional analysis. The plan includes (1) sorting and identification of candidate samples, (2) conducting a statiscally-based power analysis to generate representaive cohorts from the population of stored biospecimens, (3) completion of RIN analysis on select samples, and (4) development of disposition recommendations based on the RIN scores. Results of this work will also support NASA open science initiatives and guides development of the NASA Scientific Collections Directive (a policy on best practices for curation of biological collections). Our RIN-based methodology for characterizing the quality of tissues stored in the ISC since the 1980s also creates unique

  16. Uji Mutagenik Ames untuk Melengkapi Data Keamanan Ekstrak Gambir (Uncaria gambir Roxb.

    Novi Sulistyaningrum

    2015-05-01

    Full Text Available The main compound of Uncaria gambir Roxb. (gambir, catechin and it’s derivates have been believed to be potential as antiviral. Epigallocatechin gallate (EGCG and epicatechin are catechin derivates which are found to be potential as antiviral against Human Immunodeficiency Virus (HIV. However, gambir extract also contains quercetin that has possibility to be mutagenic. Therefore, a preliminary study towards safety of those compounds within gambir extract, mutagenicity assay using Ames Method has been performed.Sample (gambir extract was obtained from West Sumatera, Indonesia. The extract was characterized according to Farmakope Herbal Indonesia and WHO methods. Mutagenicity test by Ames method utilized a colorimetric microplate in 6 various concentration (125 mg/mL; 62.5 mg/mL; 31.25 mg/mL; 15.625 mg/mL; 7.81 mg/mL dan 3.91 mg/mL against mutant bacteria Salmonella typhimurium TA 98, Salmonella typhimurium TA 100 and Escherichia coli WP2 uvrA with and without the addition of S-9 enzyme. Extract of gambir in this study contains 86.60% of catechin, 12.92% moisture content, 22.49% water-soluble extract content, 80.63% ethanol-soluble extract content, 0.81% total ash, 0.32% acid insoluble ash content and 10.38% in dryness level. From the mutagenicity test and calculation, fold increase (over baseline of the sample in 6 various concentration with and without adding S-9 enzyme are lower than 2. Gambir extract from West Sumatra with catechin contains 86.6% hasn’t showed mutagenic effect due to the fold increase (over baseline of mutagenicity test lower than 2.

  17. Phenotypic Data Collection and Sample Preparation for Genomics of Wood Formation and Cellulosic Biomass Traits in Sunflower: Ames, IA location.

    Marek, Laura F.

    2011-06-17

    Three fields were planted in Ames in 2010, two association mapping fields, N3 and A, and a recombinant inbred line field, N13. Phenotype data and images were transferred to UGA to support genetic and genomic analyses of woody biomass-related traits.

  18. Analysis of plant extracts antimutagenicity using the Ames test and the cytogenetic analysis of peripheral blood lymphocytes

    Buňková, R.; Marová, I.; Pokorná, Z.; Lojek, Antonín

    2005-01-01

    Roč. 11, č. 2 (2005), s. 107-112 ISSN 1082-0132 Institutional research plan: CEZ:AV0Z50040507 Keywords : plant extracts * antioxidative activity * Ames test Subject RIV: BO - Biophysics Impact factor: 0.724, year: 2005

  19. Identification of a polyketide synthase required for alternariol (AOH and alternariol-9-methyl ether (AME formation in Alternaria alternata.

    Debjani Saha

    Full Text Available Alternaria alternata produces more than 60 secondary metabolites, among which alternariol (AOH and alternariol-9-methyl ether (AME are important mycotoxins. Whereas the toxicology of these two polyketide-based compounds has been studied, nothing is known about the genetics of their biosynthesis. One of the postulated core enzymes in the biosynthesis of AOH and AME is polyketide synthase (PKS. In a draft genome sequence of A. alternata we identified 10 putative PKS-encoding genes. The timing of the expression of two PKS genes, pksJ and pksH, correlated with the production of AOH and AME. The PksJ and PksH proteins are predicted to be 2222 and 2821 amino acids in length, respectively. They are both iterative type I reducing polyketide synthases. PksJ harbors a peroxisomal targeting sequence at the C-terminus, suggesting that the biosynthesis occurs at least partly in these organelles. In the vicinity of pksJ we found a transcriptional regulator, altR, involved in pksJ induction and a putative methyl transferase, possibly responsible for AME formation. Downregulation of pksJ and altR caused a large decrease of alternariol formation, suggesting that PksJ is the polyketide synthase required for the postulated Claisen condensations during the biosynthesis. No other enzymes appeared to be required. PksH downregulation affected pksJ expression and thus caused an indirect effect on AOH production.

  20. ASCORBIC ACID REDUCTION OF ACTIVE CHLORINE PRIOR TO DETERMINING AMES MUTAGENICITY OF CHLORINATED NATURAL ORGANIC MATTER (NOM)

    Many potable water disinfection byproducts (DBPs) that result from the reaction of natural organic matter (NOM) with oxidizing chlorine are known or suspected to be carcinogenic and mutagenic. The Ames assay is routinely used to assess an overall level of mutagenicity for all com...

  1. Growth hormone alters the glutathione S-transferase and mitochondrial thioredoxin systems in long-living Ames dwarf mice.

    Rojanathammanee, Lalida; Rakoczy, Sharlene; Brown-Borg, Holly M

    2014-10-01

    Ames dwarf mice are deficient in growth hormone (GH), prolactin, and thyroid-stimulating hormone and live significantly longer than their wild-type (WT) siblings. The lack of GH is associated with stress resistance and increased longevity. However, the mechanism underlying GH's actions on cellular stress defense have yet to be elucidated. In this study, WT or Ames dwarf mice were treated with saline or GH (WT saline, Dwarf saline, and Dwarf GH) two times daily for 7 days. The body and liver weights of Ames dwarf mice were significantly increased after 7 days of GH administration. Mitochondrial protein levels of the glutathione S-transferase (GST) isozymes, K1 and M4 (GSTK1 and GSTM4), were significantly higher in dwarf mice (Dwarf saline) when compared with WT mice (WT saline). GH administration downregulated the expression of GSTK1 proteins in dwarf mice. We further investigated GST activity from liver lysates using different substrates. Substrate-specific GST activity (bromosulfophthalein, dichloronitrobenzene, and 4-hydrox-ynonenal) was significantly reduced in GH-treated dwarf mice. In addition, GH treatment attenuated the activity of thioredoxin and glutaredoxin in liver mitochondria of Ames mice. Importantly, GH treatment suppressed Trx2 and TrxR2 mRNA expression. These data indicate that GH has a role in stress resistance by altering the functional capacity of the GST system through the regulation of specific GST family members in long-living Ames dwarf mice. It also affects the regulation of thioredoxin and glutaredoxin, factors that regulate posttranslational modification of proteins and redox balance, thereby further influencing stress resistance. © The Author 2013. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  2. Transforming BIM to BEM: Generation of Building Geometry for the NASA Ames Sustainability Base BIM

    O' Donnell, James T. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Maile, Tobias [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Rose, Cody [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Mrazovic, Natasa [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Morrissey, Elmer [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Regnier, Cynthia [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Parrish, Kristen [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Bazjanac, Vladimir [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2013-01-01

    Typical processes of whole Building Energy simulation Model (BEM) generation are subjective, labor intensive, time intensive and error prone. Essentially, these typical processes reproduce already existing data, i.e. building models already created by the architect. Accordingly, Lawrence Berkeley National Laboratory (LBNL) developed a semi-automated process that enables reproducible conversions of Building Information Model (BIM) representations of building geometry into a format required by building energy modeling (BEM) tools. This is a generic process that may be applied to all building energy modeling tools but to date has only been used for EnergyPlus. This report describes and demonstrates each stage in the semi-automated process for building geometry using the recently constructed NASA Ames Sustainability Base throughout. This example uses ArchiCAD (Graphisoft, 2012) as the originating CAD tool and EnergyPlus as the concluding whole building energy simulation tool. It is important to note that the process is also applicable for professionals that use other CAD tools such as Revit (“Revit Architecture,” 2012) and DProfiler (Beck Technology, 2012) and can be extended to provide geometry definitions for BEM tools other than EnergyPlus. Geometry Simplification Tool (GST) was used during the NASA Ames project and was the enabling software that facilitated semi-automated data transformations. GST has now been superseded by Space Boundary Tool (SBT-1) and will be referred to as SBT-1 throughout this report. The benefits of this semi-automated process are fourfold: 1) reduce the amount of time and cost required to develop a whole building energy simulation model, 2) enable rapid generation of design alternatives, 3) improve the accuracy of BEMs and 4) result in significantly better performing buildings with significantly lower energy consumption than those created using the traditional design process, especially if the simulation model was used as a predictive

  3. Collective effects in Au(100-800 AMeV) + Au semi-central collisions; Effets collectifs dans les collisions semi-centrales Au(100-800 AMeV) + Au

    Crochet, P.

    1996-04-04

    The present work has been carried out in the framework of the experimental program of the FOPI collaboration. It is devoted to a systematic study of the different forms of collective expansion of nuclear matter in semi-central Au+Au collisions at incident energies ranging from 100 AMeV to 800 AMeV. The aim is to investigate the influence of compressional effects, momentum dependence of the nuclear interaction and nucleon-nucleon cross section on the observed phenomena. Important changes in the reaction mechanisms are evidenced, in particular at low incident energies where one observes, on the one hand, a transition from an enhanced in-plane emission to a preferential out-of-plane emission pattern and, on the other hand, a strong reduction of the directed in-plane component. Experimental results are compared to the predictions of the Quantum Molecular Dynamics (QMD) model for different parametrizations of the nuclear interaction. (author).

  4. Educational Projects in Unmanned Aerial Systems at the NASA Ames Research Center

    Dahlgren, Robert P.

    2017-01-01

    Unmanned aerial systems (UAS), autonomy and robotics technology have been fertile ground for developing a wide variety of interdisciplinary student learning opportunities. In this talk, several projects will be described that leverage small fixed-wing UAS that have been modified to carry science payloads. These aircraft provide a unique hands-on experience for a wide range of students from college juniors to graduate students pursuing degrees in electrical engineering, aeronautical engineering, mechanical engineering, applied mathematics, physics, structural engineering and other majors. By combining rapid prototyping, design reuse and open-source philosophies, a sustainable educational program has been organized structured as full-time internships during the summer, part-time internships during the school year, short details for military cadets, and paid positions. As part of this program, every summer one or more UAS is developed from concept through design, build and test phases using the tools and facilities at the NASA Ames Research Center, ultimately obtaining statements of airworthiness and flight release from the Agency before test flights are performed. In 2016 and 2017 student projects focused on the theme of 3D printed modular airframes that may be optimized for a given mission and payload. Now in its fifth year this program has served over 35 students, and has provided a rich learning experience as they learn to rapidly develop new aircraft concepts in a highly regulated environment, on systems that will support principal investigators at university, NASA, and other US federal agencies.

  5. Scholarship, publication, and career advancement in health professions education: AMEE Guide No. 43.

    McGaghie, William C

    2009-07-01

    Scholarship and publication are key contributors to career advancement in health professions education worldwide. Scholarship is expressed in many ways including original research; integration and synthesis of ideas and data, often across disciplines; application of skill and knowledge to problems that have consequences for health professionals, students, and patients; and teaching in many forms. Professional publication also has diverse outlets ranging from empirical articles in peer reviewed journals, textbook chapters, videos, simulation technologies, and many other means of expression. Scholarship and publication are evaluated and judged using criteria that are consensual, public, and transparent. This three-part AMEE Guide presents advice about how to prepare and publish health professions education research reports and other forms of scholarship in professional journals and other outlets. Part One addresses scholarship-its varieties, assessment, and attributes of productive scholars and scholarly teams. Part Two maps the road to publication, beginning with what's important and reportable and moving to manuscript planning and writing, gauging manuscript quality, manuscript submission and review, and writing in English. Part Three offers 21 practical suggestions about how to advance a successful and satisfying career in the academic health professions. Concluding remarks encourage health professions educators to pursue scholarship with vision and reflection.

  6. Radiation-induced mutagenicity and lethality in Ames tester strains of Salmonella

    Isildar, M.; Bakale, G.

    1984-01-01

    Mutation and killing induced by X radiation and 60 Co γ radiation were studied in six different histidine-requiring auxotrophs of Salmonella typhimurium. Strain TA100, which is sensitive to base-pair substitutions, and strains TA2637 and TA98, which are sensitive to frameshifts, carry the pKM101 plasmid and exhibit significantly higher radiation-induced mutations compared to their plasmidless parent strains TA1535, TA1537, and TA1538, respectively. Among the plasmid-containing strains, TA98 and TA2637 are much more sensitive to the mutagenic action of radiation than is TA100 based on a comparison with their respective spontaneous mutation rates; however, no uniformity was observed in the responses of the strains to the lethal action of ionizing radiation. The following conclusions are consistent with these observations: (1) the standard Ames Salmonella assay correctly identifies ionizing radiation as a mutagenic agent; (2) frameshift-sensitive parent strains are more sensitive to the mutagenic effects of ionizing radiation than is the only strain studied that is sensitive to base-pair substitutions; and (3) enhancement of mutagenesis and survival is related to plasmid-mediated repair of DNA damage induced by ionizing radiation and does not involve damage induced by Cerenkov-generated uv radiation which is negligible for our irradiation conditions

  7. Mutagenicity of Tween 80-solvated mild gasification products in the Ames salmonella microsomal assay system

    1992-01-13

    The results of the Tween 80-solvated Ames testing of six mild gasification samples indicate significant mutagenic activity only in the composite materials (MG-119 and MG-120), previously suspected from the DMSO-solvated assays, which had shown some variable but ultimately insignificant mutagenic responses. The activity of these samples from the Tween 80-solvated assays was quite low when compared to either the positive controls or the SRC-II HD coal-liquefaction reference material. The class of mutagenic activity expressed by these samples solvated in Tween 80 was that of an indirect-acting, frameshift mutagen(s) since significant activity was found only on tester strain TA98 in the presence of the metabolic activation fraction (S9). Because DMSO and other solvents have been shown to affect the mutagenic activity of certain pure chemicals, the possibility of solvent/mutagen interactions in complex mixtures such as coal-derived liquids exists. Thus, the testing of the genotoxic activity of undefined, chemically complex compounds may require the use of at least two solvent systems to reduce the possibility of artifactual findings. 10 refs., 4 tabs.

  8. Ames expedited site characterization demonstration at the former manufactured gas plant site, Marshalltown, Iowa

    Bevolo, A.J.; Kjartanson, B.H.; Wonder, J.D.

    1996-03-01

    The goal of the Ames Expedited Site Characterization (ESC) project is to evaluate and promote both innovative technologies (IT) and state-of-the-practice technologies (SOPT) for site characterization and monitoring. In April and May 1994, the ESC project conducted site characterization, technology comparison, and stakeholder demonstration activities at a former manufactured gas plant (FMGP) owned by Iowa Electric Services (IES) Utilities, Inc., in Marshalltown, Iowa. Three areas of technology were fielded at the Marshalltown FMGP site: geophysical, analytical and data integration. The geophysical technologies are designed to assess the subsurface geological conditions so that the location, fate and transport of the target contaminants may be assessed and forecasted. The analytical technologies/methods are designed to detect and quantify the target contaminants. The data integration technology area consists of hardware and software systems designed to integrate all the site information compiled and collected into a conceptual site model on a daily basis at the site; this conceptual model then becomes the decision-support tool. Simultaneous fielding of different methods within each of the three areas of technology provided data for direct comparison of the technologies fielded, both SOPT and IT. This document reports the results of the site characterization, technology comparison, and ESC demonstration activities associated with the Marshalltown FMGP site. 124 figs., 27 tabs

  9. Training for life science experiments in space at the NASA Ames Research Center

    Rodrigues, Annette T.; Maese, A. Christopher

    1993-01-01

    As this country prepares for exploration to other planets, the need to understand the affects of long duration exposure to microgravity is evident. The National Aeronautics and Space Administration (NASA) Ames Research Center's Space Life Sciences Payloads Office is responsible for a number of non-human life sciences payloads on NASA's Space Shuttle's Spacelab. Included in this responsibility is the training of those individuals who will be conducting the experiments during flight, the astronauts. Preparing a crew to conduct such experiments requires training protocols that build on simple tasks. Once a defined degree of performance proficiency is met for each task, these tasks are combined to increase the complexity of the activities. As tasks are combined into in-flight operations, they are subjected to time constraints and the crew enhances their skills through repetition. The science objectives must be completely understood by the crew and are critical to the overall training program. Completion of the in-flight activities is proof of success. Because the crew is exposed to the background of early research and plans for post-flight analyses, they have a vested interest in the flight activities. The salient features of this training approach is that it allows for flexibility in implementation, consideration of individual differences, and a greater ability to retain experiment information. This training approach offers another effective alternative training tool to existing methodologies.

  10. Ovarian transcriptome associated with reproductive senescence in the long-living Ames dwarf mice.

    Schneider, Augusto; Matkovich, Scot J; Saccon, Tatiana; Victoria, Berta; Spinel, Lina; Lavasani, Mitra; Bartke, Andrzej; Golusinski, Pawel; Masternak, Michal M

    2017-01-05

    The aim of the current work was to evaluate the ovarian follicle reserve and the ovarian transcriptome in Ames dwarf (df/df) mice. The results suggest a delayed ovarian aging in df/df mice compared to normal (N) mice. Although a high number of genes were differentially expressed during aging of N mice, only a small fraction of these changed with aging in df/df mice. These alterations involved more than 500 categorized biological processes. The majority of these biological processes, including inflammatory/immune responses, were up-regulated with aging in N mice, while old df/df mice were characterized by down-regulation of these same processes in comparison to age matched N mice. However, biological processes related to DNA damage and repairing were commonly down-regulated with aging in both genotypes. In conclusion, delayed ovarian aging in long-living df/df mice was associated with reduced expression of genes related to the inflammatory and immune responses. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  11. The NASA Ames Hypersonic Combustor-Model Inlet CFD Simulations and Experimental Comparisons

    Venkatapathy, E.; Tokarcik-Polsky, S.; Deiwert, G. S.; Edwards, Thomas A. (Technical Monitor)

    1995-01-01

    Computations have been performed on a three-dimensional inlet associated with the NASA Ames combustor model for the hypersonic propulsion experiment in the 16-inch shock tunnel. The 3-dimensional inlet was designed to have the combustor inlet flow nearly two-dimensional and of sufficient mass flow necessary for combustion. The 16-inch shock tunnel experiment is a short duration test with test time of the order of milliseconds. The flow through the inlet is in chemical non-equilibrium. Two test entries have been completed and limited experimental results for the inlet region of the combustor-model are available. A number of CFD simulations, with various levels of simplifications such as 2-D simulations, 3-D simulations with and without chemical reactions, simulations with and without turbulent conditions, etc., have been performed. These simulations have helped determine the model inlet flow characteristics and the important factors that affect the combustor inlet flow and the sensitivity of the flow field to these simplifications. In the proposed paper, CFD modeling of the hypersonic inlet, results from the simulations and comparison with available experimental results will be presented.

  12. Sources and levels of background noise in the NASA Ames 40- by 80-foot wind tunnel

    Soderman, Paul T.

    1988-01-01

    Background noise levels are measured in the NASA Ames Research Center 40- by 80-Foot Wind Tunnel following installation of a sound-absorbent lining on the test-section walls. Results show that the fan-drive noise dominated the empty test-section background noise at airspeeds below 120 knots. Above 120 knots, the test-section broadband background noise was dominated by wind-induced dipole noise (except at lower harmonics of fan blade-passage tones) most likely generated at the microphone or microphone support strut. Third-octave band and narrow-band spectra are presented for several fan operating conditions and test-section airspeeds. The background noise levels can be reduced by making improvements to the microphone wind screen or support strut. Empirical equations are presented relating variations of fan noise with fan speed or blade-pitch angle. An empirical expression for typical fan noise spectra is also presented. Fan motor electric power consumption is related to the noise generation. Preliminary measurements of sound absorption by the test-section lining indicate that the 152 mm thick lining will adequately absorb test-section model noise at frequencies above 300 Hz.

  13. Mutagenicity and antimutagenicity of Salacia crassifolia (mart. Ex. Schult. G. Don. evaluated by Ames test

    C. C. Carneiro

    2017-09-01

    Full Text Available Abstract Salacia crassifolia (Mart. Ex. Schult. G. Don. is a bush which belongs to Celastraceae family and occurs specially in Brazilian Cerrado. Its leaves, stem, seeds and fruits are popularly used for several medicinal purposes, such as antitumoral, antirheumatic, anti-inflammatory and antimicrobial. In this study, the mutagenic and antimutagenic activities of S. crassifolia stem bark fractions (hexane, ethyl acetate and hydroalcoholic were evaluated by the Ames mutagenicity assay in Salmonella typhimurium TA98 and TA100 strains. By the obtained results, all S. crassifolia fractions did not significantly increase the number of prototrophic revertants for histidine (His+ in both S. typhimurium strains tested (p > 0.05, suggesting absence of mutagenicity. Regarding antimutagenicity, the fractions ethyl acetate and hydroalcoholic significantly decreased the number of His+ revertants colonies induced by positive control for strain TA98 (p < 0.05, demonstrating protection against mutagenicity induced by 4-nitroquinolile1-oxide, whereas the hexane fraction did not show antimutagenic effect in this strain. In the TA100 strain, all fractions of S. crassifolia protected DNA against the harmful action of sodium azide, and the hexane fraction exhibited the greatest protection in this work. Thus, it’s possible conclude that the fractions of S. crassifolia tested in this study could be used in chemoprevention.

  14. Emission Spectroscopy and Radiometric Measurements in the NASA Ames IHF Arc Jet Facility

    Winter, Michael W.; Raiche, George A.; Prabhu, Dinesh K.

    2012-01-01

    Plasma diagnostic measurement campaigns in the NASA Ames Interaction Heating Facility (IHF) have been conducted over the last several years with a view towards characterizing the flow in the arc jet facility by providing data necessary for modeling and simulation. Optical emission spectroscopy has been used in the plenum and in the free jet of the nozzle. Radiation incident over a probe surface has also been measured using radiometry. Plenum measurements have shown distinct radial profiles of temperature over a range of operating conditions. For cases where large amounts of cold air are added radially to the main arc-heated stream, the temperature profiles are higher by as much as 1500 K than the profiles assumed in flow simulations. Optical measurements perpendicular to the flow direction in the free jet showed significant contributions to the molecule emission through inverse pre-dissociation, thus allowing determination of atom number densities from molecular emission. This has been preliminarily demonstrated with the N2 1st Positive System. Despite the use of older rate coefficients, the resulting atom densities are reasonable and surprisingly close to flow predictions.

  15. Out-of-plane emission of nuclear matter in Au+Au collisions between 100 and 800 AMeV

    Bastid, N.; Buta, A.; Crochet, P.

    1996-01-01

    We present new experimental results concerning the azimuthal distributions of light and intermediate mass fragments at midrapidity for Au (100 - 800 AMeV) +Au collisions measured with the phase I setup of the FOPI detector at GSI in Darmstadt. The azimuthal distributions are investigated as a function of the collision centrality, the incident energy, the fragment charge and transverse momentum. The maximum of the azimuthal anisotropy is obtained for collisions associated with impact parameters around 7 fm. Intermediate mass fragments present a stronger out-of-plane emission signal that light fragments. We show in particular that the azimuthal anisotropy as a function of the scaled fragment transverse momentum follows an universal curve for incident energies ranging from 250 to 800 AMeV. A signature for a transition from in-plane to out-of-plane emission is evidenced at the lowest beam energies. (author)

  16. The Typical Different Features of Grammar of the British English (BrE and American English (AmE

    I Wayan Dirgeyasa

    2016-08-01

    Full Text Available There are a number of varieties of English all over the world such as American, British, Australian, Indian, Singaporean, Philippine English, etc. However, there are only two varieties of English which are most widely and dominantly taught, learned, and used both spoken and printed around the world namely British English (BrE and American English (AmE. In real sense, the two are often confusing for the non-native learners because they have some differences and uniqueness in some aspects such as spelling, pronunciation, vocabulary, and grammar. Therefore, it is really important for students, teachers and speakers as well to be aware of the major differences between the two. This paper is trying to review some striking unique and different features of grammar of British English (BrE and American English (AmE.

  17. Out-of-plane emission of nuclear matter in Au+Au collisions between 100 and 800 AMeV

    Bastid, N.; Buta, A.; Crochet, P. [and others; FOPI Collaboration

    1996-12-31

    We present new experimental results concerning the azimuthal distributions of light and intermediate mass fragments at midrapidity for Au (100 - 800 AMeV) +Au collisions measured with the phase I setup of the FOPI detector at GSI in Darmstadt. The azimuthal distributions are investigated as a function of the collision centrality, the incident energy, the fragment charge and transverse momentum. The maximum of the azimuthal anisotropy is obtained for collisions associated with impact parameters around 7 fm. Intermediate mass fragments present a stronger out-of-plane emission signal that light fragments. We show in particular that the azimuthal anisotropy as a function of the scaled fragment transverse momentum follows an universal curve for incident energies ranging from 250 to 800 AMeV. A signature for a transition from in-plane to out-of-plane emission is evidenced at the lowest beam energies. (author).

  18. Original Research: Metabolic alterations from early life thyroxine replacement therapy in male Ames dwarf mice are transient.

    Darcy, Justin; Fang, Yimin; Hill, Cristal M; McFadden, Sam; Sun, Liou Y; Bartke, Andrzej

    2016-10-01

    Ames dwarf mice are exceptionally long-lived due to a Prop1 loss of function mutation resulting in deficiency of growth hormone, thyroid-stimulating hormone and prolactin. Deficiency in thyroid-stimulating hormone and growth hormone leads to greatly reduced levels of circulating thyroid hormones and insulin-like growth factor 1, as well as a reduction in insulin secretion. Early life growth hormone replacement therapy in Ames dwarf mice significantly shortens their longevity, while early life thyroxine (T4) replacement therapy does not. Possible mechanisms by which early life growth hormone replacement therapy shortens longevity include deleterious effects on glucose homeostasis and energy metabolism, which are long lasting. A mechanism explaining why early life T4 replacement therapy does not shorten longevity remains elusive. Here, we look for a possible explanation as to why early life T4 replacement therapy does not impact longevity of Ames dwarf mice. We found that early life T4 replacement therapy increased body weight and advanced the age of sexual maturation. We also find that early life T4 replacement therapy does not impact glucose tolerance or insulin sensitivity, and any deleterious effects on oxygen consumption, respiratory quotient and heat production are transient. Lastly, we find that early life T4 replacement therapy has long-lasting effects on bone mineral density and bone mineral content. We suggest that the transient effects on energy metabolism and lack of effects on glucose homeostasis are the reasons why there is no shortening of longevity after early life T4 replacement therapy in Ames dwarf mice. © 2016 by the Society for Experimental Biology and Medicine.

  19. A critical review of the life sciences project management at Ames Research Center for the Spacelab Mission development test 3

    Helmreich, R. L.; Wilhelm, J. M.; Tanner, T. A.; Sieber, J. E.; Burgenbauch, S. F.

    1979-01-01

    A management study was initiated by ARC (Ames Research Center) to specify Spacelab Mission Development Test 3 activities and problems. This report documents the problems encountered and provides conclusions and recommendations to project management for current and future ARC life sciences projects. An executive summary of the conclusions and recommendations is provided. The report also addresses broader issues relevant to the conduct of future scientific missions under the constraints imposed by the space environment.

  20. Viking GCMS Data Restoral and Perceiving Temperature on Other Worlds: Astrobiology Projects at NASA Ames

    Guzman, Melissa

    2015-01-01

    The primary task for the summer was to procure the GCMS data from the National Space Science Data Coordinated Archive (NSSDCA) and to assess the current state of the data set for possible reanalysis opportunities. After procurement of the Viking GCMS data set and analysis of its current state, the internship focus shifted to preparing a plan for restoral and archiving of the GCMS data set. A proposal was prepared and submitted to NASA Headquarters to restore and make available the 8000 mass chromatographs that are the basic data generated by the Viking GCMS instrument. The relevance of this restoral and the methodology we propose for restoral is presented. The secondary task for the summer is to develop a thermal model for the perceived temperature of a human standing on Mars, Titan, or Europa. Traditionally, an equation called "Fanger's comfort equation" is used to measure the perceived temperature by a human in a given reference environment. However, there are limitations to this model when applied to other planets. Therefore, the approach for this project has been to derive energy balance equations from first principles and then develop a methodology for correlating "comfort" to energy balance. Using the -20 C walk-in freezer in the Space Sciences building at NASA Ames, energy loss of a human subject is measured. Energy loss for a human being on Mars, Titan and Europa are calculated from first principles. These calculations are compared to the freezer measurements, e.g. for 1 minute on Titan, a human loses as much energy as x minutes in a -20 C freezer. This gives a numerical comparison between the environments. These energy calculations are used to consider the physiological comfort of a human based on the calculated energy losses.

  1. Simulating the Current Water Cycle with the NASA Ames Mars Global Climate Model

    Kahre, M. A.; Haberle, R. M.; Hollingsworth, J. L.; Brecht, A. S.; Urata, R. A.; Montmessin, F.

    2017-12-01

    The water cycle is a critical component of the current Mars climate system, and it is now widely recognized that water ice clouds significantly affect the nature of the simulated water cycle. Two processes are key to implementing clouds in a Mars global climate model (GCM): the microphysical processes of formation and dissipation, and their radiative effects on atmospheric heating/cooling rates. Together, these processes alter the thermal structure, change the atmospheric dynamics, and regulate inter-hemispheric transport. We have made considerable progress using the NASA Ames Mars GCM to simulate the current-day water cycle with radiatively active clouds. Cloud fields from our baseline simulation are in generally good agreement with observations. The predicted seasonal extent and peak IR optical depths are consistent MGS/TES observations. Additionally, the thermal response to the clouds in the aphelion cloud belt (ACB) is generally consistent with observations and other climate model predictions. Notably, there is a distinct gap in the predicted clouds over the North Residual Cap (NRC) during local summer, but the clouds reappear in this simulation over the NRC earlier than the observations indicate. Polar clouds are predicted near the seasonal CO2 ice caps, but the column thicknesses of these clouds are generally too thick compared to observations. Our baseline simulation is dry compared to MGS/TES-observed water vapor abundances, particularly in the tropics and subtropics. These areas of disagreement appear to be a consistent with other current water cycle GCMs. Future avenues of investigation will target improving our understanding of what controls the vertical extent of clouds and the apparent seasonal evolution of cloud particle sizes within the ACB.

  2. MicroRNA regulation in Ames dwarf mouse liver may contribute to delayed aging.

    Bates, David J; Li, Na; Liang, Ruqiang; Sarojini, Harshini; An, Jin; Masternak, Michal M; Bartke, Andrzej; Wang, Eugenia

    2010-02-01

    The Ames dwarf mouse is well known for its remarkable propensity to delay the onset of aging. Although significant advances have been made demonstrating that this aging phenotype results primarily from an endocrine imbalance, the post-transcriptional regulation of gene expression and its impact on longevity remains to be explored. Towards this end, we present the first comprehensive study by microRNA (miRNA) microarray screening to identify dwarf-specific lead miRNAs, and investigate their roles as pivotal molecular regulators directing the long-lived phenotype. Mapping the signature miRNAs to the inversely expressed putative target genes, followed by in situ immunohistochemical staining and in vitro correlation assays, reveals that dwarf mice post-transcriptionally regulate key proteins of intermediate metabolism, most importantly the biosynthetic pathway involving ornithine decarboxylase and spermidine synthase. Functional assays using 3'-untranslated region reporter constructs in co-transfection experiments confirm that miRNA-27a indeed suppresses the expression of both of these proteins, marking them as probable targets of this miRNA in vivo. Moreover, the putative repressed action of this miRNA on ornithine decarboxylase is identified in dwarf mouse liver as early as 2 months of age. Taken together, our results show that among the altered aspects of intermediate metabolism detected in the dwarf mouse liver--glutathione metabolism, the urea cycle and polyamine biosynthesis--miRNA-27a is a key post-transcriptional control. Furthermore, compared to its normal siblings, the dwarf mouse exhibits a head start in regulating these pathways to control their normality, which may ultimately contribute to its extended health-span and longevity.

  3. Multiyear Simulations of the Martian Water Cycle with the Ames General Circulation Model

    Haberle, R. M.; Schaeffer, J. R.; Nelli, S. M.; Murphy, J. R.

    2003-01-01

    Mars atmosphere is carbon dioxide dominated with non-negligible amounts of water vapor and suspended dust particles. The atmospheric dust plays an important role in the heating and cooling of the planet through absorption and emission of radiation. Small dust particles can potentially be carried to great altitudes and affect the temperatures there. Water vapor condensing onto the dust grains can affect the radiative properties of both, as well as their vertical extent. The condensation of water onto a dust grain will change the grain s fall speed and diminish the possibility of dust obtaining high altitudes. In this capacity, water becomes a controlling agent with regard to the vertical distribution of dust. Similarly, the atmosphere s water vapor holding capacity is affected by the amount of dust in the atmosphere. Dust is an excellent green house catalyst; it raises the temperature of the atmosphere, and thus, its water vapor holding capacity. There is, therefore, a potentially significant interplay between the Martian dust and water cycles. Previous research done using global, 3-D computer modeling to better understand the Martian atmosphere treat the dust and the water cycles as two separate and independent processes. The existing Ames numerical model will be employed to simulate the relationship between the Martian dust and water cycles by actually coupling the two cycles. Water will condense onto the dust, allowing the particle's radiative characteristics, fall speeds, and as a result, their vertical distribution to change. Data obtained from the Viking, Mars Pathfinder, and especially the Mars Global Surveyor missions will be used to determine the accuracy of the model results.

  4. The microRNA ame-miR-279a regulates sucrose responsiveness of forager honey bees (Apis mellifera).

    Liu, Fang; Shi, Tengfei; Yin, Wei; Su, Xin; Qi, Lei; Huang, Zachary Y; Zhang, Shaowu; Yu, Linsheng

    2017-11-01

    Increasing evidence demonstrates that microRNAs (miRNA) play an important role in the regulation of animal behaviours. Honey bees (Apis mellifera) are eusocial insects, with honey bee workers displaying age-dependent behavioural maturation. Many different miRNAs have been implicated in the change of behaviours in honey bees and ame-miR-279a was previously shown to be more highly expressed in nurse bee heads than in those of foragers. However, it was not clear whether this difference in expression was associated with age or task performance. Here we show that ame-miR-279a shows significantly higher expression in the brains of nurse bees relative to forager bees regardless of their ages, and that ame-miR-279a is primarily localized in the Kenyon cells of the mushroom body in both foragers and nurses. Overexpression of ame-miR-279a attenuates the sucrose responsiveness of foragers, while its absence enhances their sucrose responsiveness. Lastly, we determined that ame-miR-279a directly target the mRNA of Mblk-1. These findings suggest that ame-miR-279a plays important roles in regulating honey bee division of labour. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. NMDA and kainate receptor expression, long-term potentiation, and neurogenesis in the hippocampus of long-lived Ames dwarf mice.

    Sharma, Sunita; Darland, Diane; Lei, Saobo; Rakoczy, Sharlene; Brown-Borg, Holly M

    2012-06-01

    In the current study, we investigated changes in N-methyl D-aspartate (NMDA) and kainate receptor expression, long-term potentiation (LTP), and neurogenesis in response to neurotoxic stress in long-living Ames dwarf mice. We hypothesized that Ames dwarf mice have enhanced neurogenesis that enables retention of spatial learning and memory with age and promotes neurogenesis in response to injury. Levels of the NMDA receptors (NR)1, NR2A, NR2B, and the kainate receptor (KAR)2 were increased in Ames dwarf mice, relative to wild-type littermates. Quantitative assessment of the excitatory postsynaptic potential in Schaffer collaterals in hippocampal slices from Ames dwarf mice showed an increased response in high-frequency induced LTP over time compared with wild type. Kainic acid (KA) injection was used to promote neurotoxic stress-induced neurogenesis. KA mildly increased the number of doublecortin-positive neurons in wild-type mice, but the response was significantly enhanced in the Ames dwarf mice. Collectively, these data support our hypothesis that the enhanced learning and memory associated with the Ames dwarf mouse may be due to elevated levels of NMDA and KA receptors in hippocampus and their ability to continue producing new neurons in response to neuronal damage.

  6. Long-lived hypopituitary Ames dwarf mice are resistant to the detrimental effects of high-fat diet on metabolic function and energy expenditure.

    Hill, Cristal M; Fang, Yimin; Miquet, Johanna G; Sun, Liou Y; Masternak, Michal M; Bartke, Andrzej

    2016-06-01

    Growth hormone (GH) signaling stimulates the production of IGF-1; however, increased GH signaling may induce insulin resistance and can reduce life expectancy in both mice and humans. Interestingly, disruption of GH signaling by reducing plasma GH levels significantly improves health span and extends lifespan in mice, as observed in Ames dwarf mice. In addition, these mice have increased adiposity, yet are more insulin sensitive compared to control mice. Metabolic stressors such as high-fat diet (HFD) promote obesity and may alter longevity through the GH signaling pathway. Therefore, our objective was to investigate the effects of a HFD (metabolic stressor) on genetic mechanisms that regulate metabolism during aging. We show that Ames dwarf mice fed HFD for 12 weeks had an increase in subcutaneous and visceral adiposity as a result of diet-induced obesity, yet are more insulin sensitive and have higher levels of adiponectin compared to control mice fed HFD. Furthermore, energy expenditure was higher in Ames dwarf mice fed HFD than in control mice fed HFD. Additionally, we show that transplant of epididymal white adipose tissue (eWAT) from Ames dwarf mice fed HFD into control mice fed HFD improves their insulin sensitivity. We conclude that Ames dwarf mice are resistant to the detrimental metabolic effects of HFD and that visceral adipose tissue of Ames dwarf mice improves insulin sensitivity in control mice fed HFD. © 2016 The Authors. Aging Cell published by the Anatomical Society and John Wiley & Sons Ltd.

  7. Recent Progress in Planetary Laboratory Astrophysics achieved with NASA Ames' COSmIC Facility

    Salama, Farid; Sciamma-O'Brien, Ella; Bejaoui, Salma

    2016-10-01

    We describe the characteristics and the capabilities of the laboratory facility, COSmIC, that was developed at NASA Ames to generate, process and analyze interstellar, circumstellar and planetary analogs in the laboratory [1]. COSmIC stands for "Cosmic Simulation Chamber" and is dedicated to the study of neutral and ionized molecules and nanoparticles under the low temperature and high vacuum conditions that are required to simulate various space environments such as planetary atmospheres. COSmIC integrates a variety of state-of-the-art instruments that allow forming, processing and monitoring simulated space conditions for planetary, circumstellar and interstellar materials in the laboratory. The COSmIC experimental setup is composed of a Pulsed Discharge Nozzle (PDN) expansion, that generates a plasma in the stream of a free supersonic jet expansion, coupled to two high-sensitivity, complementary in situ diagnostics: a Cavity Ring Down Spectroscopy (CRDS) and laser induced fluorescence (LIF) systems for photonic detection [2, 3], and a Reflectron Time-Of-Flight Mass Spectrometer (ReTOF-MS) for mass detection [4].Recent results obtained using COSmIC will be highlighted. In particular, the progress that has been achieved in an on-going study investigating the formation and the characterization of laboratory analogs of Titan's aerosols generated from gas-phase molecular precursors [5] will be presented. Plans for future laboratory experiments on planetary molecules and aerosols in the growing field of planetary laboratory astrophysics will also be addressed, as well as the implications of studies underway for astronomical observations.References: [1] Salama F., in Organic Matter in Space, IAU S251, Kwok & Sandford eds, CUP, S251, 4, 357 (2008).[2] Biennier L., Salama, F., Allamandola L., & Scherer J., J. Chem. Phys., 118, 7863 (2003)[3] Tan X, & Salama F., J. Chem. Phys. 122, 84318 (2005)[4] Ricketts C., Contreras C., Walker, R., Salama F., Int. J. Mass Spec, 300

  8. Growth hormone abolishes beneficial effects of calorie restriction in long-lived Ames dwarf mice.

    Gesing, Adam; Al-Regaiey, Khalid A; Bartke, Andrzej; Masternak, Michal M

    2014-10-01

    Disruption of the growth hormone (GH) axis promotes longevity and delays aging. In contrast, GH over-expression may lead to accelerated aging and shorter life. Calorie restriction (CR) improves insulin sensitivity and may extend lifespan. Long-lived Ames dwarf (df/df) mice have additional extension of longevity when subjected to 30% CR. The aim of the study was to assess effects of CR or GH replacement therapy separately and as a combined (CR+GH) treatment in GH-deficient df/df and normal mice, on selected metabolic parameters (e.g., insulin, glucose, cholesterol), insulin signaling components (e.g., insulin receptor [IR] β-subunit, phosphorylated form of IR [IR pY1158], protein kinase C ζ/λ [p-PKCζ/λ] and mTOR [p-mTOR]), transcription factor p-CREB, and components of the mitogen-activated protein kinase (MAPK) signaling (p-ERK1/2, p-p38), responsible for cell proliferation, differentiation and survival. CR decreased plasma levels of insulin, glucose, cholesterol and leptin, and increased hepatic IR β-subunit and IR pY1158 levels as well as IR, IRS-1 and GLUT-2 gene expression compared to ad libitum feeding, showing a significant beneficial diet intervention effect. Moreover, hepatic protein levels of p-PKCζ/λ, p-mTOR and p-p38 decreased, and p-CREB increased in CR mice. On the contrary, GH increased levels of glucose, cholesterol and leptin in plasma, and p-mTOR or p-p38 in livers, and decreased plasma adiponectin and hepatic IR β-subunit compared to saline treatment. There were no GH effects on adiponectin in N mice. Moreover, GH replacement therapy did not affect IR, IRS-1 and GLUT-2 gene expression. GH treatment abolishes the beneficial effects of CR; it may suggest an important role of GH-IGF1 axis in mediating the CR action. Suppressed somatotrophic signaling seems to predominate over GH replacement therapy in the context of the examined parameters and signaling pathways. Copyright © 2014 Elsevier Inc. All rights reserved.

  9. AMEE Guide 32: e-Learning in medical education Part 1: Learning, teaching and assessment.

    Ellaway, Rachel; Masters, Ken

    2008-06-01

    In just a few years, e-learning has become part of the mainstream in medical education. While e-learning means many things to many people, at its heart it is concerned with the educational uses of technology. For the purposes of this guide, we consider the many ways that the information revolution has affected and remediated the practice of healthcare teaching and learning. Deploying new technologies usually introduces tensions, and e-learning is no exception. Some wish to use it merely to perform pre-existing activities more efficiently or faster. Others pursue new ways of thinking and working that the use of such technology affords them. Simultaneously, while education, not technology, is the prime goal (and for healthcare, better patient outcomes), we are also aware that we cannot always predict outcomes. Sometimes, we have to take risks, and 'see what happens.' Serendipity often adds to the excitement of teaching. It certainly adds to the excitement of learning. The use of technology in support of education is not, therefore, a causal or engineered set of practices; rather, it requires creativity and adaptability in response to the specific and changing contexts in which it is used. Medical Education, as with most fields, is grappling with these tensions; the AMEE Guide to e-Learning in Medical Education hopes to help the reader, whether novice or expert, navigate them. This Guide is presented both as an introduction to the novice, and as a resource to more experienced practitioners. It covers a wide range of topics, some in broad outline, and others in more detail. Each section is concluded with a brief 'Take Home Message' which serves as a short summary of the section. The Guide is divided into two parts. The first part introduces the basic concepts of e-learning, e-teaching, and e-assessment, and then focuses on the day-to-day issues of e-learning, looking both at theoretical concepts and practical implementation issues. The second part examines technical

  10. AME survey-003 A1-part 2: the motivation factors of medical doctors in China.

    Wáng, Yì-Xiáng J; Káplár, Zoltán; L, Yáo T

    2015-12-01

    The professional moral and job satisfaction of medical profession remain highly disputed in media in China. On the other hand, there is wide disaffection of patients toward doctors in China. This survey aims to obtain a better understanding of the motivation of Chinese medical professionals. An anonymous online cross-sectional survey, AME survey III, was conducted using the platform provided by DXY (www.dxy.cn) during the period of September 10-23, 2015. In total 2,356 DXY users completed the survey, including 1,740 males and 617 females, with a mean age of 31.96±7.03 yrs. The reasons (multiple choices) for career disaffection included poor patient/doctor relationship (88.6%), imbalance between workload and pay (79.5%), could not enter the preferred specialty (14.14%), and working in small clinics with no career progress (11.17%). If given the choice to enter the specialty as well as the hospital grade of their choice, 73.8% dissatisfied respondents replied they would like to be a doctor. For the dis-satisfied respondents, university teacher appeared to be the most popular career choice. The cited high workload was considered to be due to (I) imbalance in geographical allocation of doctors and insufficient training of doctors; (II) many red-tapism formalities; (III) Chinese patients often have unreasonable requests; (IV) over-examination and over-treatment; (V) high pressure to publish papers. One hundred and twelve respondents have their child/children attending university or graduated from university, 25.0% of them are pursuing a career in medicine. Nine hundred and ninety respondents have child/children while did not reach university age yet, among them 23.62% would like their child/children to study medicine. 64.87% of the 2,356 participants favor China to open up medical market to qualified foreign medical organizations to take part in fair competition, and 57.91% favor the government supporting regulated private hospitals. The moral and motivation of medical

  11. M2-F1 mounted in NASA Ames Research Center 40x80 foot wind tunnel

    1962-01-01

    After the first attempted ground-tow tests of the M2-F1 in March 1963, the vehicle was taken to the Ames Research Center, Mountain View, CA, for wind-tunnel testing. During these tests, Milt Thompson and others were in the M2-F1 to position the control surfaces for each test. The wingless, lifting body aircraft design was initially conceived as a means of landing an aircraft horizontally after atmospheric reentry. The absence of wings would make the extreme heat of re-entry less damaging to the vehicle. In 1962, Dryden management approved a program to build a lightweight, unpowered lifting body as a prototype to flight test the wingless concept. It would look like a 'flying bathtub,' and was designated the M2-F1, the 'M' referring to 'manned' and 'F' referring to 'flight' version. It featured a plywood shell placed over a tubular steel frame crafted at Dryden. Construction was completed in 1963. The first flight tests of the M2-F1 were over Rogers Dry Lake at the end of a tow rope attached to a hopped-up Pontiac convertible driven at speeds up to about 120 mph. This vehicle needed to be able to tow the M2-F1 on the Rogers Dry Lakebed adjacent to NASA's Flight Research Center (FRC) at a minimum speed of 100 miles per hour. To do that, it had to handle the 400-pound pull of the M2-F1. Walter 'Whitey' Whiteside, who was a retired Air Force maintenance officer working in the FRC's Flight Operations Division, was a dirt-bike rider and hot-rodder. Together with Boyden 'Bud' Bearce in the Procurement and Supply Branch of the FRC, Whitey acquired a Pontiac Catalina convertible with the largest engine available. He took the car to Bill Straup's renowned hot-rod shop near Long Beach for modification. With a special gearbox and racing slicks, the Pontiac could tow the 1,000-pound M2-F1 110 miles per hour in 30 seconds. It proved adequate for the roughly 400 car tows that got the M2-F1 airborne to prove it could fly safely and to train pilots before they were towed behind a C

  12. Model Deformation and Optical Angle of Attack Measurement System in the NASA Ames Unitary Plan Wind Tunnel

    Kushner, Laura K.; Drain, Bethany A.; Schairer, Edward T.; Heineck, James T.; Bell, James H.

    2017-01-01

    Both AoA and MDM measurements can be made using an optical system that relies on photogrammetry. Optical measurements are being requested by customers in wind tunnels with increasing frequency due to their non-intrusive nature and recent hardware and software advances that allow measurements to become near real time. The NASA Ames Research Center Unitary Plan Wind Tunnel is currently developing a system based on photogrammetry to measure model deformation and model angle of attack. This paper describes the new system, its development, its use on recent tests and plans to further develop the system.

  13. Experiences with a high-blockage model tested in the NASA Ames 12-foot pressure wind tunnel

    Coder, D. W.

    1984-01-01

    Representation of the flow around full-scale ships was sought in the subsonic wind tunnels in order to a Hain Reynolds numbers as high as possible. As part of the quest to attain the largest possible Reynolds number, large models with high blockage are used which result in significant wall interference effects. Some experiences with such a high blockage model tested in the NASA Ames 12-foot pressure wind tunnel are summarized. The main results of the experiment relating to wind tunnel wall interference effects are also presented.

  14. Critical review of Ames Life Science participation in Spacelab Mission Development Test 3: The SMD 3 management study

    Helmreich, R.; Wilhelm, J.; Tanner, T. A.; Sieber, J. E.; Burgenbauch, S.

    1978-01-01

    A management study was conducted to specify activities and problems encountered during the development of procedures for documentation and crew training on experiments, as well as during the design, integration, and delivery of a life sciences experiment payload to Johnson Space Center for a 7 day simulation of a Spacelab mission. Conclusions and recommendations to project management for current and future Ames' life sciences projects are included. Broader issues relevant to the conduct of future scientific missions under the constraints imposed by the environment of space are also addressed.

  15. Construction of a 2- by 2-foot transonic adaptive-wall test section at the NASA Ames Research Center

    Morgan, Daniel G.; Lee, George

    1986-01-01

    The development of a new production-size, two-dimensional, adaptive-wall test section with ventilated walls at the NASA Ames Research Center is described. The new facility incorporates rapid closed-loop operation, computer/sensor integration, and on-line interference assessment and wall corrections. Air flow through the test section is controlled by a series of plenum compartments and three-way slide vales. A fast-scan laser velocimeter was built to measure velocity boundary conditions for the interference assessment scheme. A 15.2-cm- (6.0-in.-) chord NACA 0012 airfoil model will be used in the first experiments during calibration of the facility.

  16. In vitro mutagenicity assay (Ames test and phytochemical characterization of seeds oil of Helianthus annuus Linné (sunflower

    Nelma de Mello Silva Oliveira

    Full Text Available The objective of this research was to investigate the genotoxic potential of the oil of H. annuus L. (sunflower seeds via the Ames test as well as its oxidative properties and lipid composition. The pre-incubation method, system metabolic activation (S9 fraction and five S. typhimurium strains (TA97, TA98, TA100, TA1535 and TA102 were employed for the Ames test. The oxidative stability and fatty acid composition were analyzed by standard methods and gas chromatography. A revertant analysis showed no significant differences between the treatment doses (10–200 μl/plate and the negative controls, regardless of S9+ and S9−, and included all of the S. typhimurium strains. Chromatographic analysis showed high levels of polyunsaturated fatty acids, followed by monounsaturated, saturated and total trans-isomers. Among the polyunsaturated, monounsaturated and saturated fatty acids, linoleic, oleic and palmitic acids predominated. The results suggest that the sunflower oil is not genotoxic as indicated by frameshift mutations and base pair substitutions regardless of the treatment dose, but shows dose-dependent toxicity. The oxidative properties of the sunflower oil were consistent with the requirements of national and international standards. However, its composition could also indicate phytotherapeutic properties. Keywords: Helianthus annuus L., Sunflower oil, Genetic toxicity, Gas chromatography

  17. Adjoint Method and Predictive Control for 1-D Flow in NASA Ames 11-Foot Transonic Wind Tunnel

    Nguyen, Nhan; Ardema, Mark

    2006-01-01

    This paper describes a modeling method and a new optimal control approach to investigate a Mach number control problem for the NASA Ames 11-Foot Transonic Wind Tunnel. The flow in the wind tunnel is modeled by the 1-D unsteady Euler equations whose boundary conditions prescribe a controlling action by a compressor. The boundary control inputs to the compressor are in turn controlled by a drive motor system and an inlet guide vane system whose dynamics are modeled by ordinary differential equations. The resulting Euler equations are thus coupled to the ordinary differential equations via the boundary conditions. Optimality conditions are established by an adjoint method and are used to develop a model predictive linear-quadratic optimal control for regulating the Mach number due to a test model disturbance during a continuous pitch

  18. Huellas de las religiones tradicionales del África subsahariana en América Latina y el Caribe

    Lazaro Cabrera Thompson

    2008-01-01

    Full Text Available El artículo explora las religiones tradicionales practicadas por los pueblos ewe-mina, ewe-fon, bantú y yoruba del África subsahariana, antes de abordar las formas como estas prácticas religiosas persisten en el “Nuevo Mundo” tras la llegada forzosa de aquellos esclavizados africanos. Con base en la presencia de estas religiones tradicionales africanas en distintos países latinoamericanos y caribeño, se evidencia un conjunto religioso fusionado por historias, mitos, leyendas, danza, música, etc. de ascendencia africana y se hace un llamado a los/ as investigadores/as, que desde América Latina y el Caribe, indagan sobre las religiones tradicionales yoruba, para que franqueen los límites de Nigeria con el fin de abarcar a toda la diáspora yoruba.

  19. Performance of the OVERFLOW-MLP and LAURA-MLP CFD Codes on the NASA Ames 512 CPU Origin System

    Taft, James R.

    2000-01-01

    The shared memory Multi-Level Parallelism (MLP) technique, developed last year at NASA Ames has been very successful in dramatically improving the performance of important NASA CFD codes. This new and very simple parallel programming technique was first inserted into the OVERFLOW production CFD code in FY 1998. The OVERFLOW-MLP code's parallel performance scaled linearly to 256 CPUs on the NASA Ames 256 CPU Origin 2000 system (steger). Overall performance exceeded 20.1 GFLOP/s, or about 4.5x the performance of a dedicated 16 CPU C90 system. All of this was achieved without any major modification to the original vector based code. The OVERFLOW-MLP code is now in production on the inhouse Origin systems as well as being used offsite at commercial aerospace companies. Partially as a result of this work, NASA Ames has purchased a new 512 CPU Origin 2000 system to further test the limits of parallel performance for NASA codes of interest. This paper presents the performance obtained from the latest optimization efforts on this machine for the LAURA-MLP and OVERFLOW-MLP codes. The Langley Aerothermodynamics Upwind Relaxation Algorithm (LAURA) code is a key simulation tool in the development of the next generation shuttle, interplanetary reentry vehicles, and nearly all "X" plane development. This code sustains about 4-5 GFLOP/s on a dedicated 16 CPU C90. At this rate, expected workloads would require over 100 C90 CPU years of computing over the next few calendar years. It is not feasible to expect that this would be affordable or available to the user community. Dramatic performance gains on cheaper systems are needed. This code is expected to be perhaps the largest consumer of NASA Ames compute cycles per run in the coming year.The OVERFLOW CFD code is extensively used in the government and commercial aerospace communities to evaluate new aircraft designs. It is one of the largest consumers of NASA supercomputing cycles and large simulations of highly resolved full

  20. Genotoxic, Cytotoxic, Antigenotoxic, and Anticytotoxic Effects of Sulfonamide Chalcone Using the Ames Test and the Mouse Bone Marrow Micronucleus Test.

    Carolina Ribeiro E Silva

    Full Text Available Chalcones present several biological activities and sulfonamide chalcone derivatives have shown important biological applications, including antitumor activity. In this study, genotoxic, cytotoxic, antigenotoxic, and anticytotoxic activities of the sulfonamide chalcone N-{4-[3-(4-nitrophenylprop-2-enoyl]phenyl} benzenesulfonamide (CPN were assessed using the Salmonella typhimurium reverse mutation test (Ames test and the mouse bone marrow micronucleus test. The results showed that CPN caused a small increase in the number of histidine revertant colonies in S. typhimurium strains TA98 and TA100, but not statistically significant (p > 0.05. The antimutagenicity test showed that CPN significantly decreased the number of His+ revertants in strain TA98 at all doses tested (p 0.05. Additionally, CPN co-administered with MMC significantly increased PCE/NCE ratio at all doses tested, demonstrating its anticytotoxic effect. In summary, CPN presented genotoxic, cytotoxic, antigenotoxic, and anticytotoxic properties.

  1. AMES, NESC and ENIQ: European networks in the field of structural integrity involving NDE and inspection effectiveness assessment

    Crutzen, S.; Hurst, R.; Debarberis, L.; Lemaitre, P.; Eriksen, B.

    1999-01-01

    Three European networks on structural integrity aspects of ageing nuclear components are presently managed by the Institute for Advanced Materials of the Joint Research Centre of the European Commission: AMES (Ageing Materials Evaluation and Studies), ENIQ (European Network for Inspection Qualification) and NESC (Network for Evaluating Steel Components). All three networks involve actions, which aim at the effectiveness and reliability assessment of NDE techniques and of inspection procedures: Either for materials damage detection and characterisation or for defect detection and evaluation. This paper is describing very generally the objectives of the three networks and is then concentrating on the results obtained in ENIQ, which are relevant with ISI and regulatory issues. (orig./DGE)

  2. Comparative mutability of the Ames tester strains of Salmonella typhimurium by ultraviolet radiation and by 4-nitroquinoline I-oxide

    Nakano, E.; Ichikawa-Ryo, H.; Kondo, S.

    1982-01-01

    A standard method for determining mutant frequencies per survivor was used to study the detailed kinetics of reverse mutations of Ames tester strains of Salmonella typhimurium induced by UV and by 4NQO. After UV irradiation, strain TA1538 was non-mutable, but its plasmid-containing derivative TA98 was mutable, whereas TA1535 was mutable and its plasmid-bearing derivative TA100 was about 10-fold more mutable. After treatment with 4NQO, TA98 was less mutable than TA1538, whereas TA100 was more mutable than TA1535 by a factor of 10-50. TA1537 was slightly less mutable than TA1535 by either UV or 4NQO. The differential mutabilities of these strains are briefly discussed in relation to the 'hot spot' base sequences for reversion and the nature of DNA damage caused by UV and 4NQO. (orig.)

  3. The effects of alcohol mixed with energy drink (AMED) on subjective intoxication and alertness : results from a double-blind placebo-controlled clinical trial

    van de Loo, Aurora J A E; van Andel, Nienke; van Gelder, Charlotte A G H; Janssen, Boris S G; Titulaer, Joep; Jansen, Jimmy; Verster, Joris C

    2016-01-01

    OBJECTIVE: The purpose of this double blind placebo controlled study was to examine if specific effects on subjective intoxication and alertness-sleepiness ratings could be demonstrated after consuming alcohol mixed with energy drink (AMED) when compared to consuming alcohol only (AO). METHODS: 56

  4. Desarrollo y productividad de ñame (Dioscorea trifida y Dioscorea esculenta en diferentes condiciones hídricas

    Alba Nelly Acevedo Mercado

    2015-01-01

    Full Text Available En la región Montes de María (9° 24' 56,33" N y 75° 23' 04,19" O, departamento de Sucre, Colombia, en zonas de clima cálido (26 °C y 30 °C y de clima medio (20 °C y 24 °C, humedad relativa entre 75 y 85% y precipitación de 750 mm durante el ensayo se estudió el efecto del riego en el desarrollo y productividad de dos especies de ñame en peligro de extinción (Dioscorea trifida y Dioscorea esculenta en un diseño experimental de parcelas subdivididas, donde las variables fueron tres condiciones hídricas: riego de 888 mm durante la etapa crítica del cultivo, riego de 944 mm durante todo el ciclo del cultivo, y ausencia de riego con una oferta de agua de 750 mm provenientes de precipitación. La densidad de siembra fue de 10,000 plantas/ha, labranza tradicional con arado de discos y cosecha 8 meses después de la siembra. Como variables se midieron rendimiento de ñame, contenido de almidón, longitud y diámetro de tubérculos y biomasa aérea. Dioscorea trifida presentó un rendimiento promedio de 30.6 t/ha y D. esculenta de 27 t/ha, con contenidos de almidón de 21.3 y 21.6% en base húmeda, respectivamente; la longitud promedio de tubérculos para D. trifida fue de 17.4 cm y para D. esculenta de 11.4 cm; los diámetros promedio fueron 14.4 cm y 10.5 cm y la biomasa aérea 1.1 kg/planta y 0.67 kg/planta, respectivamente. La aplicación de riego al cultivo produjo un incremento en la producción con respecto al cultivo sin riego, para Dioscorea trifida este incremento fue de 78.9% y para Dioscorea esculenta de 92.9%.

  5. Quantitative assessment of the dose-response of alkylating agents in DNA repair proficient and deficient ames tester strains.

    Tang, Leilei; Guérard, Melanie; Zeller, Andreas

    2014-01-01

    Mutagenic and clastogenic effects of some DNA damaging agents such as methyl methanesulfonate (MMS) and ethyl methanesulfonate (EMS) have been demonstrated to exhibit a nonlinear or even "thresholded" dose-response in vitro and in vivo. DNA repair seems to be mainly responsible for these thresholds. To this end, we assessed several mutagenic alkylators in the Ames test with four different strains of Salmonella typhimurium: the alkyl transferases proficient strain TA1535 (Ogt+/Ada+), as well as the alkyl transferases deficient strains YG7100 (Ogt+/Ada-), YG7104 (Ogt-/Ada+) and YG7108 (Ogt-/Ada-). The known genotoxins EMS, MMS, temozolomide (TMZ), ethylnitrosourea (ENU) and methylnitrosourea (MNU) were tested in as many as 22 concentration levels. Dose-response curves were statistically fitted by the PROAST benchmark dose model and the Lutz-Lutz "hockeystick" model. These dose-response curves suggest efficient DNA-repair for lesions inflicted by all agents in strain TA1535. In the absence of Ogt, Ada is predominantly repairing methylations but not ethylations. It is concluded that the capacity of alkyl-transferases to successfully repair DNA lesions up to certain dose levels contributes to genotoxicity thresholds. Copyright © 2013 Wiley Periodicals, Inc.

  6. Metabolic adaptations to short-term every-other-day feeding in long-living Ames dwarf mice.

    Brown-Borg, Holly M; Rakoczy, Sharlene

    2013-09-01

    Restrictive dietary interventions exert significant beneficial physiological effects in terms of aging and age-related disease in many species. Every other day feeding (EOD) has been utilized in aging research and shown to mimic many of the positive outcomes consequent with dietary restriction. This study employed long living Ames dwarf mice subjected to EOD feeding to examine the adaptations of the oxidative phosphorylation and antioxidative defense systems to this feeding regimen. Every other day feeding lowered liver glutathione (GSH) concentrations in dwarf and wild type (WT) mice but altered GSH biosynthesis and degradation in WT mice only. The activities of liver OXPHOS enzymes and corresponding proteins declined in WT mice fed EOD while in dwarf animals, the levels were maintained or increased with this feeding regimen. Antioxidative enzymes were differentially affected depending on the tissue, whether proliferative or post-mitotic. Gene expression of components of liver methionine metabolism remained elevated in dwarf mice when compared to WT mice as previously reported however, enzymes responsible for recycling homocysteine to methionine were elevated in both genotypes in response to EOD feeding. The data suggest that the differences in anabolic hormone levels likely affect the sensitivity of long living and control mice to this dietary regimen, with dwarf mice exhibiting fewer responses in comparison to WT mice. These results provide further evidence that dwarf mice may be better protected against metabolic and environmental perturbations which may in turn, contribute to their extended longevity. © 2013.

  7. Simulation of Shuttle launch G forces and acoustic loads using the NASA Ames Research Center 20G centrifuge

    Shaw, T. L.; Corliss, J. M.; Gundo, D. P.; Mulenburg, G. M.; Breit, G. A.; Griffith, J. B.

    1994-01-01

    The high cost and long times required to develop research packages for space flight can often be offset by using ground test techniques. This paper describes a space shuttle launch and reentry simulating using the NASA Ames Research Center's 20G centrifuge facility. The combined G-forces and acoustic environment during shuttle launch and landing were simulated to evaluate the effect on a payload of laboratory rates. The launch G force and acoustic profiles are matched to actual shuttle launch data to produce the required G-forces and acoustic spectrum in the centrifuge test cab where the rats were caged on a free-swinging platform. For reentry, only G force is simulated as the aero-acoustic noise is insignificant compared to that during launch. The shuttle G-force profiles of launch and landing are achieved by programming the centrifuge drive computer to continuously adjust centrifuge rotational speed to obtain the correct launch and landing G forces. The shuttle launch acoustic environment is simulated using a high-power, low-frequency audio system. Accelerometer data from STS-56 and microphone data from STS-1 through STS-5 are used as baselines for the simulations. This paper provides a description of the test setup and the results of the simulation with recommendations for follow-on simulations.

  8. Measurement of isotopic cross sections of the fission fragments produced in 500 AMeV 208Pb + p reaction

    Fernandez-Dominguez, B.

    2003-03-01

    The aim of this work is the study of the fission fragments produced in the spallation reaction 208 Pb + p at 500 AMeV. The fission fragments from Z=23 up to Z=59 have been detected and identified by using the inverse kinematics technique with the high-resolution spectrometer FRS. The production cross sections and the recoil velocities of 430 nuclei have been measured. The measured data have been compared with previous data. The isotopic distributions show a high precision. However, the absolute value of the fission cross section is higher than expected. From the experimental data the characteristics of the average fissioning system have been reconstructed (Z fis , A fis , E* fis ). In addition, the number of post-fission neutrons emitted from the fission fragments, v post , has been determined by using a new method. The experimental data have been compared to the two-steps models describing the spallation reaction. The impact of the model parameters on the observables has been analysed and the reasons Leading to the observed differences between the codes are also presented. This analyse shows a good agreement with the INCL4+ABLA code. (author)

  9. Prevalência de práticas educativas acerca do aleitamento materno exclusivo (AME em Cuiabá - MT

    Luma Natalia Barbosa

    2015-03-01

    Full Text Available Objetivo: Descrever a prevalência das práticas educativas em saúde sobre o aleitamento materno exclusivo (AME no Município de Cuiabá - MT nos meses de julho a dezembro de 2012. Métodos: Trata-se de um estudo descritivo transversal, realizado junto a mulheres internadas em um hospital. A amostra foi composta por 306 mulheres no período pós-parto imediato. Os dados foram coletados por meio de um questionário semiestruturado. Resultados: Ter oito anos ou mais de estudo (RP = 1,77; ter renda até dois salários mínimos (RP = 1,22; ter planejado a gravidez (RP = 1,31; ter iniciado o atendimento no serviço de pré-natal no primeiro trimestre (RP = 1,65 e serem primíparas (RP = 1,21 são características que aparecem associadas com uma maior chance de receber orientações sobre aleitamento materno do que as demais mulheres. Conclusão: Faz-se necessário repensar mudanças dessas práticas, a fim de se realizar ações educativas que busquem efetivar transformações na relação profissional/usuário, visando o acolhimento das gestantes.

  10. Building bridges between theory and practice in medical education using a design-based research approach: AMEE Guide No. 60.

    Dolmans, Diana H J M; Tigelaar, D

    2012-01-01

    Medical education research has grown enormously over the past 20 years, but it does not sufficiently make use of theories, according to influential leaders and researchers in this field. In this AMEE Guide, it is argued that design-based research (DBR) studies should be conducted much more in medical education design research because these studies both advance the testing and refinement of theories and advance educational practice. In this Guide, the essential characteristics of DBR as well as how DBR differs from other approach such as formative evaluation are explained. It is also explained what the pitfalls and challenges of DBR are. The main challenges deal with how to insure that DBR studies reveal findings that are of a broader relevance than the local situation and how to insure that DBR contributes toward theory testing and refinement. An example of a series of DBR studies on the design of a teaching portfolio in higher education that is aimed at stimulating a teacher's professional development is described, to illustrate how DBR studies actually work in practice. Finally, it is argued that DBR-studies could play an important role in the advancement of theory and practice in the two broad domains of designing or redesigning work-based learning environments and assessment programs.

  11. Report of the Interagency Optical Network Testbeds Workshop 2, NASA Ames Research Center, September 12-14, 2005

    2005-01-01

    The Optical Network Testbeds Workshop 2 (ONT2), held on September 12-14, 2005, was cosponsored by the Department of Energy Office of Science (DOE/SC) and the National Aeronautics and Space Administration (NASA), in cooperation with the Joint Engineering Team (JET) of the Federal Networking and Information Technology Research and Development (NITRD) Program's Large Scale Networking (LSN) Coordinating Group. The ONT2 workshop was a follow-on to an August 2004 Workshop on Optical Network Testbeds (ONT1). ONT1 recommended actions by the Federal agencies to assure timely development and implementation of optical networking technologies and infrastructure. Hosted by the NASA Ames Research Center in Mountain View, California, the ONT2 workshop brought together representatives of the U.S. advanced research and education (R&E) networks, regional optical networks (RONs), service providers, international networking organizations, and senior engineering and R&D managers from Federal agencies and national research laboratories. Its purpose was to develop a common vision of the optical network technologies, services, infrastructure, and organizations needed to enable widespread use of optical networks; recommend activities for transitioning the optical networking research community and its current infrastructure to leading-edge optical networks over the next three to five years; and present information enabling commercial network infrastructure providers to plan for and use leading-edge optical network services in that time frame.

  12. Environmental Assessment for US Department of Energy support of an Iowa State University Linear Accelerator Facility at Ames, Iowa

    1990-05-01

    The proposed Department of Energy (DOE) action is financial and technical support of construction and initial operation of an agricultural commodity irradiator (principally for meat), employing a dual mode electron beam generator capable of producing x-rays, at the Iowa State University Linear Accelerator located at Ames, Iowa. The planned pilot commercial-scale facility would be used for the following activities: conducting irradiation research on agricultural commodities, principally meats; in the future, after the pilot phase, as schedules permit, possibly conducting research on other, non-edible materials; evaluating effects of irradiation on nutritional and sensory quality of agricultural products; demonstrating the efficiency of the process to control or eliminate pathogens, and/or to prolong the commodities' post-harvest shelf-life via control or elimination of bacteria, fungi, and/or insects; providing information to the public on the benefits, safety and risks of irradiated agricultural commodities; determining consumer acceptability of the irradiated products; providing data for use by regulatory agencies in developing protocols for various treatments of Iowa agricultural commodities; and training operators, maintenance and quality control technicians, scientists, engineers, and staff of regulatory agencies in agricultural commodity irradiation technology. 14 refs., 5 figs.

  13. Evaluation of Different Methods for Identification of Structural Alerts Using Chemical Ames Mutagenicity Data Set as a Benchmark.

    Yang, Hongbin; Li, Jie; Wu, Zengrui; Li, Weihua; Liu, Guixia; Tang, Yun

    2017-06-19

    Identification of structural alerts for toxicity is useful in drug discovery and other fields such as environmental protection. With structural alerts, researchers can quickly identify potential toxic compounds and learn how to modify them. Hence, it is important to determine structural alerts from a large number of compounds quickly and accurately. There are already many methods reported for identification of structural alerts. However, how to evaluate those methods is a problem. In this paper, we tried to evaluate four of the methods for monosubstructure identification with three indices including accuracy rate, coverage rate, and information gain to compare their advantages and disadvantages. The Kazius' Ames mutagenicity data set was used as the benchmark, and the four methods were MoSS (graph-based), SARpy (fragment-based), and two fingerprint-based methods including Bioalerts and the fingerprint (FP) method we previously used. The results showed that Bioalerts and FP could detect key substructures with high accuracy and coverage rates because they allowed unclosed rings and wildcard atom or bond types. However, they also resulted in redundancy so that their predictive performance was not as good as that of SARpy. SARpy was competitive in predictive performance in both training set and external validation set. These results might be helpful for users to select appropriate methods and further development of methods for identification of structural alerts.

  14. Exploring reaction mechanisms and their competition in 58Ni+48Ca collisions at E = 25 AMeV

    Francalanza L.

    2014-03-01

    Full Text Available Latest results concerning the study of central collisions in 58Ni+48Ca reactions at Elab(Ni=25 AMeV are presented. The experimental data, collected with the CHIMERA 4π device, have been analyzed in order to investigate the competition among different reaction mechanisms for central collisions in the Fermi energy domain. The method adopted to perform the centrality selection refers to the global variable “flow angle”, that is related to the event shape in momentum space, as it is determined by the eigenvectors of the experimental kinetic-energy tensor. The main features of the reaction products were explored by using different constraints on some of the relevant observables, such as mass and velocity distributions and their correlations. Much emphasis was devoted to the competition between fusion-evaporation processes with subsequent identification of a heavy residue and a prompt multifragmentation mechanism. The reaction mechanism was simulated in the framework of transport theories (dynamical stochastic BNV calculations, followed by sequential SIMON code and further comparison with dynamical calculations from transport model (QMD, CoMD are in progress. Moreover, an extension of this study taking into account for the light particles has been envisaged.

  15. Communication skills: an essential component of medical curricula. Part I: Assessment of clinical communication: AMEE Guide No. 51.

    Laidlaw, Anita; Hart, Jo

    2011-01-01

    This AMEE Guide in Medical Education is Part 1 of a two part Guide covering the issues of Communication. This Guide has been written to provide guidance for those involved in planning the assessment of clinical communication and provides guidance and information relating to the assessment of various aspects of clinical communication; its underlying theory; its practical ability to show that an individual is competent and its relationship to students' daily performance. The advantages and disadvantages of assessing specific aspects of communication are also discussed. The Guide draws attention to the complexity of assessing the ability to communicate with patients and healthcare professionals, with issues of reliability and validity being highlighted for each aspect. Current debates within the area of clinical communication teaching are raised: when should the assessment of clinical communication occur in undergraduate medical education?; should clinical communication assessment be integrated with clinical skills assessment, or should the two be separate?; how important should the assessment of clinical communication be, and the question of possible failure of students if they are judged not competent in communication skills? It is the aim of the authors not only to provide a useful reference for those starting to develop their assessment processes, but also provide an opportunity for review and debate amongst those who already assess clinical communication within their curricula, and a resource for those who have a general interest in medical education who wish to learn more about communication skills assessment.

  16. Prophage induction, mutagenesis, and cell survival of Ames' mutagen tester strains after 8-methoxypsoralen plus ultraviolet light-A

    Wheeler, L.A.; DeMeo, M. (California Univ., Los Angeles (USA)); Lowe, N. (Combined UCLA-WADSWORTH Dermatology Program, Los Angeles, CA (USA))

    1983-10-01

    8-methoxypsoralen (8-MOP) is not detected as a mutagen in the standard Ames test either in the presence or absence of S9-mix and/or ultraviolet light-A (320-400 nm). The Ames strains have been shown to harbor bacteriophages that are inducible by carcinogens and mutagens. Psoralen plus UVA (PUVA) was found to be a potent prophage inducing treatment. Induction was observed in TA1535, TA1538, TA98, TA100, TA1978 and TA1975 with 8-MOP and UVA. PUVA is a potent bactericidal treatment at concentrations of 8-MOP above 0.5 ..mu..g/ml and 2.5 kJ/m/sup 2/ in tester strains TA1535, TA1538, TA98 and TA100. PUVA is known to be bactericidal, but the cytotoxicity observed in the present study was unique in that the frameshift tester strains (TA1538 and TA98) were more sensitive to the lethal effects of PUVA than the base pair tester strains (TA1535 and TA100). The differential cytotoxicity in such closely related strains led to the examination of some of the strains from which the Ames strains were derived. It is postulated that TA1535 retains a DNA repair function that is lost by TA1538 during the selection for uvrB deficient strains.

  17. Prevention of neuromusculoskeletal frailty in slow-aging ames dwarf mice: longitudinal investigation of interaction of longevity genes and caloric restriction.

    Oge Arum

    Full Text Available Ames dwarf (Prop1 (df/df mice are remarkably long-lived and exhibit many characteristics of delayed aging and extended healthspan. Caloric restriction (CR has similar effects on healthspan and lifespan, and causes an extension of longevity in Ames dwarf mice. Our study objective was to determine whether Ames dwarfism or CR influence neuromusculoskeletal function in middle-aged (82 ± 12 weeks old or old (128 ± 14 w.o. mice. At the examined ages, strength was improved by dwarfism, CR, and dwarfism plus CR in male mice; balance/ motor coordination was improved by CR in old animals and in middle-aged females; and agility/ motor coordination was improved by a combination of dwarfism and CR in both genders of middle-aged mice and in old females. Therefore, extension of longevity by congenital hypopituitarism is associated with improved maintenance of the examined measures of strength, agility, and motor coordination, key elements of frailty during human aging, into advanced age. This study serves as a particularly important example of knowledge related to addressing aging-associated diseases and disorders that results from studies in long-lived mammals.

  18. Prevention of neuromusculoskeletal frailty in slow-aging ames dwarf mice: longitudinal investigation of interaction of longevity genes and caloric restriction.

    Arum, Oge; Rasche, Zachary Andrew; Rickman, Dustin John; Bartke, Andrzej

    2013-01-01

    Ames dwarf (Prop1 (df/df) ) mice are remarkably long-lived and exhibit many characteristics of delayed aging and extended healthspan. Caloric restriction (CR) has similar effects on healthspan and lifespan, and causes an extension of longevity in Ames dwarf mice. Our study objective was to determine whether Ames dwarfism or CR influence neuromusculoskeletal function in middle-aged (82 ± 12 weeks old) or old (128 ± 14 w.o.) mice. At the examined ages, strength was improved by dwarfism, CR, and dwarfism plus CR in male mice; balance/ motor coordination was improved by CR in old animals and in middle-aged females; and agility/ motor coordination was improved by a combination of dwarfism and CR in both genders of middle-aged mice and in old females. Therefore, extension of longevity by congenital hypopituitarism is associated with improved maintenance of the examined measures of strength, agility, and motor coordination, key elements of frailty during human aging, into advanced age. This study serves as a particularly important example of knowledge related to addressing aging-associated diseases and disorders that results from studies in long-lived mammals.

  19. THE NASA AMES PAH IR SPECTROSCOPIC DATABASE VERSION 2.00: UPDATED CONTENT, WEB SITE, AND ON(OFF)LINE TOOLS

    Boersma, C.; Mattioda, A. L.; Allamandola, L. J. [NASA Ames Research Center, MS 245-6, Moffett Field, CA 94035 (United States); Bauschlicher, C. W. Jr.; Ricca, A. [NASA Ames Research Center, MS 230-3, Moffett Field, CA 94035 (United States); Cami, J.; Peeters, E.; De Armas, F. Sánchez; Saborido, G. Puerta [SETI Institute, 189 Bernardo Avenue 100, Mountain View, CA 94043 (United States); Hudgins, D. M., E-mail: Christiaan.Boersma@nasa.gov [NASA Headquarters, MS 3Y28, 300 E St. SW, Washington, DC 20546 (United States)

    2014-03-01

    A significantly updated version of the NASA Ames PAH IR Spectroscopic Database, the first major revision since its release in 2010, is presented. The current version, version 2.00, contains 700 computational and 75 experimental spectra compared, respectively, with 583 and 60 in the initial release. The spectra span the 2.5-4000 μm (4000-2.5 cm{sup -1}) range. New tools are available on the site that allow one to analyze spectra in the database and compare them with imported astronomical spectra as well as a suite of IDL object classes (a collection of programs utilizing IDL's object-oriented programming capabilities) that permit offline analysis called the AmesPAHdbIDLSuite. Most noteworthy among the additions are the extension of the computational spectroscopic database to include a number of significantly larger polycyclic aromatic hydrocarbons (PAHs), the ability to visualize the molecular atomic motions corresponding to each vibrational mode, and a new tool that allows one to perform a non-negative least-squares fit of an imported astronomical spectrum with PAH spectra in the computational database. Finally, a methodology is described in the Appendix, and implemented using the AmesPAHdbIDLSuite, that allows the user to enforce charge balance during the fitting procedure.

  20. Post-examination interpretation of objective test data: monitoring and improving the quality of high-stakes examinations--a commentary on two AMEE Guides.

    Tavakol, Mohsen; Dennick, Reg

    2012-01-01

    As great emphasis is rightly placed upon the importance of assessment to judge the quality of our future healthcare professionals, it is appropriate not only to choose the most appropriate assessment method, but to continually monitor the quality of the tests themselves, in a hope that we may continually improve the process. This article stresses the importance of quality control mechanisms in the exam cycle and briefly outlines some of the key psychometric concepts including reliability measures, factor analysis, generalisability theory and item response theory. The importance of such analyses for the standard setting procedures is emphasised. This article also accompanies two new AMEE Guides in Medical Education (Tavakol M, Dennick R. Post-examination Analysis of Objective Tests: AMEE Guide No. 54 and Tavakol M, Dennick R. 2012. Post examination analysis of objective test data: Monitoring and improving the quality of high stakes examinations: AMEE Guide No. 66) which provide the reader with practical examples of analysis and interpretation, in order to help develop valid and reliable tests.

  1. Current Background Noise Sources and Levels in the NASA Ames 40- by 80-Foot Wind Tunnel: A Status Report

    Allen, Christopher S.; Jaeger, Stephen; Soderman, Paul; Koga, Dennis (Technical Monitor)

    1999-01-01

    Background noise measurements were made of the acoustic environment in the National Full-Scale Aerodynamics Complex 40- by 80-Foot Wind Tunnel (40x80) at NASA Ames Research Center. The measurements were acquired subsequent to the 40x80 Aeroacoustic Modernization Project, which was undertaken to improve the anechoic characteristics of the 40x80's closed test section as well as reduce the levels of background noise in the facility. The resulting 40x80 anechoic environment was described by Soderman et. al., and the current paper describes the resulting 40x80 background noise, discusses the sources of the noise, and draws comparisons to previous 40x80 background noise levels measurements. At low wind speeds or low frequencies, the 40x80 background noise is dominated by the fan drive system. To obtain the lowest fan drive noise for a given tunnel condition, it is possible in the 40x80 to reduce the fans' rotational speed and adjust the fans' blade pitch, as described by Schmidtz et. al. This idea is not new, but has now been operationally implemented with modifications for increased power at low rotational speeds. At low to mid-frequencies and at higher wind speeds, the dominant noise mechanism was thought to be caused by the surface interface of the previous test section floor acoustic lining. In order to reduce this noise mechanism, the new test section floor lining was designed to resist the pumping of flow in and out of the space between the grating slats required to support heavy equipment. In addition, the lining/flow interface over the entire test section was designed to be smoother and quieter than the previous design. At high wind speeds or high frequencies, the dominant source of background noise in the 40x80 is believed to be caused by the response of the in-flow microphone probes (required by the nature of the closed test section) to the fluctuations in the freestream flow. The resulting background noise levels are also different for probes of various

  2. Developing the Infrared PAH Emission Bands Into Calibrated Probes of Astrophysical Conditions with The NASA Ames PAH IR Spectroscopic Database

    Boersma, Christiaan

    We propose to quantitatively calibrate the PAH band strength ratios that have been traditionally used as qualitative proxies of PAH properties and linking PAH observables with local astrophysical conditions, thus developing PAHs into quantitative probes of astronomical environments. This will culminate in a toolbox (calibration charts) that can be used by PAH experts and non-PAH experts alike to unlock the information hidden in PAH emission sources that are part of the Spitzer and ISO archives. Furthermore, the proposed work is critical to mine the treasure trove of information JWST will return as it will capture, for the first time, the complete mid-infrared (IR) PAH spectrum with fully resolved features, through a single aperture, and along single lines-of-sight; making it possible to fully extract the information contained in the PAH spectra. In short, the work proposed here represents a major step in enabling the astronomical PAH model to reach its full potential as a diagnostic of the physical and chemical conditions in objects spanning the Universe. Polycyclic aromatic hydrocarbons (PAHs), a common and important reservoir of accessible carbon across the Universe, play an intrinsic part in the formation of stars, planets and possibly even life itself. While most PAH spectra appear quite similar, they differ in detail and contain a wealth of untapped information. Thanks to recent advances in laboratory studies and computer-based calculations of PAH spectra, the majority of which have been made at NASA Ames, coupled with the astronomical modeling tools we have developed, we can interpret the spectral details at levels never before possible. This enables us to extract local physical conditions and track subtle changes in these conditions at levels previously impossible. Building upon the tools and paradigms developed as part of the publicly available NASA Ames PAH IR Spectroscopic Database (PAHdb; www.astrochem.org/pahdb/), the purpose of our proposed research is

  3. Piloted Evaluation of Modernized Limited Authority Control Laws in the NASA-Ames Vertical Motion Simulator (VMS)

    Sahasrabudhe, Vineet; Melkers, Edgar; Faynberg, Alexander; Blanken, Chris L.

    2003-01-01

    The UH-60 BLACK HAWK was designed in the 1970s, when the US Army primarily operated during the day in good visual conditions. Subsequently, the introduction of night-vision goggles increased the BLACK HAWK'S mission effectiveness, but the accident rate also increased. The increased accident rate is strongly tied to increased pilot workload as a result of a degradation in visual cues. Over twenty years of research in helicopter flight control and handling qualities has shown that these degraded handling qualities can be recovered by modifying the response type of the helicopter in low speed flight. Sikorsky Aircraft Corporation initiated a project under the National Rotorcraft Technology Center (NRTC) to develop modern flight control laws while utilizing the existing partial authority Stability Augmentation System (SAS) of the BLACK HAWK. This effort resulted in a set of Modernized Control Laws (MCLAWS) that incorporate rate command and attitude command response types. Sikorsky and the US Army Aeroflightdynamics Directorate (AFDD) conducted a piloted simulation on the NASA-Ames Vertical h4otion Simulator, to assess potential handling qualities and to reduce the risk of subsequent implementation and flight test of these modern control laws on AFDD's EH-60L helicopter. The simulation showed that Attitude Command Attitude Hold control laws in pitch and roll improve handling qualities in the low speed flight regime. These improvements are consistent across a range of mission task elements and for both good and degraded visual environments. The MCLAWS perform better than the baseline UH-60A control laws in the presence of wind and turbulence. Finally, while the improved handling qualities in the pitch and roll axis allow the pilot to pay more attention to the vertical axis and hence altitude performance also improves, it is clear from pilot comments and altitude excursions that the addition of an Altitude Hold function would further reduce workload and improve overall

  4. Extreme testing of undiluted e-cigarette aerosol in vitro using an Ames air-agar-interface technique.

    Thorne, D; Hollings, M; Seymour, A; Adamson, J; Dalrymple, A; Ballantyne, M; Gaca, M

    2018-04-01

    There is a growing consensus that e-cigarettes hold the potential for reducing the harm associated with cigarette smoking. Recently published studies have reported in vitro testing of e-cigarettes, demonstrating reduced toxicological and biological effects. Few studies however have reported the use of e-cigarettes under extreme testing conditions. To assess the full mutagenic potential of a commercially available electronic-cigarette (Vype ePen), this study investigated the delivery of aerosol under extreme conditions, using a scaled-down 35 mm plate Ames bacterial reverse mutagenicity assay. S. typhimurium strains TA98, TA100, TA97, TA104 and E. coli WP2 uvrA pKM101 with or without metabolic activation (S9), were employed. Using a modified Vitrocell VC 10 exposure system 0, 180, 360, 540, 720 or 900 puffs of undiluted e-cigarette aerosol was generated and delivered to bacterial cultures aligned to reported human consumption data. The results demonstrate that no mutagenic activity was observed in any strain under any test condition even when exposed to 900 puffs of undiluted e-cigarette aerosols +/- S9. Positive control responses were observed in all strains +/- S9. Nicotine assessments demonstrated an increased and consistent aerosol delivery, with calculated maximum doses of ∼1 mg/mL delivery of nicotine. These data demonstrate the validity of this unique testing approach and adds further information to the growing weight of evidence that e-cigarettes offer substantially reduced exposure when compared to conventional cigarette smoke. For future in vitro assessments of next generation tobacco and nicotine products, the generation, delivery and testing of undiluted aerosols can now be considered. Copyright © 2018 The Authors. Published by Elsevier B.V. All rights reserved.

  5. Ames dwarf (Prop1(df)/Prop1(df)) mice display increased sensitivity of the major GH-signaling pathways in liver and skeletal muscle.

    Miquet, Johanna G; Muñoz, Marina C; Giani, Jorge F; González, Lorena; Dominici, Fernando P; Bartke, Andrzej; Turyn, Daniel; Sotelo, Ana I

    2010-04-01

    Growth hormone (GH) is an anabolic hormone that regulates growth and metabolism. Ames dwarf mice are natural mutants for Prop1, with impaired development of anterior pituitary and undetectable levels of circulating GH, prolactin and TSH. They constitute an endocrine model of life-long GH-deficiency. The main signaling cascades activated by GH binding to its receptor are the JAK2/STATs, PI-3K/Akt and the MAPK Erk1/2 pathways. We have previously reported that GH-induced STAT5 activation was higher in Ames dwarf mice liver compared to non-dwarf controls. The aim of this study was to evaluate the principal components of the main GH-signaling pathways under GH-deficiency in liver and skeletal muscle, another GH-target tissue. Ames dwarf mice and their non-dwarf siblings were assessed. Animals were injected i.p. with GH or saline 15min before tissue removal. Protein content and phosphorylation of signaling mediators were determined by immunoblotting of tissue solubilizates. GH was able to induce STAT5 and STAT3 tyrosine phosphorylation in both liver and muscle, but the response was higher for Ames dwarf mice than for non-dwarf controls. When Erk1/2 activation was assessed in liver, only dwarf mice showed GH-induced phosphorylation, while in muscle no response to the hormone was found in either genotype. GH-induced Akt phosphorylation at Ser473 in liver was only detected in dwarf mice. In skeletal muscle, both normal and dwarf mice responded to a GH stimulus, although dwarf mice presented higher GH activation levels. The phosphorylation of GSK-3, a substrate of Akt, increased upon hormone stimulation only in dwarf mice in both tissues. In contrast, no differences in the phosphorylation of mTOR, another substrate of Akt, were observed after GH stimulus, either in normal or dwarf mice in liver, while we were unable to determine mTOR in muscle. Protein content of GH-receptor and of the signaling mediators studied did not vary between normal and dwarf animals in the assessed

  6. Ames Air Revitalization

    Huang, Roger Z.

    2015-01-01

    This is an informal presentation presented to the University of Colorado, Boulder Bioastronautics group seminar. It highlights the key focal areas of the Air Revitalization Group research over the past year, including progress on the CO2 Removal and Compression System, testing of CDRA drying bed configurations, and adsorption research.

  7. Ciencéame

    Rivera Castaño, José Juan

    2014-01-01

    En la actualidad las redes sociales son el medio de comunicación más utilizado dentro del mundo que rodea a Internet, ya que aporta a la sociedad un canal de interacción amplio y fluido, el cual se construye a través de un intercambio de información entre grupos de personas, instituciones, entidades y organizaciones. La importancia de la comunicación en la red ha sido tal, que la industria del software ha realizado grandes esfuerzos para pasar de sitios webs como los blogs dond...

  8. Reflections About the Role of Intellectuals in Latin America Reflexiones acerca del rol de los intelectuales en América Latina Reflexões sobre o papel dos intelectuais na América Latina

    Judith Naidorf

    2010-10-01

    intellectual debate but to contribute to a not new but always applicable, which should be a breakthrough for each of our practices in the different social areas in which we daily work.

    En este trabajo nos proponemos abordar algunos aspectos teórico - conceptuales que contribuyan a la reflexión sobre la especificidad del papel del intelectual latinoamericano actual. Los aportes de diversos autores nos ayudarán a caracterizar un rol que se encuentra en permanente reformulación, análisis y discusión. La propuesta es retomar los desarrollos teóricos de la categoría de intelectual, desde Antonio Gramsci e Immanuel Wallerstein principalmente, pasando por sus momentos más intensos en la década del 60-70 con Sartre y Foucault en Europa. También se rescatan las contribuciones realizadas por Pierre Bourdieu, Sousa Santos y los aportes para América Latina de Fals Borda, Florestán Fernández, Octavio Ianni y Eliseo Verón, entre otros. Además se incluyen como ejemplos declaraciones del subcomandante Marcos para el EZLN y se hace referencia a los análisis realizados por Julio Gambina y Daniel Campione para el caso argentino. No es interés de este trabajo arribar a definiciones acabadas acerca de la función social del intelectual sino aportar a un debate no nuevo pero siempre vigente. Neste trabalho pretendemos abordar alguns aspectos teóricos-conceituais que contribuem para a reflexão sobre especificidade do papel do intelectual latino-americano atual. As contribuições de diferentes autores nos ajudam a caracterizar um papel que está constantemente sendo repensado, a análisado e discutido. A proposta é revisitar aos desenvolvimentos teóricos sobre o "intelectual" de Antonio Gramsci e Emanuel Wallerstein principalmente através dos debates mais intensos na década de 60-70 com Sartre e Foucault na Europa. Também se destacam as contribuições feitas por Pierre Bourdieu, Sousa Santos e contribuições desde América Latina de

  9. Respuesta fisiológica del ñame espino (Dioscorea Rotundata Poir a las densidades de siembra

    Dairo J. Pérez

    2015-12-01

    Full Text Available Esta investigación tuvo como objetivo estudiar la respuesta fisiológica del ñame espino (Dioscorea rotundata cv. brasilero en función del incremento de las densidades de siembra, bajo la oferta ambiental del Sinú medio. El estudio se llevó a cabo en la Universidad de Córdoba (Montería, Colombia, donde se evaluaron las densidades de siembra de 45.455, 30.303, 22.727 y 10.101 plantas/ha; bajo un diseño de Bloques Completos al Azar con tres repeticiones. Las variables de respuestas consideradas fueron la fotosíntesis neta (Pn, medida en tres etapas fenológicas (vegetativa, inicio y final de tuberización; y los índices de crecimiento: tasa absoluta de crecimiento (TAC, tasa de asimilación neta (TAN, tasa relativa de crecimiento (TRC e índice de área foliar (IAF. La Pn no varió entre las densidades de siembra (p≤0,05, pero después de la etapa vegetativa, se redujo en promedio un 19,14% para el inicio y final de la tuberización. La TAC y la TRC tuvieron similar tendencia, se incrementaron desde la etapa vegetativa, pero esta última se redujo al final del cultivo. La TAN comenzó a decrecer desde la etapa vegetativa con un leve incremento al final del ciclo. El IAF se incrementó significativamente a partir de la tuberización, para las densidades de siembra superiores a 10.101 plantas/ha, alcanzando valores entre 3,08 y 4,03. Se concluye que los índices de crecimiento a excepción del IAF y la Pn, no variaron entre las densidades de siembra, probablemente por la capacidad de la especie de regular su actividad fisiológica en función de la densidad de siembra.

  10. Model Deformation Measurements of Sonic Boom Models in the NASA Ames 9- by 7-Ft Supersonic Wind Tunnel

    Schairer, Edward T.; Kushner, Laura K.; Garbeff, Theodore J.; Heineck, James T.

    2015-01-01

    The deformations of two sonic-boom models were measured by stereo photogrammetry during tests in the 9- by 7-Ft Supersonic Wind Tunnel at NASA Ames Research Center. The models were geometrically similar but one was 2.75 times as large as the other. Deformation measurements were made by simultaneously imaging the upper surfaces of the models from two directions by calibrated cameras that were mounted behind windows of the test section. Bending and twist were measured at discrete points using conventional circular targets that had been marked along the leading and trailing edges of the wings and tails. In addition, continuous distributions of bending and twist were measured from ink speckles that had been applied to the upper surfaces of the model. Measurements were made at wind-on (M = 1.6) and wind-off conditions over a range of angles of attack between 2.5 deg. and 5.0 deg. At each condition, model deformation was determined by comparing the wind-off and wind-on coordinates of each measurement point after transforming the coordinates to reference coordinates tied to the model. The necessary transformations were determined by measuring the positions of a set of targets on the rigid center-body of the models whose model-axes coordinates were known. Smoothly varying bending and twist measurements were obtained at all conditions. Bending displacements increased in proportion to the square of the distance to the centerline. Maximum deflection of the wingtip of the larger model was about 5 mm (2% of the semispan) and that of the smaller model was 0.9 mm (1% of the semispan). The change in wing twist due to bending increased in direct proportion to distance from the centerline and reached a (absolute) maximum of about -1? at the highest angle of attack for both models. The measurements easily resolved bending displacements as small as 0.05 mm and bending-induced changes in twist as small as 0.05 deg.

  11. NATO Allied Medical Publication 7.5 (AMedP 7.5) NATO Planning Guide for the Estimation of CBRN Casualties

    2016-12-01

    PROMULGATION [ Date ] 1. The enclosed Allied Medical Publication AMedP-7.5, NATO Planning Guide for the Estimation of CBRN Casualties, which has been... radioisotopes modeled are 60Co, 90Sr, 99Mo, 125I, 131I, 137Cs, 192Ir, 226Ra, 238Pu, 241Am, 252Cf. 2) Whole-body irradiation (from cloudshine, groundshine,9... Earth Shelter 16.67 66.67 Exposed/Dismounted 1.00 1.00 Foxhole (nuclear only)† 3.00 10.00 Masonry Building 8.33 6.67 Multi-Story Brick Building 1.33

  12. A New Way of Doing Business: Reusable Launch Vehicle Advanced Thermal Protection Systems Technology Development: NASA Ames and Rockwell International Partnership

    Carroll, Carol W.; Fleming, Mary; Hogenson, Pete; Green, Michael J.; Rasky, Daniel J. (Technical Monitor)

    1995-01-01

    NASA Ames Research Center and Rockwell International are partners in a Cooperative Agreement (CA) for the development of Thermal Protection Systems (TPS) for the Reusable Launch Vehicle (RLV) Technology Program. This Cooperative Agreement is a 30 month effort focused on transferring NASA innovations to Rockwell and working as partners to advance the state-of-the-art in several TPS areas. The use of a Cooperative Agreement is a new way of doing business for NASA and Industry which eliminates the traditional customer/contractor relationship and replaces it with a NASA/Industry partnership.

  13. Multiplicación in vitro de segmentos nodales del clon de ñame Blanco de Guinea (Dioscorea cayenensis - D. rotundata ) en sistemas de cultivo semiautomatizado

    Manuel Cabrera Jova; Rafael Gómez Kosky; Sergio Rodríguez Morales; Jorge López Torres; Aymé Rayas Cabrera; Milagros Basail Pérez; Arletys Santos Pino; Víctor Medero Vega; Germán Rodríguez Rodríguez

    2009-01-01

    Con el empleo del sistema de inmersión temporal fue posible incrementar la multiplicación in vitro de los segmentos nodales en el clon de ñame Blanco de Guinea. Con este tipo de sistema de cultivo se obtuvieron los más altos valores para la altura de la planta, número de entrenudos por planta, así como para la masa fresca y seca de las mismas. Las condiciones de cultivo creadas en el sistema de inmersión temporal para la multiplicación in vitro de los segmentos nodales lograron el más alto co...

  14. When is a search not a search? A comparison of searching the AMED complementary health database via EBSCOhost, OVID and DIALOG.

    Younger, Paula; Boddy, Kate

    2009-06-01

    The researchers involved in this study work at Exeter Health library and at the Complementary Medicine Unit, Peninsula School of Medicine and Dentistry (PCMD). Within this collaborative environment it is possible to access the electronic resources of three institutions. This includes access to AMED and other databases using different interfaces. The aim of this study was to investigate whether searching different interfaces to the AMED allied health and complementary medicine database produced the same results when using identical search terms. The following Internet-based AMED interfaces were searched: DIALOG DataStar; EBSCOhost and OVID SP_UI01.00.02. Search results from all three databases were saved in an endnote database to facilitate analysis. A checklist was also compiled comparing interface features. In our initial search, DIALOG returned 29 hits, OVID 14 and Ebsco 8. If we assume that DIALOG returned 100% of potential hits, OVID initially returned only 48% of hits and EBSCOhost only 28%. In our search, a researcher using the Ebsco interface to carry out a simple search on AMED would miss over 70% of possible search hits. Subsequent EBSCOhost searches on different subjects failed to find between 21 and 86% of the hits retrieved using the same keywords via DIALOG DataStar. In two cases, the simple EBSCOhost search failed to find any of the results found via DIALOG DataStar. Depending on the interface, the number of hits retrieved from the same database with the same simple search can vary dramatically. Some simple searches fail to retrieve a substantial percentage of citations. This may result in an uninformed literature review, research funding application or treatment intervention. In addition to ensuring that keywords, spelling and medical subject headings (MeSH) accurately reflect the nature of the search, database users should include wildcards and truncation and adapt their search strategy substantially to retrieve the maximum number of appropriate

  15. Wind-tunnel investigation of the thrust augmentor performance of a large-scale swept wing model. [in the Ames 40 by 80 foot wind tunnel

    Koenig, D. G.; Falarski, M. D.

    1979-01-01

    Tests were made in the Ames 40- by 80-foot wind tunnel to determine the forward speed effects on wing-mounted thrust augmentors. The large-scale model was powered by the compressor output of J-85 driven viper compressors. The flap settings used were 15 deg and 30 deg with 0 deg, 15 deg, and 30 deg aileron settings. The maximum duct pressure, and wind tunnel dynamic pressure were 66 cmHg (26 in Hg) and 1190 N/sq m (25 lb/sq ft), respectively. All tests were made at zero sideslip. Test results are presented without analysis.

  16. Report of the Interagency Optical Network Testbeds Workshop 2 September 12-14, 2006 NASA Ames Research Center

    Joe Mambretti Richard desJardins

    2006-05-01

    A new generation of optical networking services and technologies is rapidly changing the world of communications. National and international networks are implementing optical services to supplement traditional packet routed services. On September 12-14, 2005, the Optical Network Testbeds Workshop 2 (ONT2), an invitation-only forum hosted by the NASA Research and Engineering Network (NREN) and co-sponsored by the Department of Energy (DOE), was held at NASA Ames Research Center in Mountain View, California. The aim of ONT2 was to help the Federal Large Scale Networking Coordination Group (LSN) and its Joint Engineering Team (JET) to coordinate testbed and network roadmaps describing agency and partner organization views and activities for moving toward next generation communication services based on leading edge optical networks in the 3-5 year time frame. ONT2 was conceived and organized as a sequel to the first Optical Network Testbeds Workshop (ONT1, August 2004, www.nren.nasa.gov/workshop7). ONT1 resulted in a series of recommendations to LSN. ONT2 was designed to move beyond recommendations to agree on a series of “actionable objectives” that would proactively help federal and partner optical network testbeds and advanced research and education (R&E) networks to begin incorporating technologies and services representing the next generation of advanced optical networks in the next 1-3 years. Participants in ONT2 included representatives from innovative prototype networks (Panel A), basic optical network research testbeds (Panel B), and production R&D networks (Panels C and D), including “JETnets,” selected regional optical networks (RONs), international R&D networks, commercial network technology and service providers (Panel F), and senior engineering and R&D managers from LSN agencies and partner organizations. The overall goal of ONT2 was to identify and coordinate short and medium term activities and milestones for researching, developing, identifying

  17. Isospin influence on the decay modes of compound systems produced in the 78,86Kr + 40,48Ca at 10 AMeV

    Pirrone S.

    2016-01-01

    Full Text Available The study of the decay modes competition of the compound systems produced in the collisions 78Kr+40Ca and 86Kr+48Ca at 10AMeV is presented. In particular, the N/Z entrance channel influence on the decay paths of the compound systems, directly connected to the isospin influence, is investigated. The experiment was performed at the INFN Laboratori Nazionali del Sud (LNS in Catania by using the 4π multi-detector CHIMERA. Charge, mass, angular distributions and kinematical features of the reaction products were studied. The analysis shows some differences in the contribution arising from the various reaction mechanisms for the neutron poor and neutron rich systems. Comparison with theoretical statistical and dynamical models are presented for the two systems. Besides a study of the influence of the energy on the entrance channel is performed for the 78Kr+40Ca reaction, by comparing the results of this experiment to those obtained for the same system at 5.5 AMeV with the INDRA device at GANIL.

  18. Thermo Physics Facilities Branch Brochure ARC Jet Complex Fact Sheets, Hypervelocity Free-Flight Aerodynamic Facility Fact Sheets, Ames Vertical Gun Range Fact Sheets

    Fretter, E. F. (Editor); Kuhns, Jay (Editor); Nuez, Jay (Editor)

    2003-01-01

    The Ames Arc Jet Complex has a rich heritage of over 40 years in Thermal Protection System (TPS) development for every NASA Space Transportation and Planetary program, including Apollo, Space Shuttle, Viking, Pioneer-Venus, Galileo, Mars Pathfinder,Stardust, NASP,X-33,X-34,SHARP-B1 and B2,X-37 and Mars Exploration Rovers. With this early TPS history came a long heritage in the development of the arc jet facilities. These are used to simulate the aerodynamic heating that occurs on the nose cap, wing leading edges and on other areas of the spacecraft requiring thermal protection. TPS samples have been run in the arc jets from a few minutes to over an hour,from one exposure to multiple exposures of the same sample, in order t o understand the TPS materials response to a hot gas flow environment (representative of real hyperthermal environments experienced in flight). The Ames Arc l e t Complex is a key enabler for customers involved in the three major areas of TPS development: selection, validation, and qualification. The arc jet data are critical for validating TPS thermal models, heat shield designs and repairs, and ultimately for flight qualification.

  19. Application of satellite data to the studies of agricultural meteorology: Relationship between ground temperature from GMS IR data and AMeDAS air temperature

    Tani, H.; Horiguchi, I.; Motoki, T.

    1984-01-01

    The purpose of the present study is to estimate air temperature in areas where there is no meteorological observation site, using satellite thermal IR data. Surface temperature from GMS IR data derived by eq. (1) was compared with AMeDAS (meteorological observation site) air temperature. The results are summarized as follows: 1) The maximum correlation coefficients between AMeDAS air temperature and surface temperature from GMS IR data is 0.90, the minimum is 0.30 and the mean is 0.60±0.15. 2) The correlation coefficients are affected by the precipitable water and decrease with increasing precipitable Water as shown in Fig. 2. 3) The correlation coefficients for each GMS observed time are better at night and in the morning than during the day (Table 2). 4) Also, the small values of the regression coefficients appear during the day and the large values at night and in the morning (Table 2). 5) The standard deviations which indicated scattering around the regression line are large at 12:00 and 15:00, but small at 06:00 and 09:00 (Table 2). The reason that correlation coefficients, regression coefficients and standard deviations between AMeDAS air temperature and surface temperature from GMS IR data are less during the day than at night and in the morning, is caused by ground conditions because the effects of solar radiation on surface temperature depend on ground surface conditions: plant cover, incline of slope etc. The hourly mean deviation from the regression line for surface temperature was calculated to investigate the characteristic of ground surface conditions for each AMeDAS observation site. AMeDAS observation sites were classified into four types according to the patterns of the hourly mean deviation as shown in Fig. 5. Most of type I were distributed in the plain regions: Ishikari, Konsen and Tokachi. Type II appears in the basin regions and type III on the coast of the Pacific Ocean and the Sea of Okhotsuk. The remaining areas are type IV. The standard

  20. Comparative Evaluation of Biochemical Changes in Tomato (Lycopersicon esculentum Mill.) Infected by Alternaria alternata and Its Toxic Metabolites (TeA, AOH, and AME).

    Meena, Mukesh; Zehra, Andleeb; Dubey, Manish K; Aamir, Mohd; Gupta, Vijai K; Upadhyay, Ram S

    2016-01-01

    In the present study, we have evaluated the comparative biochemical defense response generated against Alternaria alternata and its purified toxins viz. alternariol (AOH), alternariol monomethyl ether (AME), and tenuazonic acid (TeA). The necrotic lesions developed due to treatment with toxins were almost similar as those produced by the pathogen, indicating the crucial role of these toxins in plant pathogenesis. An oxidative burst reaction characterized by the rapid and transient production of a large amount of reactive oxygen species (ROS) occurs following the pathogen infection/toxin exposure. The maximum concentration of hydrogen peroxide (H 2 O 2 ) produced was reported in the pathogen infected samples (22.2-fold) at 24 h post inoculation followed by TeA (18.2-fold), AOH (15.9-fold), and AME (14.1-fold) in treated tissues. 3,3'- Diaminobenzidine staining predicted the possible sites of H 2 O 2 accumulation while the extent of cell death was measured by Evans blue dye. The extent of lipid peroxidation and malondialdehyde (MDA) content was higher (15.8-fold) at 48 h in the sample of inoculated leaves of the pathogen when compared to control. The cellular damages were observed as increased MDA content and reduced chlorophyll. The activities of antioxidative defense enzymes increased in both the pathogen infected as well as toxin treated samples. Superoxide dismutase (SOD) activity was 5.9-fold higher at 24 h post inoculation in leaves followed by TeA (5.0-fold), AOH (4.1-fold) and AME (2.3-fold) treated leaves than control. Catalase (CAT) activity was found to be increased upto 48 h post inoculation and maximum in the pathogen challenged samples followed by other toxins. The native PAGE results showed the variations in the intensities of isozyme (SOD and CAT) bands in the pathogen infected and toxin treated samples. Ascorbate peroxidase (APx) and glutathione reductase (GR) activities followed the similar trend to scavenge the excess H 2 O 2 . The reduction in CAT

  1. Elastic and inelastic scattering of 9,11 Li + Si at backward angles in the energy range (9.5 - 25) AMeV

    Petrascu, M.; Bordeanu, C.; Isbasescu, A.; Mihai, I.; Giurgiu, M.

    1997-01-01

    Recently, an inclusive fusion experiment of 9,11 Li projectiles with Si targets, in the energy range (9.5 - 25) AMeV has been performed at Riken Ring Cyclotron-Japan using, for the detection of the fusion products, an ionization chamber, MUSIC, built in NIPNE-HH, Bucharest. In this experiment, the contribution of elastic and inelastic scattering, at forward detection angles is eliminated through the experimental set-up. For a clear investigation of the fusion process, the estimation of elastic and inelastic scattering at backward angles, between 80 angle - 180 angle was considered necessary. This estimation was made by the coupled channels computer code ECIS. ECIS is an iterative method, the first iteration of this procedure being DWBA. In the analysis of elastic and inelastic scattering of 9,11 Li projectile on Si target we assumed that the incident 9 Li and 11 Li waves are diffracted by an optical potential with an Woods-Saxon geometry. The adopted optical potential is given. For the depth of the real and imaginary volume terms we used values dependent on projectile energy and target mass number. These values have been chosen in good agreement with a semi-microscopic model with a double-folding potential. The set of optical parameters selected for the system 9,11 Li (13 AMeV) + Si is given. The presence of neutron halo of 11 Li nucleus was taken into account by using adjusted values for the parameters r R and a R . The 28 Si nucleus is considered a rigid rotor, including the couplings involving the ground state and a first to excited states. The quadrupole deformation parameter was β 2 = - 0.24. The results for the scattering of 11 Li projectile on Si target at 13 AMeV energy are given with the parameters R match , I and J max taken from the Monte Carlo simulations with PACE code. We found that the contribution of elastic and inelastic scattering for background angles, between 80 angle - 180 angle is under 2%. The contribution of a inelastic scattering taken

  2. The NASA Ames PAH IR Spectroscopic Database: Computational Version 3.00 with Updated Content and the Introduction of Multiple Scaling Factors

    Bauschlicher, Charles W., Jr.; Ricca, A.; Boersma, C.; Allamandola, L. J.

    2018-02-01

    Version 3.00 of the library of computed spectra in the NASA Ames PAH IR Spectroscopic Database (PAHdb) is described. Version 3.00 introduces the use of multiple scale factors, instead of the single scaling factor used previously, to align the theoretical harmonic frequencies with the experimental fundamentals. The use of multiple scale factors permits the use of a variety of basis sets; this allows new PAH species to be included in the database, such as those containing oxygen, and yields an improved treatment of strained species and those containing nitrogen. In addition, the computed spectra of 2439 new PAH species have been added. The impact of these changes on the analysis of an astronomical spectrum through database-fitting is considered and compared with a fit using Version 2.00 of the library of computed spectra. Finally, astronomical constraints are defined for the PAH spectral libraries in PAHdb.

  3. A Tale of Two Small Business Grants: The Best of Times, the Worst of Times from the NASA Ames Small Business Innovative Research (SBIR) Program

    Kojiro, Daniel R.; Lee, Geoffrey S.

    2006-01-01

    The purposes of the SBIR Program are to: stimulate technological innovation in the private sector; strengthen the role of Small Business Concerns (SBCs) in meeting Federal research and development needs; increase the commercial application of these research results; and encourage participation of socially and economically disadvantaged persons and women-owned small businesses. The process can be highly rewarding, providing the small business with resources to pursue research and development with a focus on providing NASA with new and advanced capabilities. We present two examples of how the NASA Ames SBIR Program has addressed these purposes, nurturing innovative ideas from small, businesses into commercially viable products that also address analytical needs in space research. These examples, from the Science Instruments for Conducting Solar System Exploration Subtopic, describe the journey from innovative concept to analytical instrument, one successful and one hampered by numerous roadblocks (including some international intrigue}.

  4. Wind-tunnel investigation of a large-scale VTOL aircraft model with wing root and wing thrust augmentors. [Ames 40 by 80 foot wind tunnel

    Aoyagi, K.; Aiken, T. N.

    1979-01-01

    Tests were conducted in the Ames 40 by 80 foot wind tunnel to determine the aerodynamic characteristics of a large-scale V/STOL aircraft model with thrust augmentors. The model had a double-delta wing of aspect ratio 1.65 with augmentors located in the wing root and the wing trailing edge. The supply air for the augmentor primary nozzles was provided by the YJ-97 turbojet engine. The airflow was apportioned approximately 74 percent to the wing root augmentor and 24 percent to wing augmentor. Results were obtained at several trailing-edge flap deflections with the nozzle jet-momentum coefficients ranging from 0 to 7.9. Three-component longitudinal data are presented with the agumentor operating with and without the horizontal tail. A limited amount of six component data are also presented.

  5. I. The properties of hot Ca-like fragments from the 40Ca+40Ca reaction at 35 AMeV

    Planeta, R.; Gawlikowicz, W.; Wieloch, A.

    2001-01-01

    The creation of hot Ca-like fragments was investigated in the 40 Ca + 40 Ca reaction at 35 AMeV. Using the AMPHORA 4π detector system, the primary projectile-like fragment was reconstructed and its properties were determined. Both primary and secondary distributions are compared with the predictions of a Monte Carlo code describing a heavy-ion collision as a two-step process. Some of the nucleons which are identified as participants in the first step are transferred in the second step to these final states, which correspond on the average to the maximum value of entropy (thermodynamic probability). The model allows for competition between mean-field effects and nucleon-nucleon interactions in the overlap zone of the interacting nuclei. The analysis presented here suggests a thermalized source picture of the decay of the projectile-like fragment. The validity of the reconstruction procedure for projectile-like fragments is discussed. (orig.)

  6. Mutagens from the cooking of food. II. Survey by Ames/Salmonella test of mutagen formation in the major protein-rich foods of the American diet

    Bjeldanes, L.F. (Univ. of California, Berkeley); Morris, M.M.; Felton, J.S.; Healy, S.; Stuermer, D.; Berry, P.; Timourian, H.; Hatch, F.T.

    1982-01-01

    The formation of mutagens in the major cooked protein-rich foods in the US diet was studied in the Ames Salmonella typhimurium test. The nine protein-rich foods most commonly eaten in the USA--ground beef, beef steak, eggs, pork chops, fried chicken, pot-roasted beef, ham, roast beef and bacon--were examined for their mutagenicity towards S. typhimurium TA1538 after normal 'household' cooking (deep frying, griddle/pan frying, baking/roasting, broiling, stewing, braising or boiling at 100-475/sup 0/C). Well-done fried ground beef, beef steak, ham, pork chops and bacon showed significant mutagen formation. For chicken and beef steak high-temperature broiling produced the most mutagenicity, followed by baking/roasting and frying. Stewing, braising and deep frying produced little mutagen. Eggs andd egg products produced mutagens only after cooking at high temperatures (the yolk to a greater extent than the white). Commercially cooked hamburgers showed a wide range of mutagenic activity. We conclude that mutagen formation following cooking of protein-containing foods is a complex function of food type, cooking time and cooking temperature. It seems clear that all the major protein-rich foods if cooked to a well-done state on the griddle (eggs only at temperature above 225/sup 0/C) or by broiling will contain mutagens detectable by the Ames/Salmonella assay. This survey is a step towards determining whether any human health hazard results from cooking protein-rich foods. Further testing in both short- and long-term genotoxicity bioassays and carcinogenesis assays are needed before any human risk extrapolations can be made.

  7. Mutagens from the cooking of food. II. Survey by Ames/Salmonella test of mutagen formation in the major protein-rich foods of the American diet.

    Bjeldanes, L F; Morris, M M; Felton, J S; Healy, S; Stuermer, D; Berry, P; Timourian, H; Hatch, F T

    1982-08-01

    The formation of mutagens in the major cooked protein-rich foods in the US diet was studied in the Ames Salmonella typhimurium test. The nine protein-rich foods most commonly eaten in the USA--ground beef, beef steak, eggs, pork chops, fried chicken, pot-roasted beef, ham, roast beef and bacon--were examined for their mutagenicity towards S. typhimurium TA1538 after normal 'household' cooking (deep frying, griddle/pan frying, baking/roasting, broiling, stewing, braising or boiling of 100-475 degrees C). Well-done fried ground beef, beef steak, ham pork chops and bacon showed significant mutagen formation. For chicken and beef steak high-temperature broiling produced the most mutagenicity, followed by baking/roasting and frying. Stewing, braising and deep frying produced little mutagen. Eggs and egg products produced mutagens only after cooking at high temperatures (the yolk to a greater extent than the white). Commercially cooked hamburgers showed a wide range of mutagenic activity. We conclude that mutagen formation following cooking of protein-containing foods is a complex function of food type, cooking time and cooking temperature. It seems clear that all the major protein-rich foods if cooked to a well-done state on the griddle (eggs only at temperatures above 225 degrees C) or by broiling will contain mutagens detectable by the Ames/Salmonella assay. This survey is a step towards determining whether any human health hazard results from cooking protein-rich foods. Further testing in both short- and long-term genotoxicity bioassays and carcinogenesis assays are needed before any human risk extrapolations can be made.

  8. Aeroacoustic Study of a 26%-Scale Semispan Model of a Boeing 777 Wing in the NASA Ames 40- by 80-Foot Wind Tunnel

    Horne, W. Clifton; Burnside, Nathan J.; Soderman, Paul T.; Jaeger, Stephen M.; Reinero, Bryan R.; James, Kevin D.; Arledge, Thomas K.

    2004-01-01

    An acoustic and aerodynamic study was made of a 26%-scale unpowered Boeing 777 aircraft semispan model in the NASA Ames 40- by 80-Foot Wind Tunnel for the purpose of identifying and attenuating airframe noise sources. Simulated approach and landing configurations were evaluated at Mach numbers between 0.12 and 0.24. Cruise configurations were evaluated at Mach numbers between 0.24 and 0.33. The research team used two Ames phased-microphone arrays, a large fixed array and a small traversing array, mounted under the wing to locate and compare various noise sources in the wing high-lift system and landing gear. Numerous model modifications and noise alleviation devices were evaluated. Simultaneous with acoustic measurements, aerodynamic forces were recorded to document aircraft conditions and any performance changes caused by the geometric modifications. Numerous airframe noise sources were identified that might be important factors in the approach and landing noise of the full-scale aircraft. Several noise-control devices were applied to each noise source. The devices were chosen to manipulate and control, if possible, the flow around the various tips and through the various gaps of the high-lift system so as to minimize the noise generation. Fences, fairings, tip extensions, cove fillers, vortex generators, hole coverings, and boundary-layer trips were tested. In many cases, the noise-control devices eliminated noise from some sources at specific frequencies. When scaled to full-scale third-octave bands, typical noise reductions ranged from 1 to 10 dB without significant aerodynamic performance loss.

  9. Low-speed tests of a high-aspect-ratio, supercritical-wing transport model equipped with a high-lift flap system in the Langley 4- by 7-meter and Ames 12-foot pressure tunnels

    Morgan, H. L., Jr.; Kjelgaard, S. O.

    1983-01-01

    The Ames 12-Foot Pressure Tunnel was used to determine the effects of Reynolds number on the static longitudinal aerodynamic characteristics of an advanced, high-aspect-ratio, supercritical wing transport model equipped with a full span, leading edge slat and part span, double slotted, trailing edge flaps. The model had a wing span of 7.5 ft and was tested through a free stream Reynolds number range from 1.3 to 6.0 x 10 to 6th power per foot at a Mach number of 0.20. Prior to the Ames tests, an investigation was also conducted in the Langley 4 by 7 Meter Tunnel at a Reynolds number of 1.3 x 10 to 6th power per foot with the model mounted on an Ames strut support system and on the Langley sting support system to determine strut interference corrections. The data obtained from the Langley tests were also used to compare the aerodynamic charactertistics of the rather stiff, 7.5-ft-span steel wing model tested during this investigation and the larger, and rather flexible, 12-ft-span aluminum-wing model tested during a previous investigation. During the tests in both the Langley and Ames tunnels, the model was tested with six basic wing configurations: (1) cruise; (2) climb (slats only extended); (3) 15 deg take-off flaps; (4) 30 deg take-off flaps; (5) 45 deg landing flaps; and (6) 60 deg landing flaps.

  10. Comparative genotoxicity testing of Rhine river sediment extracts using the comet assay with permanent fish cell lines (RTG-2 and RTL-W1) and the Ames test

    Kosmehl, T.; Braunbeck, T.; Hollert, H. [Dept. of Zoology, Aquatic Ecology and Toxicology Section, Univ. of Heidelberg (Germany); Krebs, F.; Manz, W. [German Federal Inst. of Hydrology, Koblenz (Germany); Erdinger, L. [Dept. for Hygiene and Medical Microbiology, Inst. for Hygiene, Univ. of Heidelberg (Germany)

    2004-07-01

    Whilst at least in Germany assessment strategies on the basis of chemical analysis and acute toxicity data dominated the last decades, the development of more specific biological endpoints and biomarkers in ecotoxicology is required in order to arrive at a good ecological potential and good chemical status of surface waters in the European river basins until the year 2015, as required by the European Water Framework Directive. Since sediments have for long been known to function both as a sink and as a source of pollutants in aquatic systems, and since part of the particle-associated substances have frequently been demonstrated to cause mutagenic and carcinogenic effects in aquatic organisms, particularly in fish, there is, among other requirements, an urgent need to develop, standardize and implement integrated vertebrate-based test systems addressing genotoxicity into recent sediment investigation strategies. Thus, the present study was designed to compare the suitability of two commonly used test systems, the comet assay and the Ames test, for the evaluation of the ecotoxicological burden of surface and core sediment samples from the river Rhine. Methods (or main features). In order to determine the importance of inherent enzymatic activities, two permanent fish cell lines with different biotransformation capacities, RTL-W1 and RTG-2, were compared with respect to their capability of detecting genotoxic effects in 18 surface and core sediment samples from 9 locations along the river Rhine in the comet assay with and without exogenous bioactivation. For further comparison, as a prokaryotic mutagenicity assay, the Salmonella plate incorporation assay (Ames test) with the test strains TA98 and TA100 with and without exogenous metabolic activation was used. Results and discussion. Whereas all sediment extracts induced genotoxic effects in the comet assay with RTL-W1 cells, only 12 out of 18 sediment extracts revealed significant genotoxicity in the tests with the

  11. Mutagens from the cooking of food. III. Survey by Ames/Salmonella test of mutagen formation in secondary sources of cooked dietary protein

    Bjeldanes, L F [Univ. of California, Berkeley; Morris, M M; Felton, J S; Healy, S; Stuermer, D; Berry, P; Timourian, H; Hatch, F T

    1982-01-01

    A survey of mutagen formation during the cooking of a variety of protein-rich foods that are minor sources of protein intake in the American diet is reported (see Bjeldanes, Morris, Felton et al. (1982) for survey of major protein foods). Milk, cheese, tofu and organ meats showed negligible mutagen formation except following high-temperature cooking for long periods of time. Even under the most extreme conditions, tofu, cheese and milk exhibited fewer than 500 Ames/Salmonella typhimurium revertants/100 g equivalents (wet weight of uncooked food), and organ meats only double that amount. Beans showed low mutagen formation after boiling followed by frying (with and without oil). Only boiling of beans followed by baking for 1 hr gave appreciable mutagenicity (3650 revertants/100 g equivalents). Seafood samples gave a variety of results: red snapper, salmon, trout, halibut and rock cod all gave more than 1000 revertants/100 g wet weight equivalents when pan-fried or griddle-fried for about 6 min/side. Baked or poached rock cod and deep-fried shrimp showed no significant mutagen formation. Broiled lamb chops showed mutagen formation similar to that in red meats tested in the preceding paper: 16,000 revertants/100 g equivalents. These findings show that as measured by bioassay in S. typhimurium, most of the food that are minor sources of protein in the American diet are also minor sources of cooking-induced mutagens.

  12. Report on the Stanford/KACST/AMES UVLED small satellite mission to demonstrate charge management of an electrically isolated proof mass for drag-free operation

    Saraf, Shailendhar

    A spacecraft demonstration of ultra-violet (UV) LEDs and UV LED charge management based on research done at Stanford University is being developed jointly by the King Abdulaziz City for Science and Technology (KACST) Saudi Arabia and NASA Ames Research Center, with an expected launch date of June 2014. This paper will report on the payload design and testing, mission preparation, satellite launch and payload bring -up in space. Mission lifetime is expected to be at least one month, during which time the ability for the UV LEDs to mitigate actual space-based charging and the effects of radiation on the UV LED device performance will be studied. Precise control over the potential of an electrically isolated proof mass is necessary for the operation of devices such as a Gravitational Reference Sensor (GRS) and satellite missions such as LISA. The mission will demonstrate that AlGaN UV LEDs operating at 255 nm are an effective low-cost, low-power and compact substitute for Mercury vapor lamps used in previous missions. The goal of the mission is to increase the UV LED device to TRL-9 and the charge management system to TRL-7.

  13. The role of the Joint Research Centre from the European Commission in the European Structural Integrity Networks AMES, ENIQ and NESC

    Estorff, U. von; Torronen, K.

    1999-01-01

    Due to the reduction in many countries of the research budget for nuclear safety several European institutions and organisations and the Institute for Advanced Materials (IAM) of the Joint Research Centre (JRC) of the European Commission (EC) have developed co-operative programmes now organised into 'Networks' for mutual benefit. They include utilities, engineering companies, research and development (R and D) laboratories and regulatory bodies. These Networks are all organised and managed in a similar way, i.e. like the successful Programme for the Inspection of Steel Components (PISC). The IAM plays the role of Operating Agent, Reference Laboratory and Network Manager of these Networks: European Network on Ageing Materials Evaluation and Studies (AMES), European Network for Inspection Qualification (ENIQ) and Network for Evaluating Steel Components (NESC), each of them dealing with a specific aspect of fitness for purpose of materials in structural components. This article will describe how the network organisation works, which was the positive experience from the past, why the networks are a tool for integrating fragmented research in Europe and how they fit into the mission of the JRC and therefore follow the EC policy. (orig.)

  14. Control-value theory: using achievement emotions to improve understanding of motivation, learning, and performance in medical education: AMEE Guide No. 64.

    Artino, Anthony R; Holmboe, Eric S; Durning, Steven J

    2012-01-01

    In this AMEE Guide, we consider the emergent theoretical and empirical work on human emotion and how this work can inform the theory, research, and practice of medical education. In the Guide, we define emotion, in general, and achievement emotions, more specifically. We describe one of the leading contemporary theories of achievement emotions, control-value theory (Pekrun 2006), and we distinguish between different types of achievement emotions, their proximal antecedents, and their consequences for motivation, learning, and performance. Next, we review the empirical support for control-value theory from non-medical fields and suggest several important implications for educational practice. In this section, we highlight the importance of designing learning environments that foster a high degree of control and value for students. Finally, we end with a discussion of the need for more research on achievement emotions in medical education, and we propose several key research questions we believe will facilitate our understanding of achievement emotions and their impact on important educational outcomes.

  15. Mutagens from the cooking of food. III. Survey by Ames/Salmonella test of mutagen formation in secondary sources of cooked dietary protein.

    Bjeldanes, L F; Morris, M M; Felton, J S; Healy, S; Stuermer, D; Berry, P; Timourian, H; Hatch, F T

    1982-08-01

    A survey of mutagen formation during the cooking of a variety of protein-rich foods that are minor sources of protein intake in the American diet is reported (see Bjeldanes, Morris, Felton et al. (1982) for survey of major protein foods). Milk, cheese, tofu and organ meats showed negligible mutagen formation except following high-temperature cooking for long periods of time. Even under the most extreme conditions, tofu, cheese and milk exhibited fewer than 500 Ames/Salmonella typhimurium revertants/100 g equivalents (wet weight of uncooked food), and organ meats only double that amount. Beans showed low mutagen formation after boiling and boiling followed by frying (with and without oil). Only boiling of beans followed by baking for 1 hr gave appreciable mutagenicity (3650 revertants/100g equivalents). Seafood samples gave a variety of results: red snapper, salmon, trout, halibut and rock cod all gave more than 1000 revertants/100 g wet weight equivalents when pan-fried or griddle-fried for about 6 min/side. Baked or poached rock and deep-fried shrimp showed no significant mutagen formation. Broiled lamb chops showed mutagen formation similar to that in red meats tested in the preceding paper: 16,000 revertants/100 g equivalents. These findings show that as measured by bioassay in S. typhimurium, most of the foods that are minor sources of protein in the American diet are also minor sources of cooking-induced mutagens.

  16. Stereo Photogrammetry Measurements of the Position and Attitude of a Nozzle-Plume/Shock-Wave Interaction Model in the NASA Ames 9- by 7-Ft Supersonic Wind Tunnel

    Schairer, Edward T.; Kushner, Laura K.; Drain, Bethany A.; Heineck, James T.; Durston, Donald A.

    2017-01-01

    Stereo photogrammetry was used to measure the position and attitude of a slender body of revolution during nozzle-plume/shock-wave interaction tests in the NASA Ames 9- by 7-Ft Supersonic Wind Tunnel. The model support system was designed to allow the model to be placed at many locations in the test section relative to a pressure rail on one sidewall. It included a streamwise traverse as well as a thin blade that offset the model axis from the sting axis. With these features the support system was more flexible than usual resulting in higher-than-usual uncertainty in the position and attitude of the model. Also contributing to this uncertainty were the absence of a balance, so corrections for sting deflections could not be applied, and the wings-vertical orientation of the model, which precluded using a gravity-based accelerometer to measure pitch angle. Therefore, stereo photogrammetry was chosen to provide independent measures of the model position and orientation. This paper describes the photogrammetry system and presents selected results from the test.

  17. Isospin influence on the decay modes of the systems produced in the 78,86Kr +40,48Ca reactions at 10 AMeV

    Gnoffo B.

    2016-01-01

    Full Text Available The results of the analysis of the reactions 78,86Kr +40,48 Ca at 10 AMeV are presented. The experiment was performed at the INFN Laboratori Nazionali del Sud (LNS in Catania by using the 4π multidetector CHIMERA, with beams delivered by the Superconductive Cyclotron. The competition among the various disintegration paths and in particular the isospin effects on the decay modes of the produced composite systems are investigated; this provides information about fundamental nuclear quantities such as level density, fission barrier and viscosity. Different isotopic composition and relative richness are observed among the reaction products of the two systems. An odd-even staggering effect is present in the charge distributions, in particular for the light fragments produced by the neutron-poor system. The kinematical characteristics of the IMF seem to indicate a high degree of the relaxation of the formed system. Besides, global features analysis seems to show some differences in the contribution arising from the various reaction mechanisms for the two reactions.

  18. Mutagenicity of Tween 80-solvated mild gasification products in the Ames salmonella microsomal assay system. [Quarterly report, October--December 1991

    1992-01-13

    The results of the Tween 80-solvated Ames testing of six mild gasification samples indicate significant mutagenic activity only in the composite materials (MG-119 and MG-120), previously suspected from the DMSO-solvated assays, which had shown some variable but ultimately insignificant mutagenic responses. The activity of these samples from the Tween 80-solvated assays was quite low when compared to either the positive controls or the SRC-II HD coal-liquefaction reference material. The class of mutagenic activity expressed by these samples solvated in Tween 80 was that of an indirect-acting, frameshift mutagen(s) since significant activity was found only on tester strain TA98 in the presence of the metabolic activation fraction (S9). Because DMSO and other solvents have been shown to affect the mutagenic activity of certain pure chemicals, the possibility of solvent/mutagen interactions in complex mixtures such as coal-derived liquids exists. Thus, the testing of the genotoxic activity of undefined, chemically complex compounds may require the use of at least two solvent systems to reduce the possibility of artifactual findings. 10 refs., 4 tabs.

  19. Measurement of neutron spectra generated by a 62 AMeV carbon-ion beam on a PMMA phantom using extended range Bonner sphere spectrometers

    Bedogni, R.; Amgarou, K.; Domingo, C.; Russo, S.; Cirrone, G.A.P.; Pelliccioni, M.; Esposito, A.; Pola, A.; Introini, M.V.; Gentile, A.

    2012-01-01

    Neutrons constitute an important component of the radiation environment in hadron therapy accelerators. Their energy distribution may span from thermal up to hundred of MeV. The characterization of these fields in terms of dosimetric or spectrometric quantities is crucial for either the patient protection or the facility design aspects. To date, the Extended Range Bonner Sphere Spectrometer (ERBSS) is the only instrument able to simultaneously determine all spectral components in such workplaces. With the aim of providing useful data to the scientific community involved in neutron measurements at hadron therapy facilities, a measurement campaign was carried out at the Centro di AdroTerapia e Applicazioni Nucleari Avanzate (CATANA) of INFN-LNS (Laboratori Nazionali del Sud), where a 62 AMeV carbon ion is available. The beam was directed towards a PMMA phantom, simulating the patient, and two neutron measurement points were established at 0° and 90° with respect to the beam-line. The ERBSSs of UAB (Universidad Autónoma de Barcelona-Grup de Física de les Radiacions) and INFN (Istituto Nazionale di Fisica Nucleare-Laboratori Nazionali di Frascati) were used to measure the resulting neutron fields. The two ERBSSs use different detectors and sphere diameters, and have been independently calibrated. The FRUIT code was used to unfold the results.

  20. Measurement of neutron spectra generated by a 62 AMeV carbon-ion beam on a PMMA phantom using extended range Bonner sphere spectrometers

    Bedogni, R., E-mail: roberto.bedogni@lnf.infn.it [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, Via E. Fermi 40, 00044 Frascati (Italy); Amgarou, K.; Domingo, C. [Grup de Recerca en Radiacions Ionitzants, Departament de Fisica, Universitat Autonoma de Barcelona, E-08193 Bellaterra (Spain); Russo, S.; Cirrone, G.A.P. [Istituto Nazionale di Fisica Nucleare-Laboratori Nazionali dei Sud, Via S. Sofia 62, 95125 Catania (Italy); Pelliccioni, M.; Esposito, A. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, Via E. Fermi 40, 00044 Frascati (Italy); Pola, A.; Introini, M.V. [Politecnico di Milano, CESNEF, Dipartimento di Energia, via Ponzio 34/3, 20133 Milano (Italy); Gentile, A. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Frascati, Via E. Fermi 40, 00044 Frascati (Italy)

    2012-07-21

    Neutrons constitute an important component of the radiation environment in hadron therapy accelerators. Their energy distribution may span from thermal up to hundred of MeV. The characterization of these fields in terms of dosimetric or spectrometric quantities is crucial for either the patient protection or the facility design aspects. To date, the Extended Range Bonner Sphere Spectrometer (ERBSS) is the only instrument able to simultaneously determine all spectral components in such workplaces. With the aim of providing useful data to the scientific community involved in neutron measurements at hadron therapy facilities, a measurement campaign was carried out at the Centro di AdroTerapia e Applicazioni Nucleari Avanzate (CATANA) of INFN-LNS (Laboratori Nazionali del Sud), where a 62 AMeV carbon ion is available. The beam was directed towards a PMMA phantom, simulating the patient, and two neutron measurement points were established at 0 Degree-Sign and 90 Degree-Sign with respect to the beam-line. The ERBSSs of UAB (Universidad Autonoma de Barcelona-Grup de Fisica de les Radiacions) and INFN (Istituto Nazionale di Fisica Nucleare-Laboratori Nazionali di Frascati) were used to measure the resulting neutron fields. The two ERBSSs use different detectors and sphere diameters, and have been independently calibrated. The FRUIT code was used to unfold the results.

  1. Measurement of neutron spectra generated by a 62 AMeV carbon-ion beam on a PMMA phantom using extended range Bonner sphere spectrometers

    Bedogni, R.; Amgarou, K.; Domingo, C.; Russo, S.; Cirrone, G. A. P.; Pelliccioni, M.; Esposito, A.; Pola, A.; Introini, M. V.; Gentile, A.

    2012-07-01

    Neutrons constitute an important component of the radiation environment in hadron therapy accelerators. Their energy distribution may span from thermal up to hundred of MeV. The characterization of these fields in terms of dosimetric or spectrometric quantities is crucial for either the patient protection or the facility design aspects. To date, the Extended Range Bonner Sphere Spectrometer (ERBSS) is the only instrument able to simultaneously determine all spectral components in such workplaces. With the aim of providing useful data to the scientific community involved in neutron measurements at hadron therapy facilities, a measurement campaign was carried out at the Centro di AdroTerapia e Applicazioni Nucleari Avanzate (CATANA) of INFN-LNS (Laboratori Nazionali del Sud), where a 62 AMeV carbon ion is available. The beam was directed towards a PMMA phantom, simulating the patient, and two neutron measurement points were established at 0° and 90° with respect to the beam-line. The ERBSSs of UAB (Universidad Autónoma de Barcelona-Grup de Física de les Radiacions) and INFN (Istituto Nazionale di Fisica Nucleare-Laboratori Nazionali di Frascati) were used to measure the resulting neutron fields. The two ERBSSs use different detectors and sphere diameters, and have been independently calibrated. The FRUIT code was used to unfold the results.

  2. Proposed Use of the NASA Ames Nebula Cloud Computing Platform for Numerical Weather Prediction and the Distribution of High Resolution Satellite Imagery

    Limaye, Ashutosh S.; Molthan, Andrew L.; Srikishen, Jayanthi

    2010-01-01

    The development of the Nebula Cloud Computing Platform at NASA Ames Research Center provides an open-source solution for the deployment of scalable computing and storage capabilities relevant to the execution of real-time weather forecasts and the distribution of high resolution satellite data to the operational weather community. Two projects at Marshall Space Flight Center may benefit from use of the Nebula system. The NASA Short-term Prediction Research and Transition (SPoRT) Center facilitates the use of unique NASA satellite data and research capabilities in the operational weather community by providing datasets relevant to numerical weather prediction, and satellite data sets useful in weather analysis. SERVIR provides satellite data products for decision support, emphasizing environmental threats such as wildfires, floods, landslides, and other hazards, with interests in numerical weather prediction in support of disaster response. The Weather Research and Forecast (WRF) model Environmental Modeling System (WRF-EMS) has been configured for Nebula cloud computing use via the creation of a disk image and deployment of repeated instances. Given the available infrastructure within Nebula and the "infrastructure as a service" concept, the system appears well-suited for the rapid deployment of additional forecast models over different domains, in response to real-time research applications or disaster response. Future investigations into Nebula capabilities will focus on the development of a web mapping server and load balancing configuration to support the distribution of high resolution satellite data sets to users within the National Weather Service and international partners of SERVIR.

  3. Expression of DNA methyltransferases is influenced by growth hormone in the long-living Ames dwarf mouse in vivo and in vitro.

    Armstrong, Vanessa L; Rakoczy, Sharlene; Rojanathammanee, Lalida; Brown-Borg, Holly M

    2014-08-01

    Methyltransferase expression and DNA methylation are linked to aging and age-related disease. We utilized 3-, 12-, and 24-month-old Ames dwarf and their wild-type siblings to examine the genotype and age-related differences in the expression of methyltransferase enzymes related to DNA methylation in the liver, glycine-N-methyltransferase and DNA methyltransferase (DNMT). We found that DNMT proteins and transcripts are differentially expressed in dwarf mice compared with wild-type siblings that can be attributed to age and/or genotype. However, DNMT1 protein expression is drastically reduced compared with wild-type controls at every age. DNMT3a protein levels coincide with differences observed in DNMT activity. Growth hormone appears to modulate expression of DNMT1 and 3a in dwarf liver tissue and primary hepatocytes. Therefore, growth hormone may contribute to age-related processes, DNA methylation, and, ultimately, longevity. © The Author 2013. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  4. Analysis and characterization of heavy residues produced in 129Xe + natSn reactions between 8 and 25 AMeV

    Moisan, J.

    2008-06-01

    Studies with the INDRA multidetector of the 129 Xe + nat Sn reactions showed the unexpected existence of heavy fragments with a charge as large as Z=70. The charges of Xe and Sn are 54 and 50 respectively. Reactions between nuclei with a charge product greater than 2700 are dominated by deep inelastic collisions. For Xe + Sn the product is exactly 2700. After these observations, 129 Xe + nat Sn reactions at 8, 12, 15, 20 and 25 AMeV have been done. It will then be possible to clarify if the heavy residues are formed by an incomplete fusion, massive transfers occurring in deep inelastic collisions or a very asymmetric fission of a compound system. This work will present experimental results obtained by the analysis of these experiments. We will show that heavy residues are formed with a production cross-section of 10 -2 mb. Angular distributions show that the residues can be produced by an incomplete fusion of the projectile and the target. The study of the products in coincidence with the residues shows that a compound system was formed, followed by a fission producing the residue and a lighter fragment. The comparison with a phenomenological model, HIPSE, confirms that the model is valid at these energies

  5. Acoustic Modifications of the Ames 40x80 Foot Wind Tunnel and Test Techniques for High-Speed Research Model Testing

    Soderman, Paul T.; Olson, Larry (Technical Monitor)

    1995-01-01

    The NFAC 40- by 80- Foot Wind Tunnel at Ames is being refurbished with a new, deep acoustic lining in the test section which will make the facility nearly anechoic over a large frequency range. The modification history, key elements, and schedule will be discussed. Design features and expected performance gains will be described. Background noise reductions will be summarized. Improvements in aeroacoustic research techniques have been developed and used recently at NFAC on several wind tunnel tests of High Speed Research models. Research on quiet inflow microphones and struts will be described. The Acoustic Survey Apparatus in the 40x80 will be illustrated. A special intensity probe was tested for source localization. Multi-channel, high speed digital data acquisition is now used for acoustics. And most important, phased microphone arrays have been developed and tested which have proven to be very powerful for source identification and increased signal-to-noise ratio. Use of these tools for the HEAT model will be illustrated. In addition, an acoustically absorbent symmetry plane was built to satisfy the HEAT semispan aerodynamic and acoustic requirements. Acoustic performance of that symmetry plane will be shown.

  6. Comparison of acoustic data from a 102 mm conic nozzle as measured in the RAE 24-foot wind tunnel and the NASA Ames 40- by 80-foot wind tunnel

    Atencio, A., Jr.; Mckie, J.

    1982-01-01

    A cooperative program between the Royal Aircraft Establishment (RAE), England, and the NASA Ames Research Center was initiated to compare acoustic measurements made in the RAE 24-foot wind tunnel and in the Ames 40- by 80-foot wind tunnel. The acoustic measurements were made in both facilities using the same 102 mm conical nozzle supplied by the RAE. The nozzle was tested by each organization using its respective jet test rig. The mounting hardware and nozzle exit conditions were matched as closely as possible. The data from each wind tunnel were independently analyzed by the respective organization. The results from these tests show good agreement. In both facilities, interference with acoustic measurement is evident at angles in the forward quadrant.

  7. Plans for Testing the NREL Unsteady Aerodynamics Experiment 10m Diameter HAWT in the NASA Ames Wind Tunnel: Minutes, Conclusions, and Revised Text Matrix from the 1st Science Panel Meeting

    Simms, D.; Schreck, S.; Hand, M.; Fingersh, L.; Cotrell, J.; Pierce, K.; Robinson, M.

    2000-08-28

    Currently, the NREL Unsteady Aerodynamics Experiment (UAE) research turbine is scheduled to enter the NASA Ames 80-ft x 120-ft wind tunnel in early 2000. To prepare for this 3-week test, a Science Panel meeting was convened at the National Wind Technology Center (NWTC) in October 1998. During this meeting, the Science Panel and representatives from the wind energy community provided numerous detailed recommendations regarding test activities and priorities. The Unsteady Aerodynamics team of the NWTC condensed this guidance and drafted a detailed test plan. This test plan represents an attempt to balance diverse recommendations received from the Science Panel meeting, while taking into account multiple constraints imposed by the UAE research turbine, the NASA Ames 80-ft x 120-ft wind tunnel, and other sources. The NREL-NASA Ames wind tunnel tests will primarily be focused on obtaining rotating blade pressure data. NREL has been making these types of measurements since 1987 and has considerable experience in doing so. The purpose of this wind tunnel test is to acquire accurate quantitative aerodynamic and structural measurements, on a wind turbine that is geometrically and dynamically representative of full-scale machines, in an environment free from pronounced inflow anomalies. These data will be exploited to develop and validate enhanced engineering models for designing and analyzing advanced wind energy machines.

  8. Evaluación de métodos para la conservación de hongos fitopatógenos del ñame (Dioscorea sp.

    Yeimy Alexandra Pinzón Gutiérrez

    2009-07-01

    Full Text Available Un elemento esencial en la investigación con microorganismos fitopatógenos es su conservación y uso seguro. Desde este punto de vista, en este estudio se evaluaron métodos de conservación de hongos que atacan el ñame, empleando como factores de respuesta el potencial de viabilidad, y la estabilidad y presencia o ausencia de cambios en las características macro y microscópicas. Como resultado del trabajo se proponen los métodos más adecuados para los géneros Colletotrichum y Fusarium, hongos causantes de las mayores pérdidas en las plantaciones de ñame en la Costa Caribe colombiana. Las cepas utilizadas en este estudio provienen de las colecciones de la Universidad de Sucre, del Instituto de Biotecnología de la Universidad Nacional de Colombia (IBUN y de una donación de la doctora Lucía Afanador de la Universidad Nacional, Sede Medellín. Estas fueron sometidas a diferentes métodos de conservación, entre ellos criopreservación, liofilización y cultivo periódico con y sin aceite mineral. Los resultados obtenidos permitieron elegir la criopreservación como el método más eficiente para la conservación de la colección, y el cultivo periódico con aceite mineral como método alternativo y complementario. Estos minimizan el riesgo de pérdida del material biológico y brindan condiciones de manejo que conservan las características biológicas bajo estudio desde campos como la microbiología, la bioquímica y la biología molecular, entre otros. An essential element in phytopathogenic microorganism research is their preservation and safe use. The purpose of this study was to evaluate methods for preserving fungi producing diseases in yam, using potential viability, stability and the presence or absence of macro- and microscopic characteristic changes as response factors. More suitable methods for Colletotrichum and Fusarium genera were proposed as a result of the work; these are fungi causing the greatest losses in yam

  9. A simple model for yield prediction of rice based on vegetation index derived from satellite and AMeDAS data during ripening period

    Wakiyama, Y.; Inoue, K.; Nakazono, K.

    2003-01-01

    The present study was conducted to show a simple model for rice yield predicting by using a vegetation index (NDVI) derived from satellite and meteorological data. In a field experiment, the relationship between the vegetation index and radiation absorbed by the rice canopy was investigated from transplanting to maturity. Their correlation held. This result revealed that the vegetation index could be used as a measure of absorptance of solar radiation by rice canopy. NDVI multiplied by solar radiation (SR) every day was accumulated (Σ(SR·NDVI)) from the field experiment. Σ(SR·NDVI) was plotted against above ground dry matter. It was obvious that they had a strong relationship. Rice yield largely depends on solar radiation and air temperature during the ripening period. Air temperature affects dry matter production. Relationships between Y SR -1 (Y: rice yield, SR: solar radiation) and mean air temperature were investigated from meteorological data and statistical data on rice yield. There was an optimum air temperature, 21.3°C, for ripening. When it was near 21.3°C in the ripening period, the rice yield was higher. We proposed a simple model for yield prediction of rice based on these results. The model is composed with SR·NDVI and the optimum air temperature. Vegetation index was derived from 3 years, LANDSAT TM data in Toyama, Ishikawa, Fukui and Nagano prefectures at heading. The meteorological data was used from AMeDAS data. The model was described as follows: Y = 0.728 SR·NDVI−2.04(T−21.3) 2 + 282 (r 2 = 0.65, n = 43) where Y is rice yield (kg 10a -1 ), SR is solar radiation (MJ m -2 ) during the ripening period (from 10 days before heading to 30 days after heading), T is mean air temperature (°C) during the ripening period. RMSE was 33.7kg 10a -1 . The model revealed good precision. (author)

  10. Final work plan: Expedited Site Characterization of the IES Industries, Inc., Site at Marshalltown, Iowa. Ames Expedited Site Characterization Project, Version 1.0

    1994-04-04

    The overall goal of the Ames Laboratory Expedited Site Characterization (ESC) project is to evaluate and promote both innovative and state-of-the-practice site characterization and/or monitoring technologies. This will be accomplished by fielding both types of technologies together in the context of an expedited site characterization. The first site will be at a former manufactured gas plant (FMGP) in Marshalltown, Iowa. The project will field three areas of technology: geophysical, analytical, and data fusion. Geophysical technologies are designed to understand the subsurface geology to help predict fate and transport of the target contaminants. Analytical technologies/methods are designed to detect and quantify the target contaminants. Data fusion technology consists of software systems designed to rapidly integrate or fuse all site information into a conceptual site model that then becomes the decision making tool for the site team to plan subsequent sampling activity. Not all of the contaminants present can be located at the action level. Polynuclear aromatic hydrocarbons (PAHs) are the signature organics associated with the coal tar activities that took place at the site. As a result, PAHs were selected as the target compounds. Screening analytical instruments and nonintrusive geophysical techniques will be fielded to qualitatively map the spatial contaminant distribution. Soil gas surveys, immunoassay testing (IMA), innovative optical techniques, and passive organic sorbent sensors will be deployed along with the geophysical methods. Gas chromatography/mass spectrometry (GC/MS) instruments and a cone penetrometer system equipped with a laser-induced fluorescence (LIF) probe will quantitatively map the action level edges of the PAH plume(s). Samples will be taken both by the cone penetrometer test system (CPT) and the Geoprobe {reg_sign} sampler system.

  11. The Mars Dust Cycle: Investigating the Effects of Radiatively Active Water Ice Clouds on Surface Stresses and Dust Lifting Potential with the NASA Ames Mars General Circulation Model

    Kahre, Melinda A.; Hollingsworth, Jeffery

    2012-01-01

    The dust cycle is a critically important component of Mars' current climate system. Dust is present in the atmosphere of Mars year-round but the dust loading varies with season in a generally repeatable manner. Dust has a significant influence on the thermal structure of the atmosphere and thus greatly affects atmospheric circulation. The dust cycle is the most difficult of the three climate cycles (CO2, water, and dust) to model realistically with general circulation models. Until recently, numerical modeling investigations of the dust cycle have typically not included the effects of couplings to the water cycle through cloud formation. In the Martian atmosphere, dust particles likely provide the seed nuclei for heterogeneous nucleation of water ice clouds. As ice coats atmospheric dust grains, the newly formed cloud particles exhibit different physical and radiative characteristics. Thus, the coupling between the dust and water cycles likely affects the distributions of dust, water vapor and water ice, and thus atmospheric heating and cooling and the resulting circulations. We use the NASA Ames Mars GCM to investigate the effects of radiatively active water ice clouds on surface stress and the potential for dust lifting. The model includes a state-of-the-art water ice cloud microphysics package and a radiative transfer scheme that accounts for the radiative effects of CO2 gas, dust, and water ice clouds. We focus on simulations that are radiatively forced by a prescribed dust map, and we compare simulations that do and do not include radiatively active clouds. Preliminary results suggest that the magnitude and spatial patterns of surface stress (and thus dust lifting potential) are substantial influenced by the radiative effects of water ice clouds.

  12. In vitro genotoxicity of neutral red after photo-activation and metabolic activation in the Ames test, the micronucleus test and the comet assay.

    Guérard, Melanie; Zeller, Andreas; Singer, Thomas; Gocke, Elmar

    2012-07-04

    Neutral red (Nr) is relatively non-toxic and is widely used as indicator dye in many biological test systems. It absorbs visible light and is known to act as a photosensitizer, involving the generation of reactive oxygen species (type-I reaction) and singlet oxygen (type-II reaction). The mutagenicity of Nr was determined in the Ames test (with Salmonella typhimurium strains TA1535, TA97, TA98, TA98NR, TA100, and TA102) with and without metabolic activation, and with and without photo-activation on agar plates. Similarly to the situation following metabolic activation, photo-mutagenicity of Nr was seen with all Salmonella strains tested, albeit with different effects between these strains. To our knowledge, Nr is the only photo-mutagen showing such a broad action. Since the effects are also observed in strains not known to be responsive to ROS, this indicates that ROS production is not the sole mode of action that leads to photo-genotoxicity. The reactive species produced by irradiation are short-lived as pre-irradiation of an Nr solution did not produce mutagenic effects when added to the bacteria. In addition, mutagenicity in TA98 following irradiation was stronger than in the nitroreductase-deficient strain TA98NR, indicating that nitro derivatives that are transformed by bacterial nitroreductase to hydroxylamines appear to play a role in the photo-mutagenicity of Nr. Photo-genotoxicity of Nr was further investigated in the comet assay and micronucleus test in L5178Y cells. Concentration-dependent increases in primary DNA damage and in the frequency of micronuclei were observed after irradiation. Copyright © 2012 Elsevier B.V. All rights reserved.

  13. Interstellar matter in Shapley-Ames elliptical galaxies. IV. A diffusely distributed component of dust and its effect on colour gradients.

    Goudfrooij, P.; de Jong, T.

    1995-06-01

    We have investigated IRAS far-infrared observations of a complete, blue magnitude limited sample of 56 elliptical galaxies selected from the Revised Shapley-Ames Catalog. Data from a homogeneous optical CCD imaging survey as well as published X-ray data from the EINSTEIN satellite are used to constrain the infrared data. Dust masses as determined from the IRAS flux densities are found to be roughly an order of magnitude higher than those determined from optical extinction values of dust lanes and patches, in strong contrast with the situation in spiral galaxies. This "mass discrepancy" is found to be independent of the (apparent) inclination of the dust lanes. To resolve this dilemma we postulate that the majority of the dust in elliptical galaxies exists as a diffusely distributed component of dust which is undetectable at optical wavelengths. Using observed radial optical surface brightness profiles, we have systematically investigated possible heating mechanisms for the dust within elliptical galaxies. We find that heating of the dust in elliptical galaxies by the interstellar radiation field is generally sufficient to account for the dust temperatures as indicated by the IRAS flux densities. Collisions of dust grains with hot electrons in elliptical galaxies which are embedded in a hot, X-ray-emitting gas is found to be another effective heating mechanism for the dust. Employing model calculations which involve the transfer of stellar radiation in a spherical distribution of stars mixed with a diffuse distribution of dust, we show that the observed infrared luminosities imply total dust optical depths of the postulated diffusely distributed dust component in the range 0.1<~τ_V_<~0.7 and radial colour gradients 0.03<~{DELTA}(B-I)/{DELTA}log r<~0.25. The observed IRAS flux densities can be reproduced within the 1σ uncertainties in virtually all ellipticals in this sample by this newly postulated dust component, diffusely distributed over the inner few kpc of

  14. Participación política y violencia de género en América Latina

    Laura Albaine

    2014-07-01

    Full Text Available Este artículo reflexiona a través del análisis de fac- tores socioculturales e institucionales sobre uno de los obstáculos más graves que condicionan la participación política de las mujeres en América Latina: El acoso y vio- lencia política en razón de género. Esta problemática es una nueva expresión que ha adoptado la violencia de gé- nero en la arena política que restringe el ejercicio de los derechos políticos de las mujeres y el derecho a vivir una vida libre de violencia. El acoso y violencia política se manifiesta más allá de los avances normativos logrados en la región orientados a generar condiciones de igualdad en términos de género en la participación política. En consecuencia, a las nor- mas que promueven el acceso de las mujeres a cargos de decisión, tales como cuotas o paridad, deben sumársele cuerpos legales que garanticen, además de sus derechos políticos, su seguridad y sus derechos humanos. AbstractThis paper focuses on a reflection and analysis of socio-cultural and institutional factors that affect wom- en’s political participation Latin America, such as gen- der-based harassment and violence. This problem is a new expression that has adopted gender-based violence in political arena, restricting not only the exercise of women’s political rights but also their right to live a life free of violence. Despite Latin American countries have enacted laws to create conditions in terms of gender equality in polit- ical participation, political harassment and violence still occurs. However, these policy actions are not enough to ensure women’s access to decision-making positions, such as quotas or parity; it must also be legal bodies to ensure, in addition to their political rights, their personal safety and human rights. 

  15. UVA activation of N-dialkylnitrosamines releasing nitric oxide, producing strand breaks as well as oxidative damages in DNA, and inducing mutations in the Ames test

    Arimoto-Kobayashi, Sakae; Sano, Kayoko; Machida, Masaki; Kaji, Keiko; Yakushi, Keiko

    2010-01-01

    We investigated the photo-mutagenicity and photo-genotoxicity of N-dialkylnitrosamines and its mechanisms of UVA activation. With simultaneous irradiation of UVA, photo-mutagenicity of seven N-dialkylnitrosamines was observed in Ames bacteria (Salmonella typhimurium TA1535) in the absence of metabolic activation. Mutagenicity of pre-irradiated N-dialkylnitrosamines was also observed with S. typhimurium hisG46, TA100, TA102 and YG7108 in the absence of metabolic activation. UVA-mediated mutation with N-nitrosodimethylamine (NDMA) and N-nitrosodiethylamine (NDEA) decreased by adding either the NO or OH radical scavenger. When superhelical DNA was irradiated with N-dialkylnitrosamines, nicked circular DNA appeared. Ten N-dialkylnitrosamines examined produced strand breaks in the treated DNA in the presence of UVA. The level of single-strand breaks in φX174 DNA mediated by N-nitrosomorpholine (NMOR) and UVA decreased by adding either a radical scavenger or superoxide dismutase. When calf thymus DNA was treated with N-dialkylnitrosamines (NDMA, NDEA, NMOR, N-nitrosopyrrolidine (NPYR) and N-nitrosopiperidine (NPIP)) and UVA, the ratio of 8-oxodG/dG in the DNA increased. Action spectra were obtained to determine if nitrosamine acts as a sensitizer of UVA. Both mutation frequency and NO formation were highest at the absorption maximum of nitrosamines, approximately 340 nm. The plots of NO formation and mutation frequency align with the absorption curve of NPYR, NMOR and NDMA. A significant linear correlation between the optical density of N-dialkynitrosamines at 340 nm and NO formation in each irradiated solution was revealed by ANOVA. We would like to propose the hypothesis that the N-nitroso moiety of N-dialkylnitrosamines absorbs UVA photons, UVA-photolysis of N-dialkylnitrosamines brings release of nitric oxide, and subsequent production of alkyl radical cations and active oxygen species follow as secondary events, which cause DNA strand breaks, oxidative and

  16. UVA activation of N-dialkylnitrosamines releasing nitric oxide, producing strand breaks as well as oxidative damages in DNA, and inducing mutations in the Ames test

    Arimoto-Kobayashi, Sakae [Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, Okayama University, 1-1-1 Tsushima, Okayama 700-8530 (Japan); Sano, Kayoko; Machida, Masaki; Kaji, Keiko; Yakushi, Keiko [Graduate School of Medicine, Dentistry and Pharmaceutical Sciences, Okayama University, 1-1-1 Tsushima, Okayama 700-8530 (Japan)

    2010-09-10

    We investigated the photo-mutagenicity and photo-genotoxicity of N-dialkylnitrosamines and its mechanisms of UVA activation. With simultaneous irradiation of UVA, photo-mutagenicity of seven N-dialkylnitrosamines was observed in Ames bacteria (Salmonella typhimurium TA1535) in the absence of metabolic activation. Mutagenicity of pre-irradiated N-dialkylnitrosamines was also observed with S. typhimurium hisG46, TA100, TA102 and YG7108 in the absence of metabolic activation. UVA-mediated mutation with N-nitrosodimethylamine (NDMA) and N-nitrosodiethylamine (NDEA) decreased by adding either the NO or OH radical scavenger. When superhelical DNA was irradiated with N-dialkylnitrosamines, nicked circular DNA appeared. Ten N-dialkylnitrosamines examined produced strand breaks in the treated DNA in the presence of UVA. The level of single-strand breaks in {phi}X174 DNA mediated by N-nitrosomorpholine (NMOR) and UVA decreased by adding either a radical scavenger or superoxide dismutase. When calf thymus DNA was treated with N-dialkylnitrosamines (NDMA, NDEA, NMOR, N-nitrosopyrrolidine (NPYR) and N-nitrosopiperidine (NPIP)) and UVA, the ratio of 8-oxodG/dG in the DNA increased. Action spectra were obtained to determine if nitrosamine acts as a sensitizer of UVA. Both mutation frequency and NO formation were highest at the absorption maximum of nitrosamines, approximately 340 nm. The plots of NO formation and mutation frequency align with the absorption curve of NPYR, NMOR and NDMA. A significant linear correlation between the optical density of N-dialkynitrosamines at 340 nm and NO formation in each irradiated solution was revealed by ANOVA. We would like to propose the hypothesis that the N-nitroso moiety of N-dialkylnitrosamines absorbs UVA photons, UVA-photolysis of N-dialkylnitrosamines brings release of nitric oxide, and subsequent production of alkyl radical cations and active oxygen species follow as secondary events, which cause DNA strand breaks, oxidative and

  17. Biological Visualization, Imaging and Simulation(Bio-VIS) at NASA Ames Research Center: Developing New Software and Technology for Astronaut Training and Biology Research in Space

    Smith, Jeffrey

    2003-01-01

    The Bio- Visualization, Imaging and Simulation (BioVIS) Technology Center at NASA's Ames Research Center is dedicated to developing and applying advanced visualization, computation and simulation technologies to support NASA Space Life Sciences research and the objectives of the Fundamental Biology Program. Research ranges from high resolution 3D cell imaging and structure analysis, virtual environment simulation of fine sensory-motor tasks, computational neuroscience and biophysics to biomedical/clinical applications. Computer simulation research focuses on the development of advanced computational tools for astronaut training and education. Virtual Reality (VR) and Virtual Environment (VE) simulation systems have become important training tools in many fields from flight simulation to, more recently, surgical simulation. The type and quality of training provided by these computer-based tools ranges widely, but the value of real-time VE computer simulation as a method of preparing individuals for real-world tasks is well established. Astronauts routinely use VE systems for various training tasks, including Space Shuttle landings, robot arm manipulations and extravehicular activities (space walks). Currently, there are no VE systems to train astronauts for basic and applied research experiments which are an important part of many missions. The Virtual Glovebox (VGX) is a prototype VE system for real-time physically-based simulation of the Life Sciences Glovebox where astronauts will perform many complex tasks supporting research experiments aboard the International Space Station. The VGX consists of a physical display system utilizing duel LCD projectors and circular polarization to produce a desktop-sized 3D virtual workspace. Physically-based modeling tools (Arachi Inc.) provide real-time collision detection, rigid body dynamics, physical properties and force-based controls for objects. The human-computer interface consists of two magnetic tracking devices

  18. Protocolo para la formación de microtubérculos de ñame (Dioscorea alata L. en sistema de inmersión temporal

    Manuel Cabrera Jova

    2009-07-01

    Full Text Available Con el propósito de desarrollar un protocolo para la formación de microtubérculos en el clon de ñame Pacala Duclos (Dioscorea alata L. en sistema de inmersión temporal, que pudiera ser usado como alternativa para la propagación de esta especie, se definieron como objetivos de trabajo determinar el efecto del tiempo y la frecuencia de inmersión, así como la influencia del volumen de medio de cultivo por planta cultivada in vitro. Con el empleo de 15 min de inmersión y una frecuencia de inmersión cada 6 horas, se alcanzaron los mejores resultados en cuanto al número de microtubérculos formados por planta. Con este tiempo y frecuencia de inmersión los microtubérculos presentaron la mayor masa fresca y seca, así como el mayor diámetro. Además, a las 18 semanas de cultivo se obtuvo el mayor número total de microtubérculos por sistema y el mayor número de microtubérculos aprovechables como material vegetal de propagación. En cuanto al volumen de medio de cultivo por planta, con 60 ml de medio de cultivo por planta in vitro se alcanzó el mayor número de microtubérculos aprovechables, los cuales presentaron el contenido más alto de materia seca. Los microtubérculos obtenidos en este tipo de sistema de inmersión temporal presentaron una masa fresca superior a 2,40 gMF, lo cual podría permitir su uso como material de plantación directo a campo.Abreviaturas: sistema de inmersión temporal (SIT, gramos de masa fresca (gMF, recipiente de inmersión temporal automatizado (RITA.

  19. Measurement of isotopic cross sections of the fission fragments produced in 500 AMeV {sup 208}Pb + p reaction; Etude de la production des fragments de fission issus de la reaction {sup 208}Pb + p a 500 AMeV

    Fernandez-Dominguez, B

    2003-03-01

    The aim of this work is the study of the fission fragments produced in the spallation reaction {sup 208}Pb + p at 500 AMeV. The fission fragments from Z=23 up to Z=59 have been detected and identified by using the inverse kinematics technique with the high-resolution spectrometer FRS. The production cross sections and the recoil velocities of 430 nuclei have been measured. The measured data have been compared with previous data. The isotopic distributions show a high precision. However, the absolute value of the fission cross section is higher than expected. From the experimental data the characteristics of the average fissioning system have been reconstructed (Z{sub fis}, A{sub fis}, E*{sub fis}). In addition, the number of post-fission neutrons emitted from the fission fragments, v{sub post}, has been determined by using a new method. The experimental data have been compared to the two-steps models describing the spallation reaction. The impact of the model parameters on the observables has been analysed and the reasons Leading to the observed differences between the codes are also presented. This analyse shows a good agreement with the INCL4+ABLA code. (author)

  20. Evaluación en campo de plantas de ñame (Dioscorea alata L. obtenidas de los microtubérculos formados en Sistema de Inmersión Temporal

    Manuel Cabrera Jova

    2010-01-01

    Full Text Available Los microtubérculos en algunas especies de plantas constituyen una importante alternativa como material vegetal de plantación. Se definió como objetivo de trabajo evaluar en campo la respuesta morfoagronómica de las plantas obtenidas de los microtubérculos de ñame formados en Sistema de Inmersión Temporal (SIT. Como variantes experimentales se plantaron tres categorías de microtubérculos, clasificados según su masa fresca (I. de 0,5 a 0,9 g; II. de 1,0 a 2,9 g; III. igual o mayor de 3,0 g, plantas in vitro previamente aclimatadas y corona de tubérculo. Se evaluó el efecto de la masa fresca de los microtubérculos sobre su brote, supervivencia y posterior desarrollo de las plantas derivadas de ellos en campo. Con los microtubérculos de ñame, con una masa fresca igual o superior a 3,0 g, se alcanzó el más alto porcentaje de brotación (91,30% y supervivencia de las plantas (96,50%, así como las mejores respuestas en los caracteres cuantitativos que se evaluaron en campo. Estos resultados confirmaron la importancia de la masa fresca de los microtubérculos para ser empleados como material vegetal de plantación directo en campo.

  1. Full-Span Tiltrotor Aeroacoustic Model (TRAM) Overview and 40- by 80-Foot Wind Tunnel Test. [conducted in the 40- by 80-Foot Wind Tunnel at Ames Research Center

    McCluer, Megan S.; Johnson, Jeffrey L.; Rutkowski, Michael (Technical Monitor)

    2001-01-01

    Most helicopter data trends cannot be extrapolated to tiltrotors because blade geometry and aerodynamic behavior, as well as rotor and fuselage interactions, are significantly different for tiltrotors. A tiltrotor model has been developed to investigate the aeromechanics of tiltrotors, to develop a comprehensive database for validating tiltrotor analyses, and to provide a research platform for supporting future tiltrotor designs. The Full-Span Tiltrotor Aeroacoustic Model (FS TRAM) is a dual-rotor, powered aircraft model with extensive instrumentation for measurement of structural and aerodynamic loads. This paper will present the Full-Span TRAM test capabilities and the first set of data obtained during a 40- by 80-Foot Wind Tunnel test conducted in late 2000 at NASA Ames Research Center. The Full-Span TRAM is a quarter-scale representation of the V-22 Osprey aircraft, and a heavily instrumented NASA and U.S. Army wind tunnel test stand. Rotor structural loads are monitored and recorded for safety-of-flight and for information on blade loads and dynamics. Left and right rotor balance and fuselage balance loads are monitored for safety-of-flight and for measurement of vehicle and rotor aerodynamic performance. Static pressure taps on the left wing are used to determine rotor/wing interactional effects and rotor blade dynamic pressures measure blade airloads. All of these measurement capabilities make the FS TRAM test stand a unique and valuable asset for validation of computational codes and to aid in future tiltrotor designs. The Full-Span TRAM was tested in the NASA Ames Research Center 40- by 80-Foot Wind Tunnel from October through December 2000. Rotor and vehicle performance measurements were acquired in addition to wing pressures, rotor acoustics, and Laser Light Sheet (LLS) flow visualization data. Hover, forward flight, and airframe (rotors off) aerodynamic runs were performed. Helicopter-mode data were acquired during angle of attack and thrust sweeps for

  2. Investigations of the 0.020-scale 88-OTS Integrated Space Shuttle Vehicle Jet-Plume Model in the NASA/Ames Research Center 11 by11-Foot Unitary Plan Wind Tunnel (IA80). Volume 1

    Nichols, M. E.

    1976-01-01

    The results are documented of jet plume effects wind tunnel test of the 0.020-scale 88-OTS launch configuration space shuttle vehicle model in the 11 x 11 foot leg of the NASA/Ames Research Center Unitary Plan Wind Tunnel. This test involved cold gas main propulsion system (MPS) and solid rocket motor (SRB) plume simulations at Mach numbers from 0.6 to 1.4. Integrated vehicle surface pressure distributions, elevon and rudder hinge moments, and wing and vertical tail root bending and torsional moments due to MPS and SRB plume interactions were determined. Nozzle power conditions were controlled per pretest nozzle calibrations. Model angle of attack was varied from -4 deg to +4 deg; model angle of sideslip was varied from -4 deg to +4 deg. Reynolds number was varied for certain test conditions and configurations, with the nominal freestream total pressure being 14.69 psia. Plotted force and pressure data are presented.

  3. Pressure distribution data from tests of 2.29 M (7.5 feet) span EET high-lift transport aircraft model in the Ames 12-foot pressure tunnel

    Kjelgaard, S. O.; Morgan, H. L., Jr.

    1983-01-01

    A high-lift transport aircraft model equipped with full-span leading-edge slat and part-span double-slotted trailing-edge flap was tested in the Ames 12-ft pressure tunnel to determine the low-speed performance characteristics of a representative high-aspect-ratio supercritical wing. These tests were performed in support of the Energy Efficient Transport (EET) program which is one element of the Aircraft Energy Efficiency (ACEE) project. Static longitudinal forces and moments and chordwise pressure distributions at three spanwise stations were measured for cruise, climb, two take-off flap, and two landing flap wing configurations. The tabulated and plotted pressure distribution data is presented without analysis or discussion.

  4. Transient Fanconi syndrome with severe polyuria and polydipsia in a 4-year old Shih Tzu fed chicken jerky treats.

    Major, A; Schweighauser, A; Hinden, S E; Francey, T

    2014-12-01

    Acquired Fanconi syndrome is characterized by inappropriate urinary loss of amino acids, bicarbonate, electrolytes, and water. It has recently been described in dogs fed chicken jerky treats from China, a new differential diagnosis to the classical inciting infectious diseases (e.g. leptospirosis, pyelonephritis) and toxins. A dog fed exclusively chicken jerky treats purchased in Switzerland was presented to our clinic with severe polyuria, polydipsia and profound electrolyte and acid base disturbances. Other inciting causes of Fanconi syndrome were ruled out. The requirement of a very intensive supportive treatment in this dog stands in contrast to treatment of chronic forms of Fanconi syndrome as described in the Basenji. This intensive therapy and the associated monitoring can be a real challenge and a limiting factor for the prognosis of acquired Fanconi syndrome. Veterinarians should be aware of the risk of excessive feeding of chicken jerky treats.

  5. Chinese strategic culture, Shih and Li: a comparison of the Kuomintang and Chinese Communist Party from 1923-1927

    2016-05-26

    contended that a time comes when “society can no longer live under this bourgeoisie , in other words, its existence is no longer compatible with society...said, “The first stage of revolution is the restriction of absolutism, which satisfies the bourgeoisie ; the second is the attainment of the republic...which satisfies the “people,” the peasantry and the petty bourgeoisie at large; the third is the socialist revolution, which alone can satisfy the

  6. Molecular characterisation of Colombian yam germplasm by "DNA amplification fingerprinting (DAF" in radioactivo conditions Caracterización molecular del germoplasma de ñame colombiano utilizando "DNA Amplificaron Fingerprinting (DAF" en condiciones radiactivas

    Bustamante Silvia L.

    2003-12-01

    sustainability for small-scale Colombian yam farmers.Para la realización de este trabajo se utilizaron muestras de la colección de ñame (Dioscorea spp. de la Universi­dad de Córdoba y algunas muestras provenientes del IITA (International Institute of Tropical Agriculture, Ibadan, Nigeria, con el fin de caracterizarlas molecularmente y complementar la información que se tiene de ellas. Dada la importancia del cultivo del ñame para los pequeños productores de la costa atlántica, surgió la propuesta de iniciar estudios moleculares en una primera etapa empleando técnicas como los AFLP En este trabajo, utilizan­do DNA amplificación "fingerprinting" (DAF, técnica basada en la PCR que utiliza oligos aleatorios que gene­ran patrones de bandeo característicos de cada individuo, se encontró que la diversidad de la población fue 0.0413 con una media de similaridad de 0.9587, lo cual indica que la colección de ñame existente en el país posee muy poca diversidad genética, y esto puede explicar parcialmente la vulnerabilidad del cultivo a plagas y enfer­medades, como sucedió a finales de la década de 1980 cuando la antracnosis prácticamente acabó con el cultivo en la costa atlántica colombiana. Es recomendable continuar con los estudios de caracterización utilizando una técnica de mayor poder de discriminación.

  7. Caracterización molecular de Colletotrichum gloeosporioides aislado de plantas de ñame de la Costa Atlántica Colombiana utilizando la técnica “DNA Amplification Fingerprinting (DAF”

    Natalia Giraldo Marroquín

    2016-01-01

    Full Text Available La antracnosis en ñame, causada por el hongo Colletotrichum gloeosporioides, es una enfermedad relevante que posee el potencial de destruir el 100% de la cosecha, convirtiéndose en la principal limitante fitosanitaria para el rendimiento del cultivo en el país. Esta es una situación preocupante considerando que aproximadamente 35.000 familias de pequeños y medianos agricultores de la Costa Atlántica Colombiana subsisten de este cultivo; es por esto que el objetivo de este trabajo fue caracterizar molecularmente 42 aislamientos del hongo procedentes de plantas de ñame con síntomas de la enfermedad, utilizando la técnica molecular “DNA Amplification Fingerprinting (DAF”, caracterizada por su resolución en la determinación de la variabilidad genética de diferentes organismos. Para la determinación de polimorfismos, se amplificaron 16 marcadores DAF implementando iniciadores tipo decámero, los cuales fueron visualizados por electroforesis en microchip con el equipo MCE-202 MultiNA. Se evaluó la reproducibilidad de la técnica DAF. La amplificación arrojó 391 bandas inequívocamente polimórficas en todas las muestras, el coeficiente de Dice identificó cinco grupos con 0.30% de similaridad y el índice de diversidad genética fue de 0.28; datos que reflejan un alto grado de variabilidad en la colección estudiada de C. gloeosporioides. Ésta puede deberse, al intercambio de germoplasma, a su condición heterotálica, a las mutaciones y al alto potencial de dispersión de las conidias que le permiten mantener la viabilidad bajo condiciones adversas. Por último, se encontró que DAF es una técnica reproducible, confirmando que es una metodología fiable para la caracterización molecular de hongos.

  8. Flight and full-scale wind-tunnel comparison of pressure distributions from an F-18 aircraft at high angles of attack. [Conducted in NASA Ames Research Center's 80 by 120 ft wind tunnel

    Fisher, David F.; Lanser, Wendy R.

    1994-01-01

    Pressure distributions were obtained at nearly identical fuselage stations and wing chord butt lines in flight on the F-18 HARV at NASA Dryden Flight Research Center and in the NASA Ames Research Center's 80 by 120 ft wind tunnel on a full-scale F/A-18 aircraft. The static pressures were measured at the identical five stations on the forebody, three stations on the left and right leading-edge extensions, and three spanwise stations on the wing. Comparisons of the flight and wind-tunnel pressure distributions were made at alpha = 30 deg, 45 deg, and 60 deg/59 deg. In general, very good agreement was found. Minor differences were noted at the forebody at alpha = 45 deg and 60 deg in the magnitude of the vortex footprints and a Mach number effect was noted at the leading-edge extension at alpha = 30 deg. The inboard leading edge flap data from the wind tunnel at alpha = 59 deg showed a suction peak that did not appear in the flight data. This was the result of a vortex from the corner of the leading edge flap whose path was altered by the lack of an engine simulation in the wind tunnel.

  9. Ames and random amplified polymorphic DNA tests for the validation of the mutagenic and/or genotoxic potential of the drinking water disinfection by-products chloroform and bromoform.

    Khallef, Messaouda; Cenkci, Süleyman; Akyil, Dilek; Özkara, Arzu; Konuk, Muhsin; Benouareth, Djamel Eddine

    2018-01-28

    Chloroform and Bromoform are two abundant trihalomethanes found in Algerian drinking water. The investigation of the mutagenic hazard of these disinfection by-products was studied by Ames test as prokaryotic bioassay to show their mutagenic effects. For this, Salmonella typhimurium TA98 and TA100 strains were employed. Both chloroform and bromoform showed a direct mutagenic effect since the number of revertant colonies gradually increase in dose-dependent manner with all concentrations tested with the two bacterial strains and these were both in the absence and presence of S9 metabolic activation. The genotoxic hazard was also studied by random amplified polymorphic DNA test on the root cells of Allium cepa as eukaryotic bioassay. DNA extracted from the roots of the onion were incubated at different concentrations of chloroform and bromoform and then amplified by polymerase chain reaction. This was based on demonstrating a major effect of disappearance of bands compared to roots incubated in the negative control (distilled water). The results showed that these two compounds affected genomic DNA by breaks although by mutations.

  10. Space Shuttle AFRSI OMS pod environment test using model 81-0 test fixture in the Ames Research Center 9x7-foot supersonic wind tunnel (OS-314A/B/C)

    Collette, J. G. R.

    1984-01-01

    A test was conducted in the NASA/Ames Research Center 9x7-foot Supersonic Wind Tunnel to help resolve an anomaly that developed during the STS-6 orbiter flight wherein sections of the Advanced Flexible Reusable Surface Insulation (AFRSI) covering the OMS pods suffered some damage. A one-third scale two-dimensional shell structure model of an OMS pod cross-section was employed to support the test articles. These consisted of 15 AFRSI blanket panels form-fitted over the shell structures for exposure to simulated flight conditions. Of six baseline blankets, two were treated with special surface coatings. Two other panels were configured with AFRSI sections removed from the OV099 orbiter vehicle after the STS-6 flight. Seven additional specimens incorporated alternative designs and repairs. Following a series of surface pressure calibration runs, the specimens were exposed to simulated ascent and entry dynamic pressure profiles. Entry conditions included the use of a vortex generator to evaluate the effect of shed vortices on the AFRSI located in the area of concern.

  11. Aerodynamic characteristics of a large-scale semispan model with a swept wing and an augmented jet flap with hypermixing nozzles. [Ames 40- by 80-Foot Wind Tunnel and Static Test Facility

    Aiken, T. N.; Falarski, M. D.; Koenin, D. G.

    1979-01-01

    The aerodynamic characteristics of the augmentor wing concept with hypermixing primary nozzles were investigated. A large-scale semispan model in the Ames 40- by 80-Foot Wind Tunnel and Static Test Facility was used. The trailing edge, augmentor flap system occupied 65% of the span and consisted of two fixed pivot flaps. The nozzle system consisted of hypermixing, lobe primary nozzles, and BLC slot nozzles at the forward inlet, both sides and ends of the throat, and at the aft flap. The entire wing leading edge was fitted with a 10% chord slat and a blowing slot. Outboard of the flap was a blown aileron. The model was tested statically and at forward speed. Primary parameters and their ranges included angle of attack from -12 to 32 degrees, flap angles of 20, 30, 45, 60 and 70 degrees, and deflection and diffuser area ratios from 1.16 to 2.22. Thrust coefficients ranged from 0 to 2.73, while nozzle pressure ratios varied from 1.0 to 2.34. Reynolds number per foot varied from 0 to 1.4 million. Analysis of the data indicated a maximum static, gross augmentation of 1.53 at a flap angle of 45 degrees. Analysis also indicated that the configuration was an efficient powered lift device and that the net thrust was comparable with augmentor wings of similar static performance. Performance at forward speed was best at a diffuser area ratio of 1.37.

  12. An automated, open-source (NASA Ames Stereo Pipeline) workflow for mass production of high-resolution DEMs from commercial stereo satellite imagery: Application to mountain glacies in the contiguous US

    Shean, D. E.; Arendt, A. A.; Whorton, E.; Riedel, J. L.; O'Neel, S.; Fountain, A. G.; Joughin, I. R.

    2016-12-01

    We adapted the open source NASA Ames Stereo Pipeline (ASP) to generate digital elevation models (DEMs) and orthoimages from very-high-resolution (VHR) commercial imagery of the Earth. These modifications include support for rigorous and rational polynomial coefficient (RPC) sensor models, sensor geometry correction, bundle adjustment, point cloud co-registration, and significant improvements to the ASP code base. We outline an automated processing workflow for 0.5 m GSD DigitalGlobe WorldView-1/2/3 and GeoEye-1 along-track and cross-track stereo image data. Output DEM products are posted at 2, 8, and 32 m with direct geolocation accuracy of process individual stereo pairs on a local workstation, the methods presented here were developed for large-scale batch processing in a high-performance computing environment. We have leveraged these resources to produce dense time series and regional mosaics for the Earth's ice sheets. We are now processing and analyzing all available 2008-2016 commercial stereo DEMs over glaciers and perennial snowfields in the contiguous US. We are using these records to study long-term, interannual, and seasonal volume change and glacier mass balance. This analysis will provide a new assessment of regional climate change, and will offer basin-scale analyses of snowpack evolution and snow/ice melt runoff for water resource applications.

  13. Results of a jet plume effects test on Rockwell International integrated space shuttle vehicle using a vehicle 5 configuration 0.02-scale model (88-OTS) in the 11 by 11 foot leg of the NASA/Ames Research Center unitary plan wind tunnel (IA19), volume 1

    Nichols, M. E.

    1975-01-01

    Results are presented of jet plume effects test IA19 using a vehicle 5 configuration integrated space shuttle vehicle 0.02-scale model in the NASA/Ames Research Center 11 x 11-foot leg of the unitary plan wind tunnel. The jet plume power effects on the integrated vehicle static pressure distribution were determined along with elevon, main propulsion system nozzle, and solid rocket booster nozzle effectiveness and elevon hinge moments.

  14. MULTIPLICACIÓN Y TUBERIZACIÓN in vitro DE ÑAME (Dioscorea alata L. EN SISTEMA DE INMERSIÓN TEMPORAL MULTIPLICATION AND in vitro TUBERIZATION OF YAM (Dioscorea alata L. IN TEMPORARY IMMERSION SYSTEM

    Robinson Salazar Díaz

    2007-12-01

    Full Text Available Se realizó la estandarización de la multiplicación y tuberización in vitro de ñame (Dioscorea alata L. utilizando el sistema de inmersión temporal conocido como RITA®. Se evaluó inicialmente el porcentaje de brotación de segmentos nodales en medio de cultivo semisólido utilizando dos tipos de citoquininas (BAP y Kinetina. Las plantas obtenidas fueron subcultivadas cada cuatro semanas y luego utilizadas para la obtención de meristemos y plántulas para llevar a cabo los diferentes experimentos en sistema de inmersión temporal. Se obtuvo un mayor porcentaje de explantes brotados al utilizar Kinetina. Con el sistema RITA® se evaluó el efecto de la densidad de explantes sobre la tasa de multiplicación y sobre la inducción, formación y desarrollo de microtubérculos, no encontrándose diferencias estadísticamente significativas entre las densidades evaluadas. De igual manera, se evaluó el efecto de diferentes frecuencias y tiempos de inmersión sobre la tasa de multiplicación, encontrándose que a una frecuencia de inmersión cada 12 horas y durante 10 minutos se obtenía la formación de mayor número de nudos y mayor tamaño de las plantas a las cuatro semanas de cultivo. Al utilizar el sistema de inmersión temporal se alcanzaron mayores tasas de multiplicación y tuberización in vitro comparadas con el sistema de cultivo convencional. Demostrándose así, el potencial de estos sistemas para implementar un programa de producción de semillas de ñame.Multiplication rate and in vitro tuberización of yam (Dioscorea alata L. was made using the temporary immersion system RITA®. Shoot percentage of nodal segments was initially evaluated in semisolid medium using two cytokinin types ((BAP and Kinetin. The obtained plants were subcultured every four weeks and then used to obtain meristems and plantlets to carry out different experiments in temporary immersion system. A higher sprouted explants percentage was obtained when using

  15. Diversidad genética intra e inter-específica de ñame (Dioscorea spp. de la región Caribe de Colombia mediante marcadores AFLP

    Hernando Javier Rivera-Jiménez

    2011-12-01

    Full Text Available Conocer la variabilidad genética del ñame, Dioscorea spp., permite apoyar estrategias de mejoramiento y conservación de este recurso fitogenético. El objetivo de este estudio fue la caracterización molecular de 20 accesiones de Dioscorea spp. mediante la técnica molecular de AFLP para determinar cómo se distribuye la variabilidad genética de manera intra e inter-específica. Los datos fueron analizados mediante los métodos de agrupación de correspondencia múltiple y análisis de similaridad de Dice, estableciendo los niveles de confiabilidad de los grupos genéticos mediante remuestreos. En términos de diversidad interespecífica, los valores promedios de similitud variaron entre 41.81% entre D. alata L. y D. rotundata Poir., y 33.51% entre D. trifida L.f. y D. esculenta (Lour. Burkill, lo que sugiere alta diversidad genética entre las accesiones estudiadas, que formaron cuatro grupos genéticos: D. alata, D. rotundata, D. esculenta y D. trifida, confirmando correspondencia entre la caracterización morfológica, clasificación botánica y la caracterización molecular. En términos de diversidad intraespecífica para la especie D. alata, el análisis también reveló una composición heterogénea en la región Caribe colombiana. Estos estudios ayudarán a definir una estrategia adecuada para fines de conservación y apoyar los esfuerzos futuros en los programas de mejoramiento genético.

  16. Final report, Ames Mobile Laboratory Project: The development and operation of instrumentation in a mobile laboratory for in situ, real-time screening and characterization of soils using the laser ablation sampling technique

    Anderson, M.S.; Braymen, S.D.

    1995-01-01

    The main focus of the Ames Laboratory's Technology Integration Program, TIP, from May 1991 through December 1994 was the development, fabrication, and demonstration of a mobile instrumentation laboratory incorporating rapid in situ sampling systems for safe, rapid, and cost effective soil screening/characterization. The Mobile Demonstration Laboratory for Environmental Screening Technologies, MDLEST, containing the analysis instrumentation, along with surface and subsurface sampling probe prototypes employing the laser ablation sampling technique were chosen to satisfy the particular surface and subsurface soil characterization needs of the various Department of Energy facilities for determining the extent of heavy metal and radionuclide contamination. The MDLEST, a 44 foot long 5th wheel trailer, is easily configured for the analysis instrumentation and sampling system required for the particular site work. This mobile laboratory contains all of the utilities needed to satisfy the operating requirements of the various instrumentation installed. These utilities include, an electric generator, a chilled water system, process gases, a heating/air conditioning system, and computer monitoring and automatic operating systems. Once the MDLEST arrives at the job site, the instrumentation is aligned and calibration is completed, sampling and analysis operations begin. The sample is acquired, analyzed and the results reported in as little as 10 minutes. The surface sampling probe is used in two modes to acquire samples for analysis. It is either set directly on the ground over the site to be sampled, in situ sampling, or in a special fixture used for calibrating the sampling analysis system with standard soil samples, having the samples brought to the MDLEST. The surface sampling probe was used to in situ sample a flat concrete surface (nondestructively) with the ablated sample being analyzed by the instrumentation in the MDLEST

  17. J ames Clerk Maxwell and his Equations

    standing importance in the development of physical ideas. Maxwell has been ... mathematics teacher was William Hopkins, the famous 'Wran- ... union (like Faraday's) was child- ... bility or to use any influence when he unsuccessfully tried for.

  18. Diversidad genética intra e inter-específica de ñame (Dioscorea spp. de la región Caribe de Colombia mediante marcadores AFLP

    Alvarez Soto Andres

    2011-12-01

    Full Text Available Conocer la variabilidad genética del ñameDioscorea spp., permite apoyar estrategias de mejoramiento y conservación de este recurso fitogenético. El objetivo de este estudio fue la caracterización molecular de 20 accesiones de Dioscorea spp. mediante la técnica molecular de AFLP para determinar cómo se distribuye la variabilidad genética de manera intra e inter-específica. Los datos fueron analizados mediante los métodos de agrupación de correspondencia múltiple y análisis de similaridad de Dice, estableciendo los niveles de confiabilidad de los grupos genéticos mediante remuestreos. En términos de diversidad interespecífica, los valores promedios de similitud variaron entre 41.81% entre D. alata L. y D. rotundata Poir., y 33.51% entre D. trifida L.f. y D. esculenta (Lour. Burkill, lo que sugiere alta diversidad genética entre las accesiones estudiadas, que formaron cuatro grupos genéticos: D. alataD. rotundataD. esculenta y D. trifida, confirmando correspondencia entre la caracterización morfológica, clasificación botánica y la caracterización molecular. En términos de diversidad intraespecífica para la especie D. alata, el análisis también reveló una composición heterogénea en la región Caribe colombiana. Estos estudios ayudarán a definir una estrategia adecuada para fines de conservación y apoyar los esfuerzos futuros en los programas de mejoramiento genético.

  19. Results of an investigation to determine local flow characteristics at the air data probe locations using an 0.030-scale model (45-0) of the space shuttle vehicle orbiter configuration 140A/B (modified) in the NASA Ames Research Center unitary plan wind tunnel (OA161, A, B, C), volume 1

    Nichols, M. E.

    1976-01-01

    Results are presented of wind tunnel test 0A161 of a 0.030-scale model 45-0 of the configuration 140A/B (modified) space shuttle vehicle orbiter in the NASA Ames Research Center Unitary Plan Wind Tunnel facilities. The purpose of this test was to determine local total and static pressure environments for the air data probe locations and relative effectiveness of alternate flight-test probe configurations. Testing was done in the Mach number range from 0.30 to 3.5. Angle of attack was varied from -8 to 25 degrees while sideslip varied between -8 and 8 degrees.

  20. Results of a M = 5.3 heat transfer test of the integrated vehicle using phase-change paint techniques on the 0.0175-scale model 56-OTS in the NASA/Ames Research Center 3.5-foot hypersonic wind tunnel

    Marroquin, J.

    1985-01-01

    An experimental investigation was performed in the NASA/Ames Research Center 3.5-foot Hypersonic Wind Tunnel to obtain supersonic heat-distribution data in areas between the orbiter and external tank using phase-change paint techniques. The tests used Novamide SSV Model 56-OTS in the first and second-stage ascent configurations. Data were obtained at a nominal Mach number of 5.3 and a Reynolds number per foot of 5 x 10 to the 6th power with angles of attack of 0 deg, +/- 5 deg, and sideslip angles of 0 deg and +/- 5 deg.

  1. Study of the heavy ions (Au+Au at 150 AMeV) collisions with the FOPI detector. Comparison with the Landau-Vlasov model; Etude des collisions d`ions lourds AU+AU a 150 A.MeV avec le detecteur FOPI. Comparaison avec le modele de Landau-Vlasov

    Boussange, S

    1995-09-15

    In this thesis, heavy ions (Au+Au) collisions experiments are made at 150 AMeV.In the first part, a general study of the nuclear matter equation is presented. Then the used Landau-Vlasov theoretical model is describe. The third part presents the FOPI experience and the details of how to obtain this theoretical predictions (filter, cuts, corrections, possible centrality selections).At the end, experimental results and comparisons with the Landau-Vlasov model are presented. (TEC). 105 refs., 96 figs., 14 tabs.

  2. CARACTERÍSTICAS FISICOQUÍMICAS Y MORFOLÓGICAS DE RIZÓFOROS DE ÑAME (Dioscorea alata) CARACTERÍSTICAS FÍSICOQUÍMICAS E MORFOLÓGICAS DE RIZÓFOROS DE INHAME (Dioscorea alata) PHYSICOCHEMICAL AND MORPHOLOGIC CHARACTERISTICS OF THE RIZÓFOROS OF YAM (Dioscorea alata)

    CLÁUDIA DENISE DE PAULA; MÔNICA PIROZI; MARIO PUIATTI; JOÃO T. BORGES; ALBA M. DURANGO

    2012-01-01

    En este trabajo se determino la composición físico-química y las características morfológicas de los rizóforos de seis variedades de ñame (Dioscorea alata) del Banco de Germoplasma de Hortalizas (BGH) de la Universidade Federal de Viçosa (UFV). Fue determinada la composición centesimal mediante análisis de humedad, lípidos, proteína, cenizas, fibra bruta y carbohidratos. Las características morfológicas fueron estudiadas visualmente y por análisis microscópicos. La composición físico-química ...

  3. Indigenous Communities and Cross­Strait Rapprochement: A Case Study of Chun­-ri and Shih-­wen

    Andi Kao

    2015-08-01

    Full Text Available Absent from most public debates on Taiwan’s embrace of neoliberal capitalism are the potential consequences of economic liberalization for Taiwan’s indigenous peoples. Deregulating markets and unfettering capital and resources are tied inextricably with cross-Strait politics. With a deep-seated apprehension of China still felt in many corners of the Taiwanese society, these issues are often framed with particular emphasis on the “China Factor”, overshadowing other relevant economic and societal considerations and thereby narrowing the scope of debate over government policies. Nevertheless, the potential influx of foreign capital investment, long- and short-term migrant labor and international visitors may have profound effects on Taiwan’s most vulnerable citizens, including the indigenous peoples. This paper will report the results of field research conducted among the Paiwan ethnic group, assessing actual and potential future changes affecting their individual families and communities. Preliminary assessment indicates that official policies liberalizing visitation and trade between China and Taiwan have already affected the Paiwan communities. Whether these changes become handicaps or opportunities depends on realistic evaluation, strategic planning, education, implementation, and periodic re-evaluation. This paper will contribute to the larger discussion of possible responses to the effects of inter-regional migration and transformations on minority societies by providing an assessment of current and potential conditions among the Paiwan of Taiwan.

  4. Static and wind tunnel near-field/far-field jet noise measurements from model scale single-flow base line and suppressor nozzles. Summary report. [conducted in the Boeing large anechoic test chamber and the NASA-Ames 40by 80-foot wind tunnel

    Jaeck, C. L.

    1977-01-01

    A test program was conducted in the Boeing large anechoic test chamber and the NASA-Ames 40- by 80-foot wind tunnel to study the near- and far-field jet noise characteristics of six baseline and suppressor nozzles. Static and wind-on noise source locations were determined. A technique for extrapolating near field jet noise measurements into the far field was established. It was determined if flight effects measured in the near field are the same as those in the far field. The flight effects on the jet noise levels of the baseline and suppressor nozzles were determined. Test models included a 15.24-cm round convergent nozzle, an annular nozzle with and without ejector, a 20-lobe nozzle with and without ejector, and a 57-tube nozzle with lined ejector. The static free-field test in the anechoic chamber covered nozzle pressure ratios from 1.44 to 2.25 and jet velocities from 412 to 594 m/s at a total temperature of 844 K. The wind tunnel flight effects test repeated these nozzle test conditions with ambient velocities of 0 to 92 m/s.

  5. Cassava, yam, sweet potato and ñampi starch: functional properties and possible applications in the food industry. Harinas y almidones de yuca, ñame, camote y ñampí: propiedades funcionales y posibles aplicaciones en la industria alimentaria.

    Pedro Vargas Aguilar

    2013-03-01

    Full Text Available A technical review was conducted to related physical and chemical properties of flours and starches from cassava, yams, taro and sweet potato. Amyloseamylopectin content, viscosity, nutritional value and fiber, were studied to relate them with starch functional properties. A relationship was obtained between amylose-amylopectin, viscosity and fiber content with the digestibility of those starches and the glycemic index values. The use of fermentation to enhance the nutritional value of these starches is known. Starch fermentation allows the production of gluten-free bread and energy drinks as an option to diversify products. It was also observed the relationship between the starch viscosity and the fat absorption in fried foods.Se realizó una revisión de las características fisicoquímicas de las harinas y almidones de yuca, ñame, ñampí y camote, tales como el contenido de amilosa-amilopectina, la viscosidad, el valor nutricional y la fibra, con el fin de relacionarlas con sus propiedades funcionales y técnico-funcionales. Se obtuvo una relación entre el contenido de amilosa-amilopectina, viscosidad y contenido de fibra en la digestibilidad de estos almidones y los valores de índice glicémico. Se encontró que es posible introducir modificaciones por medio de la fermentación para mejorar el valor funcional de estos almidones. La fermentación permite elaborar pan sin gluten y bebidas energéticas como nuevas opciones de productos. También se encontró que existe una relación entre la viscosidad de los almidones y la disminución de absorción de la grasa en frituras.

  6. NASA Ames Summer High School Apprenticeship Research Program

    1988-09-01

    microorganisms, or by producing mutant bacteria and new breeds, interfering with the original destiny of Jovian evolution. And how would we know, many years...Spacelab mission, Spacelab Japan (SL-J), frog embryos will be fertilized in space in the frog embryology unit (FEU--fig. 3). Knowledge of embryology in...limited to animal embryos that develop quickly, which is necessary in a seven-to-ten-day shuttle flight. The rapid dovelopment of frog embryos makes

  7. NASA-Ames Summer High School Apprenticeship Research Program (SHARP)

    Powell, P.

    1983-01-01

    The function of SHARP is to recognize high school juniors who have demonstrated unusually high promise for sucess in mathemtics and science. Twenty academically talented students who will be seniors in high school in September were chosen to participate in SHARP 83. Mentors were selected to provide students with first-hand experiences in a research and development environment in order that each student might try out his or her tentative professional career choice. Some special features of SHARP included field trips to private industries doing similar and related research, special lectures on topics of research here at ARC, individual and group counseling sessions, written research papers and oral reports, and primarily the opportunity to be exposed to the present frontiers in space exploration and research. The long-range goal of SHARP is to contribute to the future recruitment of needed scientists and engineers. This final report is summary of all the phases of the planning and implemenation of the 1983 Summer High School Apprenticeship Research Program (SHARP).

  8. NASA Ames Summer High School Apprenticeship Research Program

    Powell, P.

    1985-01-01

    The Summer High School Apprenticeship Research Program (SHARP) is described. This program is designed to provide engineering experience for gifted female and minority high school students. The students from this work study program which features trips, lectures, written reports, and job experience describe their individual work with their mentors.

  9. PEMULIHAN KOMUNITAS KARANG KERAS PASCA PEMUTIHAN KARANG DI AMED BALI

    Omega Raya Simarangkir

    2015-08-01

    Full Text Available Climate change is now recognized as one of the greatest threats to worldwide coral reefs with one of the most serious and immediate threats of mass coral bleaching associated with increasing sea temperatures. Coral bleaching occurred in a few coral reefs throughout the world in 2010. Coral reef in Amed’s coastal area was the one of the reefs that experienced and affected by coral bleeching incident. This study aims to assess recovery of hard coral community in post-bleaching in 2010. A survey method was used to collect primary data. Data sets also supported by secondary data. This study results were hard coral community recovered in 2013, as its percentage cover increased up to 49.00%. However, macroalgae decreased up to 0.67%. Hard coral recruitment in 2013 increased up to 21 individual/m2.

  10. Pros and Cons amification and aming in Classroom

    Iulian Furdu

    2017-07-01

    Full Text Available The aim of the current work is to assess the challenges that gamification in education are facing nowadays. Benefits and disadvantages of using gamification in classroom are both discussed to offer a clearer view on the impact of using gamification within learning process. Exploratory study –cases are provided to investigate the relation between motivation and engagement of the students and gamification in training. Following this idea, a survey was conducted to assess how students’ behavior and motivation is affected by introducing a single, specific gamification element during a semester learning process. To stimulate competition among students, a ranking type plugin was introduced within the university learning management system used for extramural education. The results prove that motivation decreases by comparison to the previous semester.

  11. Topography and surface sediment distribution around Amee shoal Mormugao

    Ambre, N.V.

    stream_size 3 stream_content_type text/plain stream_name Recent_Adv_Mar_Archaeol_1991_113.pdf.txt stream_source_info Recent_Adv_Mar_Archaeol_1991_113.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  12. Ames Infusion Stories for NASA Annual Technology Report

    Smith, Brandon; Jan, Darrell Leslie; Venkatapathy, Ethiraj

    2015-01-01

    These are short (2-page) high-level summaries of technologies that have been infused - i.e., taken the next level. For example, 3DMAT started off as a Center Innovation Fund (CIF) project and graduated to the Game-changing Program (GCD), where it is being prepared for use in Orion. The Nano Entry System similarly started as CIF and graduated to GCD. The High Tortuosity Carbon Dioxide Conversion Device also started off as CIF and then received an award for further development from the NASA Innovative Advanced Concepts program (NIAC).

  13. Mechanical design of NASA Ames Research Center vertical motion simulator

    Engelbert, D. F.; Bakke, A. P.; Chargin, M. K.; Vallotton, W. C.

    1976-01-01

    NASA has designed and is constructing a new flight simulator with large vertical travel. Several aspects of the mechanical design of this Vertical Motion Simulator (VMS) are discussed, including the multiple rack and pinion vertical drive, a pneumatic equilibration system, and the friction-damped rigid link catenaries used as cable supports.

  14. Grounded theory in medical education research: AMEE Guide No. 70.

    Watling, Christopher J; Lingard, Lorelei

    2012-01-01

    Qualitative research in general and the grounded theory approach in particular, have become increasingly prominent in medical education research in recent years. In this Guide, we first provide a historical perspective on the origin and evolution of grounded theory. We then outline the principles underlying the grounded theory approach and the procedures for doing a grounded theory study, illustrating these elements with real examples. Next, we address key critiques of grounded theory, which continue to shape how the method is perceived and used. Finally, pitfalls and controversies in grounded theory research are examined to provide a balanced view of both the potential and the challenges of this approach. This Guide aims to assist researchers new to grounded theory to approach their studies in a disciplined and rigorous fashion, to challenge experienced researchers to reflect on their assumptions, and to arm readers of medical education research with an approach to critically appraising the quality of grounded theory studies.

  15. Second Annual NASA Ames Space Science and Astrobiology Jamboree

    Dotson, Jessie

    2014-01-01

    The Space Science and Astrobiology Division's researchers are pursuing investigations in a variety of fields, including exoplanets, planetary science, astrobiology, and astrophysics. In addition division personnel support a wide variety of NASA missions. With a wide variety of interesting research going on, distributed among the three branches in at least 5 buildings, it can be difficult to stay abreast of what one's fellow researchers are doing. Our goal in organizing this symposium is to facilitate communication and collaboration among the scientist within the division and to give center management and other ARC researchers and Engineers an opportunity to see what scientific missions work is being done in the division.

  16. CARACTERÍSTICAS FISICOQUÍMICAS Y MORFOLÓGICAS DE RIZÓFOROS DE ÑAME (Dioscorea alata CARACTERÍSTICAS FÍSICOQUÍMICAS E MORFOLÓGICAS DE RIZÓFOROS DE INHAME (Dioscorea alata PHYSICOCHEMICAL AND MORPHOLOGIC CHARACTERISTICS OF THE RIZÓFOROS OF YAM (Dioscorea alata

    CLÁUDIA DENISE DE PAULA

    2012-12-01

    Full Text Available En este trabajo se determino la composición físico-química y las características morfológicas de los rizóforos de seis variedades de ñame (Dioscorea alata del Banco de Germoplasma de Hortalizas (BGH de la Universidade Federal de Viçosa (UFV. Fue determinada la composición centesimal mediante análisis de humedad, lípidos, proteína, cenizas, fibra bruta y carbohidratos. Las características morfológicas fueron estudiadas visualmente y por análisis microscópicos. La composición físico-química presento diferencias significativas (pNeste trabalho determinou-se a composição físico-química e características morfológicas dos rizóforos de seis variedades de inhame (Dioscorea alata do Banco de Germoplasma de Hortaliças (BGH da Universidade Federal de Viçosa (UFV. Foi determinada a composição centesimal mediante análises de umidade, lipídios, proteína, cinzas, fibra bruta e carboidratos. As características morfológicas foram estudadas através do aspecto visual e análises microscópicas. A composição físico-química apresentou diferenças significativas (pIn this paper we determine the physico-chemical and morphological characteristics of the rizóforos of six yam varieties (Dioscorea alafa from the Vegetable Germplasm Bankb (BGH, Universidade Federal de Viçosa (UFV. Proximate composition was determined by analysis of humidity, fat, protein, ash, crude fiber and carbohydrates. The morphological characteristics were studied visually and by microscopic analysis. The physical and chemical composition showed significant differences (p<0.05 for all features, except for lipids. The Florida variety stood out from the others by presenting higher values of ash (3.08 g/100g, protein (6.35 g/100g fiber (2.69 g/100g and lower total carbohydrate content. Visual assessment of the rizóforos varieties showed that Florida, San Tome and Mimoso were those with the most regular forms. According to the scanning electron micrograph, the

  17. Diversidad genética intra e inter-específica de ñame (Dioscorea spp. de la región Caribe de Colombia mediante marcadores AFLP Genetic diversity intra and inter-specific yam (Dioscorea spp. from the colombian caribbean region by AFLP markers

    Hernando Javier Rivera-Jiménez

    2011-12-01

    Full Text Available Conocer la variabilidad genética del ñame, Dioscorea spp., permite apoyar estrategias de mejoramiento y conservación de este recurso fitogenético. El objetivo de este estudio fue la caracterización molecular de 20 accesiones de Dioscorea spp. mediante la técnica molecular de AFLP para determinar cómo se distribuye la variabilidad genética de manera intra e inter-específica. Los datos fueron analizados mediante los métodos de agrupación de correspondencia múltiple y análisis de similaridad de Dice, estableciendo los niveles de confiabilidad de los grupos genéticos mediante remuestreos. En términos de diversidad interespecífica, los valores promedios de similitud variaron entre 41.81% entre D. alata L. y D. rotundata Poir., y 33.51% entre D. trifida L.f. y D. esculenta (Lour. Burkill, lo que sugiere alta diversidad genética entre las accesiones estudiadas, que formaron cuatro grupos genéticos: D. alata, D. rotundata, D. esculenta y D. trifida, confirmando correspondencia entre la caracterización morfológica, clasificación botánica y la caracterización molecular. En términos de diversidad intraespecífica para la especie D. alata, el análisis también reveló una composición heterogénea en la región Caribe colombiana. Estos estudios ayudarán a definir una estrategia adecuada para fines de conservación y apoyar los esfuerzos futuros en los programas de mejoramiento genético.Knowing the genetic variability of yams, Dioscorea spp., is a good tool to support development and conservation strategies of this plant as genetic resource. The aim of this study was to carried out the molecular characterization of 20 accessions of Dioscorea spp. using the AFLP molecular technique to determine how genetic variation is distributed intra-and inter-specifically. Using multiple correspondence analysis and level of reliability of the genetic groups by resampling, the results showed high genetic variability among the accessions studied

  18. Sadhana | Indian Academy of Sciences

    Home; Journals; Sadhana. SHIH-HENG TUNG. Articles written in Sadhana. Volume 33 Issue 6 December 2008 pp 767-779. Development of digital image correlation method to analyse crack variations of masonry wall · Shih-Heng Tung Ming-Hsiang Shih Wen-Pei Sung · More Details Abstract Fulltext PDF. The detection of ...

  19. Sadhana | Indian Academy of Sciences

    Home; Journals; Sadhana. MING-HSIANG SHIH. Articles written in Sadhana. Volume 33 Issue 6 December 2008 pp 767-779. Development of digital image correlation method to analyse crack variations of masonry wall · Shih-Heng Tung Ming-Hsiang Shih Wen-Pei Sung · More Details Abstract Fulltext PDF. The detection ...

  20. Sadhana | Indian Academy of Sciences

    Home; Journals; Sadhana. Ming-Hsiang Shih. Articles written in Sadhana. Volume 33 Issue 6 December 2008 pp 767-779. Development of digital image correlation method to analyse crack variations of masonry wall · Shih-Heng Tung Ming-Hsiang Shih Wen-Pei Sung · More Details Abstract Fulltext PDF. The detection of ...

  1. Retrospective of photography at NASA Ames Research Center from 1940 to 1996 (Extended Abstract)

    Ponseggi, Bernard G.

    1997-05-01

    This paper deals with what is known as photo/optical instrumentation technology and/or technical photography. In 1940 this was called photography, in the late 40's the Civil Service Commission introduced a new classification called photography/technical to differentiate between still photographers and those engaging in recording engineering data. In October of 1958 a historic event took place, Congress transferred all of the duties of NACA to a newly formed agency called NASA, and with it came a call for systems that would keep up with new requirements. There was a need to change the type and style of equipment to keep up with the demands for more accurate information. Existing hardware was modified and new hardware was developed and designed to meet the new requirements of space travel of manned and unmanned orbital vehicles. This family of equipment had to withstand the rigors of space travel such as extremely high `G' forces, temperature changes and `O' gravity, while on earth we needed equipment to document launch of space vehicles as well as wind tunnel testing, rocket sled stands etc.. Some requirements were similar to those of launch vehicles, some were totally different and had other requirements, eventually they were all resolved. As electronic data systems became available NASA experimented with their use in data acquisition. This portion of this session will discuss the changes over the years and their effect on the acquisition of data, those that worked, as well as those that were a disappointment.

  2. Use of Site Characterization and Analysis Penetrometer System at the Walnut Creek Watershed, Ames, Iowa

    1993-08-01

    grout is pumped through a central tube in the push rod cable and exits through the probe tip. Retraction grouting (as the rod is withdrawn through the...soil) with a microfine Portland cement grout is normally utilized for all projects; however, subfreezing weather mandated that post - retraction grouting...ELECTRODES (4) P2 RESISTIVITY C2 MODULE GROUTING TUBES (2) 24 IN(61 CM) Grout Injector -- 1.4 IN(3.57 CM) o.D. 0" RINGS GROUTING CONE SLEEVE FRICTION

  3. NASA Ames Summer High School Apprenticeship Research Program: 1986 research papers

    Powell, Patricia

    1988-01-01

    Engineering enrollments are rising in universities; however the graduate engineering shortage continues. Particularly, women and minorities will be underrepresented for many years. As one means of solving this shortage, Federal agencies facing future scientific and technological challenges were asked to participate in the Summer High School Apprenticeship Research Program (SHARP). This program was created to provide an engineering experience for gifted female and minority high school students at an age when they could still make career and education decisions. The SHARP program is designed for high school juniors who are U.S. citizens, are 16 years old, and who have very high promise in math and science through outstanding academic performance in high school. Students who are accepted into this summer program will earn as they learn by working 8 hr days in a 5-day work week. Reports from SHARP students are presented.

  4. NASA Ames summary high school apprenticeship research program, 1983 research papers

    Powell, P.

    1984-01-01

    Engineering enrollments are rising in universities; however, the graduate engineer shortage continues. Particularly, women and minorities will be underrepresented for years to come. As one means of solving this shortage, Federal agencies facing future scientific and technological challenges were asked to participate in the Summer High School Apprenticeship Research Program (SHARP). This program was created 4 years ago to provide an engineering experience for gifted female and minority high school students at an age when they could still make career and education decisions. The SHARP Program is designed for high school juniors (women and minorities) who are U.S. citizens, are 16 years old, and who have unusually high promise in mathematics and science through outstanding academic performance in high school. Students who are accepted into this summer program will earn as they learn by working 8 hours a day in a 5-day work week. This work-study program features weekly field trips, lectures and written reports, and job experience related to the student's career interests.

  5. Teaching diversity to medical undergraduates: Curriculum development, delivery and assessment. AMEE GUIDE No. 103.

    Dogra, Nisha; Bhatti, Farah; Ertubey, Candan; Kelly, Moira; Rowlands, Angela; Singh, Davinder; Turner, Margot

    2016-01-01

    The aim of this Guide is to support teacher with the responsibility of designing, delivering and/or assessing diversity education. Although, the focus is on medical education, the guidance is relevant to all healthcare professionals. The Guide begins by providing an overview of the definitions used and the principles that underpin the teaching of diversity as advocated by Diversity and Medicine in Health (DIMAH). Following an outline of these principles we highlight the difference between equality and diversity education. The Guide then covers diversity education throughout the educational process from the philosophical stance of educators and how this influences the approaches used through to curriculum development, delivery and assessment. Appendices contain practical examples from across the UK, covering lesson plans and specific exercises to deliver teaching. Although, diversity education remains variable and fragmented there is now some momentum to ensure that the principles of good educational practice are applied to diversity education. The nature of this topic means that there are a range of different professions and medical disciplines involved which leads to a great necessity for greater collaboration and sharing of effective practice.

  6. Modification of γ-induced mutagenesis in Ames test-strains

    Basha, S.G.; Krasavin, E.A.; Kozubek, S.; Amirtaev, K.G.

    1990-01-01

    Glycerine and cysteamine protective effect on mutagenesis was studied in 3 strains of Salmonella typhimurium under γ-radiation. Glycerine modifying effect was shown to be not similar for various test-strains and depended on DNA injury nature. DNA complex injuries were shown to play significant role in mutagenesis of TA100 and TA102 strains. Absence of cysteamine modifying effect on γ-induced mutagenesis testified to cysteamine effect on enzyme balance. 20 refs.; 2 figs.; 1 tab

  7. Quantitative and qualitative methods in medical education research: AMEE Guide No 90: Part I.

    Tavakol, Mohsen; Sandars, John

    2014-09-01

    Medical educators need to understand and conduct medical education research in order to make informed decisions based on the best evidence, rather than rely on their own hunches. The purpose of this Guide is to provide medical educators, especially those who are new to medical education research, with a basic understanding of how quantitative and qualitative methods contribute to the medical education evidence base through their different inquiry approaches and also how to select the most appropriate inquiry approach to answer their research questions.

  8. Inverse-kinematics study of 78Kr + 40Ca at 10 AMeV

    Henry E.

    2015-01-01

    Full Text Available The CHIMERA multi-detector array at LNS Catania has been used to study the inverse-kinematics reaction of 78Kr + 40Ca at a bombarding energy of 10 A MeV. Analysis of the experimental data focused on a class of selected events consistent with the complete fusion and subsequent binary split of the of the reacting system. This class of events features a broad A, Z distribution of fission fragments centered about symmetric fission while exhibiting relative velocities significantly higher than given by Viola systematics. The center-of-mass angular distribution (dσ/dΘ of the fission fragments exhibit an unexpected anisotropy inconsistent with a compound-nucleus reaction and indicates a dynamic fusion-fission like process. The observed angular distribution features an asymmetric forward-backward peaking most prevalent for mass-asymmetric events. Furthermore, the more massive fragment of mass-asymmetric events appears to emerge preferentially in the forward direction, along the beam axis, in analogy to dynamic fragmentation of projectile-like fragments. Analysis of the angular distribution of alpha particles emitted from these fission fragments suggests the events are associated mostly with central collisions.

  9. Mutagenicity Evaluation of Ammonium Picrate in the Ames Salmonella/Microsome Plate Test. Segment Report,

    1979-02-01

    used by the I study director, and any % ppendices . All test and control results presented in this report are suppreted by raw data .which are permanently...dosage selection results are presented in Table 1. The acute and subchronic test results have been collected from raw data sheets and tabulated in...breakage in bone marrow cells of mice following oral exposure (per os). Both acute and subchronic dosing schedules were employed in this assay. Results

  10. Biochemistry for Medical Students: A Flexible Student-Oriented Approach. AMEE Case Study No. 3

    Macqueen, D.; And Others

    1976-01-01

    A personalized account of some experiences in the Department of Biochemistry at the University of Dundee during a radical revision of the course for medical students is offered. Innovations of the course are described in detail. (LBH)

  11. Curriculum development for the workplace using Entrustable Professional Activities (EPAs): AMEE Guide No. 99.

    ten Cate, TJ; Chen, H.C.; Hoff, RG; Peters, H.; Bok, H.; van der Schaaf, M.F.

    2015-01-01

    This Guide was written to support educators interested in building a competency-based workplace curriculum. It aims to provide an up-to-date overview of the literature on Entrustable Professional Activities (EPAs), supplemented with suggestions for practical application to curriculum construction,

  12. Curriculum development for the workplace using Entrustable Professional Activities (EPAs) : AMEE Guide No. 99

    ten Cate, Th.J.; Chen, Huiju Carrie; Hoff, Reinier; Bok, Harold|info:eu-repo/dai/nl/323072356; Peters, Harm; van der Schaaf, Marieke|info:eu-repo/dai/nl/073361917

    2015-01-01

    This Guide was written to support educators interested in building a competency-based workplace curriculum. It aims to provide an up-to-date overview of the literature on Entrustable Professional Activities (EPAs), supplemented with suggestions for practical application to curriculum construction,

  13. English language usage pattern in China mainland doctors: AME survey-001 initial analysis results.

    Zhang, Zhongheng; Wáng, Yì-Xiáng J

    2015-02-01

    English is the most widely used language in medical community worldwide. Till now there is no study yet on how English language is being used among mainland Chinese doctors. The present survey aimed to address this question. An online cross-sectional survey was carried out during the period of 23 Oct 2014 to 13 November 2014, totaling 22 days. This survey was conducted on the platform provided by DXY (www.dxy.cn), which is the largest medical and paramedical related website in China with registered medical doctor users of slightly more than one million. E-mails were sent to all DXY registered users to invite them to participate the survey which lasts approximately five-minute. The questionnaire included three major aspects: (I) the demographic characteristics of participants; (II) English reading pattern; and (III) paper publishing experience in international journals. To accommodate the complexity of relationships among variables, structural equation modeling (SEM) was employed to build the model. In total 1,663 DXY users completed the survey, which counted for ≈1% of the total registered medical doctor users. There were more participants from relatively economically developed eastern coast areas. The age of participants was 33.6±7.4 years. There were 910 respondents from teaching hospitals (54.72%), followed by tertiary care hospitals (class-III hospital, 22.37%). Mainland Chinese doctors were more likely to consult medical materials in Chinese (63.5%) when they encounter clinical difficulties. Participants who were able to list English journals of their own specialty up to four were 44.02% for 0, 13.77% for one journal, 13.89% for two journals, 9.26% for three journals, and 19.06% for four journals. Most participants (82.86%) have read at least one English paper or one professional book in English, while 17.14% responded they never read a single English paper or professorial book in English. About 30.42% participants published at least one paper in English journals, and approximately half of them require professional English editing service. This limited survey shows Mainland Chinese doctors are more likely to use Chinese medical materials. Overall their familiarity with international English journals is relatively low. Improving English education at the undergraduate and post-graduate levels is recommended.

  14. Ames Culture Chamber System: Enabling Model Organism Research Aboard the international Space Station

    Steele, Marianne

    2014-01-01

    Understanding the genetic, physiological, and behavioral effects of spaceflight on living organisms and elucidating the molecular mechanisms that underlie these effects are high priorities for NASA. Certain organisms, known as model organisms, are widely studied to help researchers better understand how all biological systems function. Small model organisms such as nem-atodes, slime mold, bacteria, green algae, yeast, and moss can be used to study the effects of micro- and reduced gravity at both the cellular and systems level over multiple generations. Many model organisms have sequenced genomes and published data sets on their transcriptomes and proteomes that enable scientific investigations of the molecular mechanisms underlying the adaptations of these organisms to space flight.

  15. Quality assurance software inspections at NASA Ames: Metrics for feedback and modification

    Wenneson, G.

    1985-01-01

    Software inspections are a set of formal technical review procedures held at selected key points during software development in order to find defects in software documents--is described in terms of history, participants, tools, procedures, statistics, and database analysis.

  16. Cognitive Load Theory: implications for medical education: AMEE Guide No. 86.

    Young, John Q; Van Merrienboer, Jeroen; Durning, Steve; Ten Cate, Olle

    2014-05-01

    Cognitive Load Theory (CLT) builds upon established models of human memory that include the subsystems of sensory, working and long-term memory. Working memory (WM) can only process a limited number of information elements at any given time. This constraint creates a "bottleneck" for learning. CLT identifies three types of cognitive load that impact WM: intrinsic load (associated with performing essential aspects of the task), extraneous load (associated with non-essential aspects of the task) and germane load (associated with the deliberate use of cognitive strategies that facilitate learning). When the cognitive load associated with a task exceeds the learner's WM capacity, performance and learning is impaired. To facilitate learning, CLT researchers have developed instructional techniques that decrease extraneous load (e.g. worked examples), titrate intrinsic load to the developmental stage of the learner (e.g. simplify task without decontextualizing) and ensure that unused WM capacity is dedicated to germane load, i.e. cognitive learning strategies. A number of instructional techniques have been empirically tested. As learners' progress, curricula must also attend to the expertise-reversal effect. Instructional techniques that facilitate learning among early learners may not help and may even interfere with learning among more advanced learners. CLT has particular relevance to medical education because many of the professional activities to be learned require the simultaneous integration of multiple and varied sets of knowledge, skills and behaviors at a specific time and place. These activities possess high "element interactivity" and therefore impose a cognitive load that may surpass the WM capacity of the learner. Applications to various medical education settings (classroom, workplace and self-directed learning) are explored.

  17. Aligning physical learning spaces with the curriculum: AMEE Guide No. 107.

    Nordquist, Jonas; Sundberg, Kristina; Laing, Andrew

    2016-08-01

    This Guide explores emerging issues on the alignment of learning spaces with the changing curriculum in medical education. As technology and new teaching methods have altered the nature of learning in medical education, it is necessary to re-think how physical learning spaces are aligned with the curriculum. The better alignment of learning spaces with the curriculum depends on more directly engaged leadership from faculty and the community of medical education for briefing the requirements for the design of all kinds of learning spaces. However, there is a lack of precedent and well-established processes as to how new kinds of learning spaces should be programmed. Such programmes are essential aspects of optimizing the intended experience of the curriculum. Faculty and the learning community need better tools and instruments to support their leadership role in briefing and programming. A Guide to critical concepts for exploring the alignment of curriculum and learning spaces is provided. The idea of a networked learning landscape is introduced as a way of assessing and evaluating the alignment of physical spaces to the emerging curriculum. The concept is used to explore how technology has widened the range of spaces and places in which learning happens as well as enabling new styles of learning. The networked learning landscaped is explored through four different scales within which learning is accommodated: the classroom, the building, the campus, and the city. High-level guidance on the process of briefing for the networked learning landscape is provided, to take into account the wider scale of learning spaces and the impact of technology. Key to a successful measurement process is argued to be the involvement of relevant academic stakeholders who can identify the strategic direction and purpose for the design of the learning environments in relation to the emerging demands of the curriculum.

  18. Self-regulation theory: applications to medical education: AMEE Guide No. 58.

    Sandars, John; Cleary, Timothy J

    2011-01-01

    Self-regulation theory, as applied to medical education, describes the cyclical control of academic and clinical performance through several key processes that include goal-directed behaviour, use of specific strategies to attain goals, and the adaptation and modification to behaviours or strategies to optimise learning and performance. Extensive research across a variety of non-medical disciplines has highlighted differences in key self-regulation processes between high- and low-achieving learners and performers. Structured identification of key self-regulation processes can be used to develop specific remediation approaches that can improve performance in academic and complex psycho-motor skills. General teaching approaches that are guided by a self-regulation perspective can also enhance academic performance. Self-regulation theory offers an exciting potential for improving academic and clinical performance in medical education.

  19. Situational judgement tests in medical education and training: Research, theory and practice: AMEE Guide No. 100.

    Patterson, Fiona; Zibarras, Lara; Ashworth, Vicki

    2016-01-01

    Why use SJTs? Traditionally, selection into medical education professions has focused primarily upon academic ability alone. This approach has been questioned more recently, as although academic attainment predicts performance early in training, research shows it has less predictive power for demonstrating competence in postgraduate clinical practice. Such evidence, coupled with an increasing focus on individuals working in healthcare roles displaying the core values of compassionate care, benevolence and respect, illustrates that individuals should be selected on attributes other than academic ability alone. Moreover, there are mounting calls to widen access to medicine, to ensure that selection methods do not unfairly disadvantage individuals from specific groups (e.g. regarding ethnicity or socio-economic status), so that the future workforce adequately represents society as a whole. These drivers necessitate a method of assessment that allows individuals to be selected on important non-academic attributes that are desirable in healthcare professionals, in a fair, reliable and valid way. What are SJTs? Situational judgement tests (SJTs) are tests used to assess individuals' reactions to a number of hypothetical role-relevant scenarios, which reflect situations candidates are likely to encounter in the target role. These scenarios are based on a detailed analysis of the role and should be developed in collaboration with subject matter experts, in order to accurately assess the key attributes that are associated with competent performance. From a theoretical perspective, SJTs are believed to measure prosocial Implicit Trait Policies (ITPs), which are shaped by socialisation processes that teach the utility of expressing certain traits in different settings such as agreeable expressions (e.g. helping others in need), or disagreeable actions (e.g. advancing ones own interest at others, expense). Are SJTs reliable, valid and fair? Several studies, including good quality meta-analytic and longitudinal research, consistently show that SJTs used in many different occupational groups are reliable and valid. Although there is over 40 years of research evidence available on SJTs, it is only within the past 10 years that SJTs have been used for recruitment into medicine. Specifically, evidence consistently shows that SJTs used in medical selection have good reliability, and predict performance across a range of medical professions, including performance in general practice, in early years (foundation training as a junior doctor) and for medical school admissions. In addition, SJTs have been found to have significant added value (incremental validity) over and above other selection methods such as knowledge tests, measures of cognitive ability, personality tests and application forms. Regarding differential attainment, generally SJTs have been found to have lower adverse impact compared to other selection methods, such as cognitive ability tests. SJTs have the benefit of being appropriate both for use in selection where candidates are novices (i.e. have no prior role experience or knowledge such as in medical school admissions) as well as settings where candidates have substantial job knowledge and specific experience (as in postgraduate recruitment for more senior roles). An SJT specification (e.g. scenario content, response instructions and format) may differ depending on the level of job knowledge required. Research consistently shows that SJTs are usually found to be positively received by candidates compared to other selection tests such as cognitive ability and personality tests. Practically, SJTs are difficult to design effectively, and significant expertise is required to build a reliable and valid SJT. Once designed however, SJTs are cost efficient to administer to large numbers of candidates compared to other tests of non-academic attributes (e.g. personal statements, structured interviews), as they are standardised and can be computer-delivered and machine-marked.

  20. Situativity theory: a perspective on how participants and the environment can interact: AMEE Guide no. 52.

    Durning, Steven J; Artino, Anthony R

    2011-01-01

    Situativity theory refers to theoretical frameworks which argue that knowledge, thinking, and learning are situated (or located) in experience. The importance of context to these theories is paramount, including the unique contribution of the environment to knowledge, thinking, and learning; indeed, they argue that knowledge, thinking, and learning cannot be separated from (they are dependent upon) context. Situativity theory includes situated cognition, situated learning, ecological psychology, and distributed cognition. In this Guide, we first outline key tenets of situativity theory and then compare situativity theory to information processing theory; we suspect that the reader may be quite familiar with the latter, which has prevailed in medical education research. Contrasting situativity theory with information processing theory also serves to highlight some unique potential contributions of situativity theory to work in medical education. Further, we discuss each of these situativity theories and then relate the theories to the clinical context. Examples and illustrations for each of the theories are used throughout. We will conclude with some potential considerations for future exploration. Some implications of situativity theory include: a new way of approaching knowledge and how experience and the environment impact knowledge, thinking, and learning; recognizing that the situativity framework can be a useful tool to "diagnose" the teaching or clinical event; the notion that increasing individual responsibility and participation in a community (i.e., increasing "belonging") is essential to learning; understanding that the teaching and clinical environment can be complex (i.e., non-linear and multi-level); recognizing that explicit attention to how participants in a group interact with each other (not only with the teacher) and how the associated learning artifacts, such as computers, can meaningfully impact learning.

  1. Analysis of (3He, t) charge exchange reactions at 140 AMeV

    Singh, Pardeep; Zegers, R.G.T.; Danielewicz, Pawel; Noji, S.; Kim, B.T.; Sakai, H.

    2014-01-01

    The spin-isospin response in nuclei has been studied widely through ( 3 He, t) and (t, 3 He) charge-exchange reactions wherein a proton (neutron) transforms into a neutron (proton), which in turn changes the isospin, ΔT=1, of the nuclei participating in the reaction, either with or without spin transfer. The Gamow-Teller transitions are used to obtain the weak transition strength in the excitation-energy regions inaccessible through β-decay. The strengths deduced using charge exchange experiments provide stringent tests for nuclear structure calculations and serve as inputs for variety of applications in which weak transition strengths play a role. In this context, we explore here the ( 3 He,t) charge-exchange reaction at 140 MeV/u on 18 O, 26 Mg, 58,60,62, 64 Ni, 90 Zr, 118,120 Sn and 208 Pb targets, within the theoretical framework of distorted wave impulse approximation

  2. NATO Handbook on the Medical Aspects of NBC Defensive Operations AMedP-6(B)

    1996-02-01

    1979. Alter, W. A., and Conklin, J. J. "Radiation Casualties" in: Handbook of Disaster Medicine . Medical Examination Publishing Co., 1983. Berdjis...disturbance produced in indoles (such as LSD) or the cannabinols (such as marihuana extracts) is not really delirium, because the casualties remain... medicinal properties similar to those of inorganic arsenic to which it is partially reduced in the body. However, no reduction to trivalent arsenic

  3. Tools for 3D scientific visualization in computational aerodynamics at NASA Ames Research Center

    Bancroft, G.; Plessel, T.; Merritt, F.; Watson, V.

    1989-01-01

    Hardware, software, and techniques used by the Fluid Dynamics Division (NASA) for performing visualization of computational aerodynamics, which can be applied to the visualization of flow fields from computer simulations of fluid dynamics about the Space Shuttle, are discussed. Three visualization techniques applied, post-processing, tracking, and steering, are described, as well as the post-processing software packages used, PLOT3D, SURF (Surface Modeller), GAS (Graphical Animation System), and FAST (Flow Analysis software Toolkit). Using post-processing methods a flow simulation was executed on a supercomputer and, after the simulation was complete, the results were processed for viewing. It is shown that the high-resolution, high-performance three-dimensional workstation combined with specially developed display and animation software provides a good tool for analyzing flow field solutions obtained from supercomputers. 7 refs

  4. Top five medical innovations in China mainland since Xinhai revolution [1911]: results of AME survey-002.

    Wáng, Yì-Xiáng J; Xiao, Fan

    2015-06-01

    This survey aims to scrutinize important medical innovations in Chinese mainland since Xinhai (Hsin-hai) revolution in 1911, which marked the end of Manchurian imperial rule and the beginning of China's republican era. An online cross-sectional survey was carried out during the period of Dec 29, 2014 to Feb 5, 2015, totaling 37 days. The survey was conducted on the platform provided by DXY (www.dxy.cn), which is the largest medical and paramedical related website in China. An email was sent to all DXY registered users to invite them to participate in a 5-minute survey. The participants were asked to nominate up to four important medical innovations in China mainland since Xinhai revolution. The participant could select 'zero' which means he/she felt there was no important medical innovations, or he/she did not know important medical innovations. It was noted that important medical innovations refer to (I) those with practical and almost immediate significance to improve healthcare; (II) should not only be introducing western technique to China, but those involve major improvement of existing western techniques count; (III) should not be those with important theoretical discovery but did not have almost immediate significance to improve healthcare. In total 1,513 DXY users participated in the voting. Totally 489 (32.3%), 441 (29.1%), 342 (22.6%), 150 (9.9%), 91 (6.0%) participants provided 0, 1, 2, 3, 4 nominations respectively. (I) Artemisine (Qinghaosu) for malaria treatment (Project 523 team, 1972); (II) arsenic Trioxide (As2O3) for acute promyelocytic leukemia (APL) treatment (ZHANG Ting-Dong and colleagues, 1970s); (III) limb re-plantation (CHEN Zhong-Wei and colleagues, 1963); (IV) all-trans retinoic acid (ATRA) for APL treatment (WANG Zhen-Yi and colleagues, 1988); and (V) Wu's mask for plague prevention (WU Lien-The, 1910), were voted as the top five innovations in China mainland since Xinhai revolution, with 375, 96, 91, 53, and 8 votes respectively. In this voting exercise, five achievements were voted as top innovations in China mainland since Xinhai revolution. However, only ATRA for APL treatment was accomplished after the ending of Great Proletarian Cultural Revolution in year 1976 in China.

  5. Assessing Mutagenicity of Methanolic Exteract of Borage Flower (Echium amuenum Using Ames Bioassay

    Meysam Moosavi

    2014-08-01

    Full Text Available Background: pyrrolizidine alkaloids have been isolated from Echium amuenum. These alkaloids knowing as hepatotoxic, damage the liver. Mutagenicity of pure pyrrolizidine alkaloids has been identified. Thus, the mutagenic effect of the methanolic flower extract was tested using Amest test. Materials and Methods: The long maceration process (for 48 hrs is carried out in order to extract all constitutes. Thin layer chromatography (TLC method was used to evaluate aflatoxin B1 contamination and histidine amino acid presence. Minimum inhibitory concentration (MIC was determined with the dilution method. Salmonella typhimurium strain TA100 was used to determination of mutagenicity. The genotype was confirmed by using histidine requirement, R- factor presence, rfa and uvrB mutations tests. The mutagenicity assay was performed by four extract concentrations (0.25, 0.5, 0.75 and 1mg/ml. Sodium azide (NaN3 and methanol were used as the mutagens (positive control and negative control, respectively in the absence or presence of liver-metabolizing enzymes. Results: The data indicate that Echium amuenum has not significant mutagenic activity against negative control. The presence of liver-metabolizing enzymes did not exhibit a significant change against the properties of extract. Conclusion: It seems that this extensive used plant in traditional medicine, doesn’t contain mutagenic or genotoxic effect in usual doses.

  6. 專論/部落格使用者的資訊行為特徵研究/高世樺;林頌堅 | A Study of Features of Blog Users' Information Behaviors / Shih-Hua Kao; Sung-Chien Lin

    高世樺、林頌堅

    2008-04-01

    Full Text Available

    部落格已經成為諸多新科技中最具有影響力的媒體之一,並對於使用者的資訊尋求行為造成影響。本研究整理部落格的相關概念及功能,並以二十位部落格使 用者的訪談結果對部落格上的資訊尋求行為特徵進行描述。研究結果顯示,使用者在部落格的開始動機、連結方式、辨別標準、監看與提取方式等等都展現了十分豐 富的行為特徵,研究並發現;(1情感聯繫是受訪者經常提及的使用目標,並且這種動機也影響了各種行為特徵;(2使用者會依照自我的需求以及所處的情境 發展出合適的使用方式,這些新使用方式可能不同於發明者與推廣者所設想的最便於使用的功能;(3部落格上的個人經驗是使用者進行資訊尋求的主要原因之 一;(4豐富而精緻的圖像經常能夠吸引使用者進入部落格。

    Blog has already become one of the most influential media among new technologies, and has impacted on users’ information seeking behaviors. This research  utilized an interview survey to explore related concepts and unique functions of blog media. Interviews with 20 blog users were completed and analyzed to depict characteristics of information seeking behaviors founded in the use of blogs. The result shows that the users had performed a variety of behavioral features in motivations of using blogs, ways of linking from one blog to another, criteria of identification among blogs, methods of blog monitoring and extracting and so forth. Some major observations were also found during the interviews conducted: (1 emotion connection is frequently mentioned by users as one of their main purposes of using blogs, which can be found in each characteristic of information seeking behaviors; (2 when users use new functions of blog, based on their respective needs and situations they can develop their own strategies and methods, which can be very different from those provided or assumed by inventors and promoters; (3 personal experience shared by bloggers is one of the primary reasons why users employ blogs to find information needed; (4 abundant and delicate images embedded in blogs can always attract users’ attention.

    頁次:62-77

  7. Genotoxicity investigation of araticum(Annona crassiflora Mart., 1841, Annonaceae using SOS-Inductest and Ames test

    JB. Vilar

    Full Text Available Although the use of medicinal plants or natural products has increased in recent decades all over the world, little information is available on their potential risk to health. Annona crassiflora Mart., a plant commonly known as araticum in Brazil, has been widely used in folk medicine for a long time since its seeds and leaves are often utilised in the treatment of cancer, snake bites, and venereal diseases, its fruits are consumed as tonic and astringent, and its bark powder has anti-fungal and anti-rheumatic properties. To evaluate the genotoxic and mutagenic properties induced by the ethanolic extract of araticum leaves, we performed the prophage λ induction (Inductest and bacterial mutagenicity assays. We used Escherichia coli WP2s(λ and RJF013 strains in the lysogenic induction test, whereas the mutagenic studies were carried out using Salmonella typhimurium histidine auxotroph strains TA97a, TA98, TA100, and TA102. Each experiment was performed three times in duplicate and included positive and negative controls. No statistically significant (p > 0.05 positive results were obtained for any of the strains tested, which suggests that the ethanolic extract of araticum leaves did not exhibit direct mechanisms of genotoxicity or mutagenicity that could be detected by the tests used in the present work.

  8. Possible Mechanisms of Ternary Fission in the 197Au+197 Au System at 15 AMeV

    Jun-Long, Tian; Xian, Li; Shi-Wei, Yan; Xi-Zhen, Wu; Zhu-Xia, Li

    2009-01-01

    Ternary fission in 197 Au+ 197 Au collisions at 15 A MeV is investigated by using the improved quantum molecular dynamical (ImQMD) model. The experimental mass distributions for each of the three fragments are reproduced for the first time without any freely adjusting parameters. The mechanisms of ternary fission in central and semi-central collisions are dynamically studied. In direct prolate ternary fission, two necks are found to be formed almost simultaneously and rupture sequentially in a very short time interval. Direct oblate ternary fission is a very rare fission event, in which three necks are formed and rupture simultaneously, forming three equally sized fragments along space-symmetric directions in the reaction plane. In sequential ternary fission a binary division is followed by another binary fission event after hundreds of fm/c. (nuclear physics)

  9. Mutagenic activity of a fluorinated analog of the beta-adrenoceptor ligand carazolol in the Ames test

    Doze, P; Elsinga, PH; de Vries, EFJ; Van Waarde, A; Vaalburg, W

    S-1'[F-18]-Fluorocarazolol (FCAR) is a fluorinated analog of the nonmutagenic beta-blocker carazolol (CAR). Tn former studies FCAR proved to be suitable for quantification of beta-adrenoceptors in vivo with positron emission tomography (PET). We report here that FCAR displays no acute toxicity in

  10. Atmospheric Methane Measurements from an Aircraft Based at NASA Ames: Five Years of Observations by the AJAX Project

    Iraci, Laura

    2016-01-01

    The Alpha Jet Atmospheric eXperiment (AJAX) is a research project based at Moffett Field, CA, which collects airborne measurements of ozone, carbon dioxide, methane, water vapor, and formaldehyde, as well as 3-D winds, temperature, pressure, and location. Since its first science flight in 2011, AJAX has developed a wide a variety of mission types, combining vertical profiles (from approx. 8 km to near surface),boundary layer legs, and plume sampling as needed. With an ongoing five-year data set, the team has sampled over 160 vertical profiles, a dozen wildfires, and numerous stratospheric ozone intrusions. This talk will present an overview of our flights flown to date, with particular focus on methane observations in the San Francisco Bay Area, Sacramento, and the delta region.

  11. Huellas de las religiones tradicionales del áfrica subsahariana en américa latina y el caribe

    Cabrera Thompson, Lazaro

    2010-01-01

    El artículo explora las religiones tradicionales practicadas por los pueblos ewe-mina, ewe-fon, bantú y yoruba del África subsahariana, antes de abordar las formas como estas prácticas religiosas persisten en el “Nuevo Mundo” tras la llegada forzosa de aquellos esclavizados africanos. Con base en la presencia de estas religiones tradicionales africanas en distintos países latinoamericanos y caribeño, se evidencia un conjunto religioso fusionado por historias, mitos, leyendas, danza, mú...

  12. Development of a High Resolution Weather Forecast Model for Mesoamerica Using the NASA Ames Code I Private Cloud Computing Environment

    Molthan, Andrew; Case, Jonathan; Venner, Jason; Moreno-Madrinan, Max J.; Delgado, Francisco

    2012-01-01

    Two projects at NASA Marshall Space Flight Center have collaborated to develop a high resolution weather forecast model for Mesoamerica: The NASA Short-term Prediction Research and Transition (SPoRT) Center, which integrates unique NASA satellite and weather forecast modeling capabilities into the operational weather forecasting community. NASA's SERVIR Program, which integrates satellite observations, ground-based data, and forecast models to improve disaster response in Central America, the Caribbean, Africa, and the Himalayas.

  13. Ames Infusion Stories for NASA Annual Technology Report: Nano Entry System for CubeSat-Class Payloads

    Smith, Brandon; Jan, Darrell Leslie; Venkatapathy, Etiraj

    2015-01-01

    The Nano Entry System for CubeSat-Class Payloads led to the development of the Nano-Adaptable Deployable Entry and Placement Technology ("Nano-ADEPT"). Nano-ADEPT is a mechanically deployed entry, descent, and landing (EDL) system that stows during launch and cruise (like an umbrella) and serves as both heat shield and primary structure during EDL. It is especially designed for small spacecraft where volume is a limiting constraint.

  14. Analysis of production of forward-angle fragments in the 22Ne (40 AMeV + 9Be reaction

    G. Kaminski

    2008-12-01

    Full Text Available A mechanisms of production of forward-emitted fragments in the 22Ne (40 АMeV + 9Be reaction are investigated. Inclusive velocity and isotopic distributions of products with 3 ≤ Z ≤ 11 were measured on the fragment separator COMBAS. The contribution of direct processes and dissipative ones is presented. Gaussian fitting functions according to Goldhaber formalism has been used to estimate direct components of fragments velocity distributions. Experimental data have been compared to geometric incomplete fusion model predictions. Incomplete fusion model was the first time applied for light nuclei as in the studied reaction system. Overall agreement of simulations with experiment in description of velocity distributions have been achieved for fragments with atomic number close to the projectile mass and for stable isotopes. Discrepancies for other products are the result of transition from incomplete fusion to direct processes with collisions of clusters in the participant zone.

  15. Floral features of two species of Bulbophyllum section Lepidorhiza Schltr.: B. levanae Ames and B. nymphopolitanum Kraenzl. (Bulbophyllinae Schltr., Orchidaceae).

    Wiśniewska, Natalia; Kowalkowska, Agnieszka K; Kozieradzka-Kiszkurno, Małgorzata; Krawczyńska, Agnieszka T; Bohdanowicz, Jerzy

    2018-03-01

    Two representatives of section Lepidorhiza, previously sometimes considered conspecific, Bulbophyllum levanae and Bulbophyllum nymphopolitanum, demonstrated both similarities and differences in floral features. There were significant differences in the length of sepals and micromorphological features of the labellum. In both species, osmophores are located on the extended apices of sepals and possibly on petals. An abundance of proteins in tepals is probably associated with the unpleasant scent of the flowers, whereas the thin wax layers on the epidermis are probably involved in the maintenance of the brilliance of floral tepals, which strongly attracts flies. In all tepals of both species, we noted the presence of dihydroxyphenolic globules in the cytoplasm after staining with FeCl 3 . Comparison with ultrastructure results revealed that they were associated with plastids containing plastoglobuli. The most remarkable feature was the presence of a prominent periplasmic space in the epidermal cells of both investigated species. Furthermore, in the labellum of B. levanae, the cuticle contained microchannels. The combination of periplasmic space and microchannels has not previously been recorded.

  16. Proceedings of the FAA Inspection Program Area Review, Held in Ames, Iowa on April 5-7, 1994

    1994-07-01

    34 against thermal wave imaging, eddy current and ultrasound techniques for finding corrosion in terms of criteria such as flexibility to other inspection...bell and whistles . 3 4 - Fantastic work! 2 2 not This technology is still in a premature stage. Research needs to LoW -1,t!n . i find a valuable

  17. 2012 Review on the Extension of the AMedP-8(C) Methodology to New Agents, Materials, and Conditions

    2013-10-01

    c. Animal Models Currently, large animal models ( goats and non-human primates) of Burkholderia species are limited to melioidosis, and their...2012). 147 ProMED-mail, “Q Fever—Spain: (AN)” (ISID, 2013). 148 ProMED-mail, “Q Fever—USA: Raw Cow’s Milk, Ex Goat ” (ISID, 2011). 149 Ehsan...149, no. 3–4 (2011): 298–306. 153 M. Georgiev et al., “Q Fever in Humans and Farm Animals in Four European Countries, 1982 to 2010,” Euro

  18. Revalidation of the NASA Ames 11-by 11-Foot Transonic Wind Tunnel with a Commercial Airplane Model

    Kmak, Frank J.; Hudgins, M.; Hergert, D.; George, Michael W. (Technical Monitor)

    2001-01-01

    The 11-By 11-Foot Transonic leg of the Unitary Plan Wind Tunnel (UPWT) was modernized to improve tunnel performance, capability, productivity, and reliability. Wind tunnel tests to demonstrate the readiness of the tunnel for a return to production operations included an Integrated Systems Test (IST), calibration tests, and airplane validation tests. One of the two validation tests was a 0.037-scale Boeing 777 model that was previously tested in the 11-By 11-Foot tunnel in 1991. The objective of the validation tests was to compare pre-modernization and post-modernization results from the same airplane model in order to substantiate the operational readiness of the facility. Evaluation of within-test, test-to-test, and tunnel-to-tunnel data repeatability were made to study the effects of the tunnel modifications. Tunnel productivity was also evaluated to determine the readiness of the facility for production operations. The operation of the facility, including model installation, tunnel operations, and the performance of tunnel systems, was observed and facility deficiency findings generated. The data repeatability studies and tunnel-to-tunnel comparisons demonstrated outstanding data repeatability and a high overall level of data quality. Despite some operational and facility problems, the validation test was successful in demonstrating the readiness of the facility to perform production airplane wind tunnel%, tests.

  19. 2015 Review on the Extension of the AMedP-8(C) Methodology to New Agents, Materials, and Conditions

    2016-06-01

    radiological accidents and incidents to the Deputy Chief of Staff for Logistics. AR 50-6 likewise addresses chemical surety. AR 50-1 and AR 50-6 assign...out a process for WMD elimination activities that applies very well to chemical weapons. The publication details roles for general purpose forces...Defense Planning & Response Project,” for the Joint Staff, Joint Requirements Office (JRO) for Chemical , Biological, Radiological and Nuclear (CBRN

  20. Aging material evaluation and studies by non-destructive techniques (AMES-NDT) - a European network project

    Dobmann, Gerd; Debarberis, Luigi; Coste, Jean-Francois

    2001-01-01

    This paper presents results obtained in a round-robin action organized in a concerted action of ten partners in the EURATOM program of the European Community. The objective of the research was to document the state of the art of available non-destructive testing (NDT) techniques in order to characterize material aging phenomena based on a reduction of Charpy-V energy and a shift in the fracture appearance transition temperature. Therefore, samples from the Japanese nuclear reactor pressure vessel JRQ-steel (ASMT Standard A533-B Class 1) have been thermally treated at 700 deg. C for 18 h with a subsequent water quenching. Besides micromagnetic and electromagnetic NDT, the positron annihilation technique, ultrasonic reverberation by using Laser ultrasonics and the thermo-electrical power have been applied to characterize the aged material states

  1. Force Tests of the Boeing XB-47 Full-Scale Empennage in the Ames 40- by 80-Foot Wind Tunnel

    Hunton, Lynn W.

    1947-01-01

    A wind-tunnel investigation of the Boeing XB-47 full-scale empennage was conducted to provide, prior to flight tests, data required on the effectiveness of the elevator and rudder. The XB-47 airplane is a jet-propelled medium bomber having wing and tail surfaces swept back 35 degrees. The investigation included tests of the effectiveness of the elevator with normal straight sides, with a buldged trailing edge, and with a modified hinge-line gap and tests of the effectiveness of the rudder with a normal straight-sided tab and with a bulged tab.

  2. II. The intermediate velocity source in the 40Ca+40Ca reaction at Elab=35 AMeV

    Sosin, Z.; Planeta, R.; Ciszek, T.

    2001-01-01

    The shape of the velocity distributions of charged particles projected on the beam direction can be explained if emissions from the hot projectile-like fragment and the target-like fragment are supplemented by an emission from an intermediate velocity source located between them. The creation of this source is predicted by a two-stage reaction model where, in the second stage, some of the nucleons identified in the first stage as participants form a group of clusters located in the region between the colliding nuclei. The cluster coalescence process is governed on the average by the maximum value of entropy, although its fluctuations are also significant. The properties of the intermediate velocity source are precisely described, including the isotopic composition of the emitted particles. (orig.)

  3. Mars Exploration Study Workshop II. Report of a workshop, Ames Research Center, Moffett Field, CA (USA), 24 - 25 May 1993.

    Duke, M. B.; Budden, N. A.

    1993-11-01

    This report, which summarizes the Mars Exploration Study Workshop II, provides an overview of the status of the Mars Exploration Study, material presented at the workshop, and discussions of open items being addressed by the study team. The workshop assembled three teams of experts to discuss cost, dual-use technology, and international involvement, and to generate a working group white paper addressing these issues.

  4. Subsonic Wake Characterization of the Orion Capsule Using PIV in the Ames UPWT 11-foot Wind Tunnel (Invited)

    Heineck, James T.; Ross, James C.; Yamauchi, Gloria K.

    2015-01-01

    The subsonic regime of Crew Capsule reentry has a very turbulent waker through which the Drogue Chutes must deploy. This presentation describes the particle image velocimetry measurement campaign used to help retire the risk.

  5. Amélioration continue des performances sur chantier par optimisation des zones de stockage et d’approvisionnement

    de Hemptinne, Antoine; Lassaux, Raphaël

    2017-01-01

    L’industrie de la construction est un moteur important de l’économie belge. Elle emploie des milliers de personnes à travers le pays et la nette croissance enregistrée pour l’année 2016 nous donne un aperçu de la bonne santé de ce secteur. Les récents résultats à court terme nous font cependant parfois oublier un constat moins réjouissant et valable depuis 20 ans : le secteur de la construction sou re d’un important retard en terme de productivité comparé aux autres branches du se...

  6. Tropical Journal of Pharmaceutical Research - Vol 15, No 3 (2016)

    Wan Wu, Wei Chen, Qiong Jin, 447-451 ... Chung-Shih Chen, Mei-Lin Wang, Rosa Huang Liu, Shih-Pin Chen, Tsong-Ming Lu, Wei-Yu Tsai, Chien-Fu Huang, ... Yan-Qiong Li, Rui Hu, Li-Hui Zhong, Qian Sun, You-Ping Yan, 527-533.

  7. Dynamic Optically Multiplexed Imaging

    2015-07-29

    Dynamic Optically Multiplexed Imaging Yaron Rachlin, Vinay Shah, R. Hamilton Shepard, and Tina Shih Lincoln Laboratory, Massachusetts Institute of...V. Shah, and T. Shih “Design Architectures for Optically Multiplexed Imaging,” in submission 9 R. Gupta , P. Indyk, E. Price, and Y. Rachlin

  8. Sadhana | Indian Academy of Sciences

    Home; Journals; Sadhana. M-H Shih. Articles written in Sadhana. Volume 34 Issue 3 June 2009 pp 421-437. A model for signal processing and predictive control of semi-active structural control system · M-H Shih W-P Sung Ching-Jong Wang · More Details Abstract Fulltext PDF. The theory for structural control has been ...

  9. El tipo de gelificante en el desarrollo in vitro y la aclimatizacion de plantas de Yampi (dioscorea trifida y ñame (dioscorea alata

    Ana Gabriela Chacón

    2000-01-01

    Full Text Available El yampf y el name se cultivan en ~osta Rica primordial mente con fines de exportaci6n; sin embargo, su producci6n se ve seriamente li- mitada por la falta de semilla libre de plagas y enfermedades. La producci6n in vitro de semilla representa una altemativa a esta problematic a, pero este proceso debe a su vez ser optimizado. El presente trabajo evalu6 el efecto de 2 gelifi- cantes sobre el crecimiento in vitro y en invema- dero de plantas de D. trifida y D. alata. Se en- contr6 que, en general, el crecimiento in vitro y en invemadero de las plantas se ve favorecido en ambas especies por el uso del Phytagel@ a 1.3 y 1.8 g/L. Ademas, el subcultivo de plantas de D. alata con sfntomas de hiperhidricidad en medio solidificado con agar redujo considerablemente estos sfntomas.

  10. Technical Reference Manual to Allied Medical Publication 7.5 (AMedP 7.5) NATO Planning Guide for the Estimation of CBRN Casualties

    2016-10-01

    Friday. When values were rounded to whole weeks, the set of seven incubation periods was the same for exposure dates of Tuesday through Thursday. Since...Undulant Fever.” Public Health Reports 53, no. 20 (1938): 796–803. Hartzell, Joshua D., Robert N. Wood- Morris , Luis J. Martinez, and Richard F...Fox, John M. Boyce, Daniel C. Anderson, Morris E. Potter, William J. Martone, and Charlotte M. Patton. “Airborne Spread of Brucellosis.” Annals of the

  11. How self-determination theory can assist our understanding of the teaching and learning processes in medical education. AMEE guide No. 59.

    Ten Cate, Th J; Kusurkar, Rashmi A; Williams, Geoffrey C

    2011-01-01

    Self-determination Theory (SDT), designed by Edward Deci and Richard Ryan, serves among the current major motivational theories in psychology. SDT research has been conducted in many areas, among which are education and health care, but its applications in medical education are rare. The potential of SDT to help understand processes in medical education justifies this Guide. SDT is explained in seven principles, one of which is the distinction of three innate psychological needs of human beings: for competence, for autonomy and for relatedness. Further, SDT elaborates how humans tend to internalise regulation of behaviour that initially has been external, in order to develop autonomous, self-determined behaviour. Implications of SDT for medical education are discussed with reference to preparation and selection, curriculum structure, classroom teaching, assessments and examinations, self-directed learning, clinical teaching, students as teachers and researchers, continuing professional development, faculty development and stress among trainees.

  12. NATO Allied Medical Publication 7.5 Study Draft 3 (AMedP 7.5 SD.3), NATO Planning Guide for the Estimation of CBRN Casualties

    2015-12-01

    NORTH ATLANTIC TREATY ORGANIZATION (NATO) NATO STANDARDIZATION OFFICE (NSO) NATO LETTER OF PROMULGATION [ Date ] 1. The enclosed Allied Medical...The radioisotopes modeled are 60Co, 90Sr, 99Mo, 125I, 131I, 137Cs, 192Ir, 226Ra, 238Pu, 241Am, 252Cf. 2) Whole-body irradiation (from cloudshine...Carrier 1.22 2.70 Earth Shelter 16.67 66.67 Exposed/Dismounted 1.00 1.00 Foxhole (nuclear only)† 3.00 10.00 Masonry Building 8.33 6.67 Multi-Story

  13. Inhalation Anthrax (Ames aerosol) in Naive and Vaccinated New Zealand Rabbits: Characterizing the Spread of Bacteria from Lung Deposition to Bacteremia

    2012-06-28

    Lond.) 51, 372–385. Henderson, D. W., Peacock , S., and Belton, F. C. (1956). Observations on the prophylaxis of experimental pulmonary anthrax in...terms of the Creative Commons Attribution Non Commercial License, which permits non-commercial use, distribution, and reproduction in other forums

  14. Comments on ;An improved Cauchy number approach for predicting the drag and reconfiguration of flexible vegetation; by Peter Whittaker, Catherine A.M.E. Wilson, and Jochen Aberle

    Chen, Li; Chen, Xiaobing

    2017-07-01

    Whittaker et al. (2015) presented a modified Cauchy number approach for the estimate of flow resistance induced by flexible vegetation. The approach represents a noteworthy effort in quantifying vegetation resistance to streamflow. Here we briefly discuss some theoretical and practical issues of this approach, and show how it is related to the approach developed by Kouwen and others (Kouwen et al., 1969; Kouwen and Unny, 1973) and recently revised by Chen et al. (2014).

  15. Allied Medical Publication AMedP-7.6(A), Commander’s Guide to Medical Operations in Support of CBRN Defensive Operations: Study Draft 1

    2015-07-01

    exploitation National forensic capabilities Guidance on issues requiring operational-level coordination, advice, assessment Legal and ethical issues...countermeasures and seek attack? appropriate authority to use them lmmunise personnel (if suitable vaccine available) ID particularly vulnerable targets

  16. Data Corrections and Wind-Tunnel Data Comparisons of a 5% TCA Model in the NASA Ames 12-ft Pressure Tunnel

    Zuniga, Fanny A.

    1999-01-01

    The objectives of this research are: 1) To determine the effect of geometric variations near the inboard leading-edge flap on high-lift and stability and control performance data; 2) To determine Re effects on TCA (Technology Concept Aircraft) high-lift configuration for optimum high-lift and stability and control performance at takeoff, climbout, approach and landing conditions; and 3) To obtain flow-visualization data on upper surface of wing for CFD validations. This paper is presented in viewgraph form.

  17. Life into Space: Space Life Sciences Experiments, Ames Research Center, Kennedy Space Center, 1991-1998, Including Profiles of 1996-1998 Experiments

    Souza, Kenneth (Editor); Etheridge, Guy (Editor); Callahan, Paul X. (Editor)

    2000-01-01

    We have now conducted space life sciences research for more than four decades. The continuing interest in studying the way living systems function in space derives from two main benefits of that research. First, in order for humans to engage in long-term space travel, we must understand and develop measures to counteract the most detrimental effects of space flight on biological systems. Problems in returning to the conditions of Earth must be kept to a manageable level. Second, increasing our understanding of how organisms function in the absence of gravity gives us new understanding of fundamental biological processes. This information can be used to improve human health and the quality of life on Earth.

  18. Ames Infusion Stories for NASA Annual Technology Report: Development of an Ablative 3D Quartz / Cyanate Ester Composite Multi-Functional Material for the Orion Spacecraft Compression Pad

    Smith, Brandon; Jan, Darrell Leslie; Venkatapathy, Ethiraj

    2015-01-01

    Vehicles re-entering Earth's atmosphere require protection from the heat of atmospheric friction. The Orion Multi-Purpose Crew Vehicle (MPCV) has more demanding thermal protection system (TPS) requirements than the Low Earth Orbit (LEO) missions, especially in regions where the structural load passes through. The use of 2-dimensional laminate materials along with a metal insert, used in EFT1 flight test for the compression pad region, are deemed adequate but cannot be extended for Lunar return missions.

  19. One-fiftieth scale model studies of 40-by 80-foot and 80-by 120-foot wind tunnel complex at NASA Ames Research Center

    Schmidt, Gene I.; Rossow, Vernon J.; Vanaken, Johannes M.; Parrish, Cynthia L.

    1987-01-01

    The features of a 1/50-scale model of the National Full-Scale Aerodynamics Complex are first described. An overview is then given of some results from the various tests conducted with the model to aid in the design of the full-scale facility. It was found that the model tunnel simulated accurately many of the operational characteristics of the full-scale circuits. Some characteristics predicted by the model were, however, noted to differ from previous full-scale results by about 10%.

  20. Phase 2 and 3 wind tunnel tests of the J-97 powered, external augmentor V/STOL model. [conducted in Ames 40- by 80-foot wind tunnel

    Garland, D. B.

    1980-01-01

    Modifications were made to the model to improve longitudinal acceleration capability during transition from hovering to wing borne flight. A rearward deflection of the fuselage augmentor thrust vector is shown to be beneficial in this regard. Other agmentor modifications were tested, notably the removal of both endplates, which improved acceleration performance at the higher transition speeds. The model tests again demonstrated minimal interference of the fuselage augmentor on aerodynamic lift. A flapped canard surface also shows negligible influence on the performance of the wing and of the fuselage augmentor.

  1. AME evidence series 001—The Society for Translational Medicine: clinical practice guidelines for diagnosis and early identification of sepsis in the hospital

    Zhang, Zhongheng; Smischney, Nathan J.; Zhang, Haibo; Van Poucke, Sven; Tsirigotis, Panagiotis; Rello, Jordi; Honore, Patrick M.; Sen Kuan, Win; Ray, Juliet June; Zhou, Jiancang; Shang, You; Yu, Yuetian; Jung, Christian; Robba, Chiara; Taccone, Fabio Silvio

    2016-01-01

    Sepsis is a heterogeneous disease caused by an infection stimulus that triggers several complex local and systemic immuno-inflammatory reactions, which results in multiple organ dysfunction and significant morbidity and mortality. The diagnosis of sepsis is challenging because there is no gold standard for diagnosis. As a result, the clinical diagnosis of sepsis is ever changing to meet the clinical and research requirements. Moreover, although there are many novel biomarkers and screening to...

  2. Results of convective heating tests of a longitudinal gap on the Rockwell flat plate model (15-0, insert 7) in the NASA/Ames Research Center

    Quan, M.; Lockman, W. K.

    1975-01-01

    Results are presented which were obtained from tests in a hypersonic wind tunnel to determine aerodynamic heating rates in a gap running parallel or slightly askew to the flow direction. The model used was a flat plate instrumented in thin-skin sections with chromelconstantan thermocouples. Heating rate profiles lengthwise along and down into the gap were obtained, and additional data were obtained from a total temperature probe and rake fabricated during the test to investigate an apparent aerodynamic cooling trend in the gap. Model variables were width, depth, length, and orientation of the gap relative to the flow direction. The tests were conducted at Mach 5.1 and Reynolds numbers per foot of 500,000, 1,000,000, and 2,000,000.

  3. Are All Ames Strains in the OECD Mutagenicity Test Guideline 471 Useful and Necessary? An Analysis of Large Mutagenicity Data Sets for the IWGT

    The International Workshop on Genetic Toxicology (IWGT) meets every four years with an objective to reach consensus recommendations on difficult or conflicting approaches to genotoxicity testing based upon practical experience and newly available data and data analysis techniques...

  4. El ñame espino (Dioscorea rotundata Poir.: una opción en la producción de jarabes edulcorantes intermedios para la industria alimentaria

    Carlos Ramón Vidal Tovar

    2010-10-01

    Full Text Available The principal objective of this study was the production of intermediate syrups by enzymatic hydrolysis using the enzyme α-amylase on solutions of 36 and 46% (D. rotundata The response variable was the dextrose equivalent in each syrup obtained. A completely randomized design was used. The data was analyzed using Statgraphics ® statistical package. The products obtained were intermediate sweeteners syrups with a dextrose equivalent of 18.81 and 22.15%, respectively; after liquefaction, -which allows classification as a low conversion syrup because of its low content of glucose syrups- the syrups obtained can be used for their functional properties as intermediate syrups or as raw material for various food industry processes such as fermentation by yeast or obtaining syrups rich in glucose by saccharification. This allows establishing a guideline for the use of yam as a non-conventional raw material in the production of products from starch.

  5. Italian Association of Clinical Endocrinologists (AME and Italian Chapter of the American Association of Clinical Endocrinologists (AACE Position Statement: Clinical Management of Vitamin D Deficiency in Adults

    Roberto Cesareo

    2018-04-01

    Full Text Available Vitamin D deficiency is very common and prescriptions of both assay and supplementation are increasing more and more. Health expenditure is exponentially increasing, thus it is timely and appropriate to establish rules. The Italian Association of Clinical Endocrinologists appointed a task force to review literature about vitamin D deficiency in adults. Four topics were identified as worthy for the practicing clinicians. For each topic recommendations based on scientific evidence and clinical practice were issued according to the Grading of Recommendations, Assessment, Development, and Evaluation (GRADE System. (1 What cut-off defines vitamin D deficiency: even though 20 ng/mL (50 nmol/L can be considered appropriate in the general population, we recommend to maintain levels above 30 ng/mL (75 nmol/L in categories at risk. (2 Whom, when, and how to perform screening for vitamin D deficiency: categories at risk (patients with bone, liver, kidney diseases, obesity, malabsorption, during pregnancy and lactation, some elderly but not healthy people should be screened by the 25-hydroxy-vitamin D assay. (3 Whom and how to treat vitamin D deficiency: beyond healthy lifestyle (mostly sun exposure, we recommend oral vitamin D (vitamin D2 or vitamin D3 supplementation in patients treated with bone active drugs and in those with demonstrated deficiency. Dosages, molecules and modalities of administration can be profitably individually tailored. (4 How to monitor the efficacy of treatment with vitamin D: no routine monitoring is suggested during vitamin D treatment due to its large therapeutic index. In particular conditions, 25-hydroxy-vitamin D can be assayed after at least a 6-month treatment. We are confident that this document will help practicing clinicians in their daily clinical practice.

  6. Italian Association of Clinical Endocrinologists (AME) & Italian Association of Clinical Diabetologists (AMD) Position Statement : Diabetes mellitus and thyroid disorders: recommendations for clinical practice.

    Guastamacchia, Edoardo; Triggiani, Vincenzo; Aglialoro, Alberto; Aiello, Antimo; Ianni, Lucia; Maccario, Mauro; Zini, Michele; Giorda, Carlo; Guglielmi, Rinaldo; Betterle, Corrado; Attanasio, Roberto; Borretta, Giorgio; Garofalo, Piernicola; Papini, Enrico; Castello, Roberto; Ceriello, Antonio

    2015-06-01

    Thyroid disease and diabetes mellitus, the most common disorders in endocrine practice, are not infrequently associated in the same subject. An altered thyroid function may affect glucose tolerance and worsen metabolic control in patients with diabetes. Thyrotoxicosis increases the risk of hyperglycemic emergencies, while a clinically relevant hypothyroidism may have a detrimental effect on glycemic control in diabetic patients. The association of alterations in thyroid function with diabetes mellitus may adversely affect the risk of cardiovascular and microvascular complications resulting from diabetes. Moreover, the treatments used for both diabetes and thyroid disease, respectively, can impact one other. Finally, multinodular goiter, but not thyroid carcinoma, was shown to be more prevalent in type 2 diabetes mellitus. Aim of the present Position Statement is to focus on the evidence concerning the association of thyroid disease and diabetes mellitus and to provide some practical suggestions for an updated clinical management.

  7. Reaction and fission cross-sections of 750AMeV 238U ions on Pb, Cu and AI-targets

    Hesse, M.; Aumann, T.; Czajkowski, S.; Dessagne, P.; Hanelt, E.; Kozhuharov, C.; Miehe, C.; Pfuetzner, M.; Roehl, C.; Schwab, W.; Stephan, C.; Tassan-Got, L.

    1995-09-01

    Charge-loss and fission cross-sections of 238 U at 750 A.MeV were measured on Al, Cu and Pb targets. The charge-loss rate was obtained by the attenuation method. Fission was selected by detecting the pair of highly ionizing fragments. Since the neutron-loss cross sections were measured in a parallel experiment for the same projectiles, all cross sections contributing to 238 U collisions on nuclei are available now as function of the target mass number and can be compared with current models. (orig.)

  8. Genotoxicity of 1,3-dichloro-2-propanol in the SOS chromotest and in the Ames test. Elucidation of the genotoxic mechanism.

    Hahn, H; Eder, E; Deininger, C

    1991-01-01

    1,3-Dichloro-2-propanol (1,3-DCP-OH, glycerol dichlorohydrin) is of great importance in many industrial processes and has been detected in foodstuffs, in particular in soup spices and instant soups. It has been shown to be carcinogenic, genotoxic and mutagenic. Its genotoxic mechanisms are, however, not yet entirely understood. We have investigated whether alcohol dehydrogenase (ADH) catalysed activation to the highly mutagenic and carcinogenic 1,3-dichloroacetone or formation of epichlorohydrin or other genotoxic compounds play a role for mutagenicity and genotoxicity. In our studies, no indications of ADH catalysed formation of 1,3-dichloropropane could be found, although we could demonstrate a clear activation by ADH in the case of 2-chloropropenol. Formation of allyl chloride could also be excluded. We found, however, clear evidence that epichlorohydrin formed chemically in the buffer and medium used in the test is responsible for genotoxicity. No indication was found that enzymatic formation of epichlorohydrin plays a role. Additional mutagenicity and genotoxicity studies with epichlorohydrin also confirmed the hypothesis that genotoxic effects of 1,3-DCP-OH depend on the chemical formation of epichlorohydrin.

  9. A Computer-Interpretable Version of the AACE, AME, ETA Medical Guidelines for Clinical Practice for the Diagnosis and Management of Thyroid Nodules

    Peleg, Mor; Fox, John; Patkar, Vivek

    2014-01-01

    with data that are not necessarily obtained in a rigid flowchart sequence. Tallis-a user-friendly web-based "enactment tool"- was then used as the "execution engine" (computer program). This tool records and displays tasks that are done and prompts users to perform the next indicated steps. The development...... GuideLine Interchange Format, version 3, known as GLIF3, which emphasizes the organization of a care algorithm into a flowchart. The flowchart specified the sequence of tasks required to evaluate a patient with a thyroid nodule. PROforma, a second guideline-modeling language, was then employed to work...

  10. Simulation and control engineering studies of NASA-Ames 40 foot by 80 foot/80 foot by 120 foot wind tunnels

    Bohn, J. G.; Jones, J. E.

    1978-01-01

    The development and use of a digital computer simulation of the proposed wind tunnel facility is described. The feasibility of automatic control of wind tunnel airspeed and other parameters was examined. Specifications and implementation recommendations for a computer based automatic control and monitoring system are presented.

  11. December 2016

    FOBUR

    subsequently received a single dose of intravenous tenectaplase and was .... Oral vitamin K antagonists such as warfarin have remained the .... embolism in a cancer patient with ... Shih WJ, Robinson MC, Huber C, Pulmano. C. Tc-99m MAA ...

  12. Unedited Version

    5

    Patient with Familial Norrie Disease: Bilateral Blindness and Leucocoria ..... Lin RC, Shih JC (2013) Monoamine oxidase A and A/B knockout mice display autistic-like ... spectrum in familial exudative vitreoretinopathy and Norrie disease with ...

  13. Analysis of Popper's Experiment and Its Realization

    Qureshi, T.

    2012-04-01

    An experiment proposed by Karl Popper to test the standard interpretation of quantum mechanics was realized by Kim and Shih. We use a quantum mechanical calculation to analyze Popper's proposal, and find a surprising result for the location of the virtual slit. We also analyze Kim and Shih's experiment, and demonstrate that although it ingeniously overcomes the problem of temporal spreading of the wave-packet, it is inconclusive about Popper's test. We point out that another experiment which (unknowingly) implements Popper's test in a conclusive way, has actually been carried out. Its results are in contradiction with Popper's prediction, and agree with our analysis.

  14. Short-term Exposure to a Mediterranean Environment Influences Attitudes and Dietary Profile in U.S. College Students: The MEDiterranean Diet in AMEricans (A-MED-AME) Pilot Study.

    Petroka, Katherine; Dinu, Monica; Hoover, Chelsea; Casini, Alessandro; Sofi, Francesco

    2016-01-01

    The aim of this study was to investigate whether short-term exposure to a Mediterranean diet during a structured abroad experience could influence dietary habits and attitudes. This study used a cross-sectional design. The study was conducted on the Florence University of the Arts (FUA) campus, Italy. Fifty-four (47 females, 7 males; mean age 21.1 ± 1.9 years) college students from 12 different states, mainly located in the central United States, were enrolled in this study. Outcome measures included adherence score to Mediterranean diet and self-reported perceptions of diet and food availability. A demographic survey was used to collect data regarding personal characteristics, anthropometrics, duration of stay, and residency status. Chi-square test, independent T-test, and Mann-Whitney test were used to perform analyses. At 3 weeks' follow-up, 94% of the population reported that availability of foods affected their food choices. Interestingly, students reported that they consumed less meat with respect to their usual dietary habits in the United States (p Mediterranean diet significantly increased by about 1 point, going from 9.9 ± 2.4 to 10.9 ± 2.0 (p Mediterranean diet was observed. Future research should explore the relationship between length of time spent in a foreign country and dietary adherence in a cultural context.

  15. Study of light fragment production in Au + Au collisions at 150 and 400 A.MeV; Etude de la production de fragments legers dans les collisions Au + Au a 150 et 400 A.Me V

    Amouroux, V

    1996-12-17

    We study light fragment production in Au + Au collisions at energies between 150 and 400 A.MeV. Experimental data are extracted from Phase I experiments performed with the FOPI detector at GSI-Darmstadt. We first give centrality criteria and the method used in order to have an evaluation of the impact parameter; that permit comparison between experiment and IQMD or FREESCO models. A first study concerns charge distributions and the reduced variance {gamma}{sub 2}. We observe that the amplitude of the reduced variance decreases rapidly as the centrality of the collision increases; this last point shows that there is no liquid-gas phase transition in central collisions. Such a conclusion agrees with theoretical studies made by the Nantes group concerning fragment formation. A second part concerns a systematic study of differential cross sections of fragment production. We show that IQMD model gives a good qualitative agreement with experimental data; nevertheless, charge distributions are not correctly reproduced by theory. A study of the parameter which fix the width of the Gaussian associated with the nucleons of the interacting system can improve the shape of the charge distributions. Finally, we give at the end of the thesis a systematic presentation of experimental invariant cross sections of fragment production. (author) 80 refs.

  16. Results of an air data probe investigation utilizing a 0.10 scale orbiter forebody (model 57-0) in the Ames Research Center 14-foot wind tunnel (OA220)

    Esparza, V.; Thornton, D. E.

    1976-01-01

    Results are presented of a 0.10 scale orbiter forebody test with left and right mounted air data probes (ADP) as well as a flight test probe (nose boom). Left and right ADP data were obtained at Mach numbers of .3, .4, .5, .6, .7, .8, .85, .9, .95, .98, 1.05 and 1.1 through a Reynolds number range of 1.3 to 4.4 million. Nose boom data were obtained at Mach numbers of .3, .4, .5, .6, .7, .9 and .98.

  17. Addenda to Allied Medical Publication 8, NATO Planning Guide for the Estimation of Chemical, Biological, Radiological, and Nuclear (CBRN) Casualties (AMedP-8(C)) to Consider the Impact of Medical Treatment on Casualty Estimation

    2013-05-01

    onset to antibiotic treatment [days], a = 0.1, and b = 0.012. If an individual has progressed to the second, fulminant stage (Stage 2) before...Granov, S. Besarović-Lazarev, A. Buntić, A. Fajdetić, and Z. Binenfeld. “1,3-Bispyridinium-Dimethylether Mono- and Dioximes: Synthesis , Reactivating

  18. NATO Planning Guide for the Estimation of Chemical, Biological, Radiological, and Nuclear (CBRN) Casualties (AMedP-8(C)) - Parameters for Estimation of Casualties from Exposure to Specified Biological Agents. Addenda to Allied Medical Publication 8

    2011-01-01

    no. 2510 (1909): 319–25; I. Sobol , “A Case of Chronic Nasal Glanders,” Acta Oto-Laryngologica 18, no. 4 (1933): 500–9; J. F. Burgess, “Chronic...Observations on Human Glanders;” Sobol , “A Case of Chronic Nasal Glanders;” Burgess, “Chronic Glanders;” Herold and Erickson, "Human Glanders: Case...Human Subject;” Hunting, Glanders: A Clinical Treatise; Bernstein and Carling, “Observations on Human Glanders;” Sobol , “A Case of Chronic Nasal

  19. Ames testを用いるチーズの抗変異原性について : 日常食品の変異原性に関する研究(VI)

    三好,康之; 原田,知美

    1999-01-01

    Desmutagenicity of various types of cheese against the Trp-p1-induced mutagenicity to histidine-dependent strain of Salmonella Typhimurium TA98 was studied.All kinds of cheese showed high desmutagenicity. The desmutagenicity percentage of the Camembert cheese processed by us reached a maximum of 78%.

  20. Genotoxicity testing of samples generated during UV/H2O2 treatment of surface water for the production of drinking water using the Ames test in vitro and the Comet assay and the SCE test in vivo

    Penders, E.J.M.; Martijn, A.J.; Spenkelink, A.; Alink, G.M.; Rietjens, I.; Hoogenboezem, W.

    2012-01-01

    UV/H2O2 treatment can be part of the process converting surface water to drinking water, but would pose a potential problem when resulting in genotoxicity. This study investigates the genotoxicity of samples collected from the water treatment plant Andijk, applying UV/H2O2 treatment with an

  1. Polarization of {sup 23}Ne, {sup 24m,25}Al and {sup 28}P produced through single nucleon pickup and charge-exchange reactions at 100 AMeV

    Ohtsubo, T., E-mail: tohtsubo@np.gs.niigata-u.ac.jp; Hirano, H.; Takahashi, S. [Niigata Univ. (Japan); Matsuta, K.; Mihara, M.; Fukuda, M. [Osaka Univ. (Japan); Nagatomo, T. [RIKEN (Japan); Izumikawa, T. [Niigata Univ., RI Center (Japan); Momota, S. [Kochi Univ. of Tech. (Japan); Nishimura, D.; Komurasaki, J.; Ishikawa, D. [Osaka Univ. (Japan); Zhou, D. M.; Zheng, Y. N.; Zhu, S. Y. [China Institute of Atomic Energy (China); Kitagawa, A.; Kanazawa, M.; Torikoshi, M.; Sato, S. [Inage-ku, NIRS (Japan); Minamisono, T. [Fukui Univ. of Tech. (Japan)

    2007-11-15

    We measured the polarization of the {beta}-emitting {sup 23}Ne (I{sup {pi}} 5/2{sup +}, T{sub 1/2} = 37.24 s) and {sup 25}Al(I{sup {pi}} = 5/2{sup +}, T{sub 1/2} = 7.18 s) produced through the one nucleon pickup reactions and {sup 24m}Al(I{sup {pi}} = 1{sup +}, T{sub 1/2} 131 ms, E{sub ex} = 426 keV) and {sup 28}P(I{sup {pi}} = 3{sup +}, T{sub 1/2} = 270 ms) produced through charge-exchange reactions in the intermediate energy heavy ion collisions. We compared them with those from the projectile fragmentation process. The larger polarization seems to persistently be positive throughout the momentum distribution, and sharper momentum distributions suggest that nuclear friction mechanism is responsible for the polarization phenomena.

  2. ORF Sequence: NC_003997 [GENIUS II[Archive

    Full Text Available acillus anthracis str. Ames] MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGP...TGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGP...TGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGPTGPTGPSGLGLPAGLYAFNSGGISLDLG

  3. ORF Sequence: NC_007530 [GENIUS II[Archive

    Full Text Available [Bacillus anthracis str. 'Ames Ancestor'] MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGP...TGDTGTTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGP...TGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGPTGPTGPSGLGLPAGL

  4. Adenomyoepithelioma of the breast with hemorrhagic change diagnosed as papiloma on core needle biopsy: A case report

    Nam, Kyung Sun; Kim, Ji Young; Kim, Soung Hee; Bae, Kyung Eun; Lee, Ji Hae; Kang, Mi Jin; Jeong, Myeong Ja; Kim, Soo Hyun; Kim, Jae Hyung [Dept. of Radiology, Sanggye Paik Hospital, Inje University College of Medicine, Seoul (Korea, Republic of)

    2016-11-15

    Adenomyoepithelioma (AME) is a rare disease entity that represents biphasic proliferation of ductal epithelial and myoepithelial cells. AME can be confused with other neoplasms including malignancy because AME has various cytologic characteristics and nonspecific radiologic features. We describe an unusual AME with hemorrhagic change that was diagnosed as papilloma on core needle biopsy three times previously. The imaging features of AME are also discussed here.

  5. Localization and Specification of Copper Ions in Biofilms on Corroding Copper Surfaces.

    1994-01-01

    Sao Paulo, Brazil: Aquatec Quimica : 1985). 256/3 5. H. Shih, F. Mansfeld, ASTM STP 1154, 174, Philadelphia, PA, 1992. 6. B. Little, P. Wagner, R...Pope, "A Study of Microbiologically Influenced Corrosion in Nuclear Power Plants and a Practical Guide for Countermeasures," Electric Power Research

  6. Surgical and medical treatment of ocular disease in a dog with Ehlers-Danlos syndrome.

    Rasch, Søren N

    2017-06-01

    Correctional surgery was performed on a 3-year-old intact male shih tzu presenting with Ehlers-Danlos syndrome, ocular disease, and skin fold dermatitis. A one-year follow-up showed that no further clinical corrections were needed. Therefore, surgery could be considered in some canine patients with Ehlers-Danlos syndrome.

  7. (Chlorophyta) biomass production using Moringa oleifera Lam. leaf ...

    Chlorella sorokiniana Shih. et Krauss, a unicellular green alga was assayed to assess its to promotion potentials response of aqueous and ethanolic leaf extracts of Moringa oleifera Lam. C. sorokiniana grown in 200 ml aliquots of modified basal medium for two weeks: was treated with the aqueous and ethanolic extracts at ...

  8. Journal of Biosciences | Indian Academy of Sciences

    Author Affiliations. Chi-Fang Chin1 Arthur Chun-Chieh Shih2 Kuo-Chin Fan1 3. Department of Computer Science and Information Engineering, National Central University, Chung-Li, Taiwan; Institute of Information Science, Academia Sinica, Taipei, Taiwan; Department of Informatics, Fo Guang Univeristy, Ilan, Taiwan ...

  9. Anti-inflammatory Effects of Magnolia sieboldii Extract in ...

    Hao Li4 and Kang-Duk Choi1*. 1Genomic ... Methods: The whole plant of M. sieboldii was extracted with methanol at room temperature. The in vitro ... action of M. sieboldii in inflammation. Magnolia ..... Shih HC, Hwang TL, Chen HC, Kuo PC, Lee EJ, Lee. KH, Wu TS. ... Fu JY, Masferrer JL, Seibert K, Raz A, Needleman P.

  10. The SDF-1-CXCR4 Axis Functions Through p38-MAPK Signaling to Drive Breast Cancer Progression and Metastasis

    2009-09-01

    2002). Rubin JB, Kung AL, Klein RS, Chan JA, Sun Y, Schmidt K, Kieran MW, Luster AD, Segal RA.A small-molecule antagonist of CXCR4 inhibits... Melanie H. Howell, Michelle Lacey, Betty Y. Shih, Carol Carter-Wientjes, Thomas E. Cleveland, John A. McLachlan, Thomas E. Wiese, Barbara S. Beckman

  11. A case of non-regenerative immune-mediated anemia treated by ...

    A 12-year-old female Shih Tzu dog was referred with diarrhea. Hematological examination indicated severe nonregenerative anemia. Bone marrow aspiration smears and core biopsy specimens revealed normal bone marrow. Based on those results, non-regenerative immune mediated anemia was diagnosed. The dog ...

  12. Sadhana | Indian Academy of Sciences

    Home; Journals; Sadhana. W-P Sung. Articles written in Sadhana. Volume 34 Issue 3 June 2009 pp 421-437. A model for signal processing and predictive control of semi-active structural control system · M-H Shih W-P Sung Ching-Jong Wang · More Details Abstract Fulltext PDF. The theory for structural control has been ...

  13. Shigellosis

    ... by Shigella (pronounced: shih-GEL-uh) bacteria. The bacteria produce toxins that can attack the lining of the ... fluids and may prescribe antibiotics to treat shigellosis. Antibiotics can help you recover faster and prevent the bacteria from spreading to other people. Most doctors suggest ...

  14. Metastable Supersymmetry Breaking in a Cooling Universe

    Kaplunovsky, Vadim S.

    2007-01-01

    I put metastable supersymmetry breaking in a cosmological context. I argue that under reasonable assumptions, the cooling down early Universe favors metastable SUSY-breaking vacua over the stable supersymmetric vacua. To illustrate the general argument, I analyze the early-Universe history of the Intriligator-Seiberg-Shih model

  15. Life or death? A Physiogenomic Approach to Understand Individual Variation in Responses to Hemorrhagic Shock

    2011-01-01

    2009, 234, 1503-1510. [34] Fang, J. F.; Shih, L. Y.; Yuan, K. C.; Fang, K. Y.; Hwang, T. L.; Hsieh, S. Y. Proteomic analysis of post-hemorrhagic...resistant and susceptible barley lines during interaction with the powdery mildew fungus . Plant Mol. Biol., 2001, 47, 739-748. [96] Harris, N. S

  16. The Effect of Spray Initial Conditions on Heat Release and Emissions in LDI CFD Calculations (Preprint)

    2008-06-01

    Shih, T.-H., Povinelli , L. A., Liu, N.-S and Chen, K.-H., (2000), “Generalized Wall Function for...J. Marek, T. D. Smith, N.-S. Liu, and L. A. Povinelli (NASA, Glenn Research Center, Cleveland, OH, “A Study of Hydrogen/Air Combustor Using NCC

  17. Further genetic localization of the transforming sequences of the p21 v-ras gene of Harvey murine sarcoma virus

    Willumsen, B M; Ellis, R W; Scolnick, E M

    1984-01-01

    , DNA sequence analysis has found a single open reading frame large enough to encode the viral p21 (R. Dhar, R. W. Ellis, T. Y. Shih, S. Oroszlan, B. Shapiro, J. Maizel, D. Lowy, and E. M. Scolnick, Science 217:934-937, 1982). There are three potential in-frame ATG initiation codons at the 5' end...

  18. East Asia: Southeast Asia

    1990-09-05

    supporting role in the founding of Malaysia. Some people describe their role as having a position but having no authority. During the cogon grass campaign...Pian Hon Yun Shih-chin’s luck was much greater than Kuo Wei- chieh’s. Although both are deputy ministers, their grass - roots power is weak. Kuo

  19. Effect of aging on copper nanoparticles synthesized by pulsed laser ...

    Administrator

    2009-06-23

    Jun 23, 2009 ... Hsieh C T, Chen J M, Lin H H and Shih H C 2003 Appl. Phys. Lett. 83 3383. Hsieh J H, Kuo P W, Peng K C, Liu S J, Hsueh J D and Chang. S C 2008 Thin ... Jung J H, Kim T W, Song M S, Kim Y H and Yoo K H 2007. J. Appl.

  20. Genetics Home Reference: monoamine oxidase A deficiency

    ... Cases O, Seif I, Grimsby J, Gaspar P, Chen K, Pournin S, Müller U, Aguet M, Babinet C, Shih JC, et al. Aggressive behavior and altered amounts of brain serotonin and norepinephrine in mice lacking MAOA. Science. 1995 Jun 23;268(5218):1763-6. Citation on ...

  1. Determinants of Computer and Internet Adoption and Use in ...

    centres and promote the training of youths and social networks. Keywords: ICT ... factors are underscored in studies in developing countries(Shih and. Venkatesh ... mentions several obstacles to ICT development in cities and the role of these ... Cameroon as the towns of the eight other regions including the Centre that.

  2. The Attention Cascade Model and Attentional Blink

    Shih, Shui-I

    2008-01-01

    An attention cascade model is proposed to account for attentional blinks in rapid serial visual presentation (RSVP) of stimuli. Data were collected using single characters in a single RSVP stream at 10 Hz [Shih, S., & Reeves, A. (2007). "Attentional capture in rapid serial visual presentation." "Spatial Vision", 20(4), 301-315], and single words,…

  3. Frequency Conversion of Single Photons: Physics, Devices, and Applications

    2012-07-01

    Anton Zeilinger , Alexan- der V. Sergienko, and Yanhua Shih. New high-intensity source of polarization- entangled photon pairs. Physical Review Letters...interface. Nature, 437(7055):116–120, 2005. [36] S. Ramelow, A. Fedrizzi, A. Poppe, N. K. Langford, and A. Zeilinger . Polarization-entanglement-conserving

  4. Browse Title Index

    Items 8801 - 8850 of 11090 ... A Mansseri-Lamrioui, A Louerguioui, J Bonaly, ... Vol 13, No 53 (2014), Promoting increased Chlorella sorokiniana Shih. et Krauss (Chlorophyta) biomass ... Vol 16, No 3 (2017), Protection of Lactobacillus acidophilus under in vitro ... Araújo Campos, Pedro Martins Ribeiro Júnior, Fabrício Rabelo ...

  5. A UK student survey investigating the effects of consuming alcohol mixed with energy drinks on overall alcohol consumption and alcohol-related negative consequences

    Johnson, Sean J; Alford, Chris; Stewart, Karina; Verster, Joris C

    2016-01-01

    Previous research reported positive associations between alcohol mixed with energy drink (AMED) consumption and overall alcohol consumption. However, results were largely based on between-subjects comparisons comparing AMED consumers with alcohol-only (AO) consumers, and therefore cannot

  6. AMERICAN ASSOCIATION OF CLINICAL ENDOCRINOLOGISTS, AMERICAN COLLEGE OF ENDOCRINOLOGY, AND ASSOCIAZIONE MEDICI ENDOCRINOLOGI MEDICAL GUIDELINES FOR CLINICAL PRACTICE FOR THE DIAGNOSIS AND MANAGEMENT OF THYROID NODULES - 2016 UPDATE

    Gharib, Hossein; Papini, Enrico; Garber, Jeffrey R

    2016-01-01

    by the American Association of Clinical Endocrinologists (AACE), American College of Endocrinology (ACE) and Associazione Medici Endocrinologi (AME). ABBREVIATIONS: AACE = American Association of Clinical Endocrinologists ACE = American College of Endocrinology AME = Associazione Medici Endocrinologi BEL = best...

  7. Giving E-Commerce a Boost

    2000-01-01

    A former Ames employee, Monte Zweben, founded a new company, Blue Martini Software, that provides software to companies seeking to personalize their products to individual customers. This customer targeting approach is accomplished through the use of artificial intelligence concepts Zweben worked on while at Ames. The Ames AI research has found applications in clickstream mining and purchasing behavior data collection.

  8. Characteristics of University Students Who Mix Alcohol and Energy Drinks

    Bonar, Erin E.; Green, Michaela R.; Ashrafioun, Lisham

    2017-01-01

    Objective: Research has identified correlates (e.g., drug use, risky sex, smoking) of using alcohol mixed with energy drinks (AMEDs). Few studies have investigated common mental health-related concerns (e.g., depression, sleep). Participants: Alcohol-using college students (n = 380 never used AMEDs, n = 180 used AMEDs) were recruited in the study…

  9. Canine urolithiasis: A look at over 16 000 urolith submissions to the Canadian Veterinary Urolith Centre from February 1998 to April 2003

    2004-01-01

    Abstract The purpose of this study was to report on the age, sex, breed, and mineral composition of 16 647 canine bladder uroliths submitted to the Canadian Veterinary Urolith Centre between February 1998 and April 2003. Each urolith submission was accompanied by a questionnaire. Of the submissions, approximately 43.8% were struvite and 41.5% oxalate. Struvite uroliths were most common in female dogs. Mixed breed dogs predominated, followed by the shih tzu, bichon frise, miniature schnauzer, Lhasa apso, and Yorkshire terrier. Oxalate uroliths were most common in males and in the miniature schnauzer, bichon frise, Lhasa apso, shih tzu, and Yorkshire terrier. Urate uroliths were most common in male Dalmations. Other urolith types, including cystine, xanthine, silica, and calcium phosphate, were less commonly reported. A review of risk factors for the various uroliths is presented, along with some recommendations for treatment and prevention. PMID:15072194

  10. Role of relative humidity in controlling rate of aflatoxin contamination in certain medicinal herbs under prolonged storage

    Elbazza, Z.E.; Mahmoud, M.I.; Roushdy, H.M.; Farrag, H.A.; Tablawy, S.Y.E.I.

    1995-01-01

    The effect of water activity on growth of aspergillus flavus test strain and aflatoxin production was studied in sabouraoud's yeast broth regulated with glycerol. Aflatoxin production increased with increasing the a w . The minimal a w was 0.92 for fungal growth and aflatoxins production. Growth of A.flavus test strain and aflatoxin production at 26+- I o and two relative humidities of 85% and 92.9% along four months incubation period on caraway, khlla, shih balady and wild chamomile samples were investigated. At 92.9% Rh, growth of A.flavus on caraway and khella samples was noticed after 20 days of incubation and increased with time incubation and increased with time. Aflatoxin production was detected after 30 days and decreased with prolonged incubation. Fungal growth and aflatoxin production were not observed on shih balady and wild chamomile samples at 92.9% Rh, and on the for studied herbs at 85%, Rh. 3 tabs

  11. Lipid Membrane Encapsulation of a 3D DNA Nano Octahedron.

    Perrault, Steven D; Shih, William M

    2017-01-01

    Structural DNA nanotechnology methods such as DNA origami allow for the synthesis of highly precise nanometer-scale materials (Rothemund, Nature 440:297-302, 2006; Douglas et al., Nature 459:414-418, 2009). These offer compelling advantages for biomedical applications. Such materials can suffer from structural instability in biological environments due to denaturation and nuclease digestion (Hahn et al., ACS Nano 2014; Perrault and Shih, ACS Nano 8:5132-5140, 2014). Encapsulation of DNA nanostructures in a lipid membrane compartmentalizes them from their environment and prevents denaturation and nuclease digestion (Perrault and Shih, ACS Nano 8:5132-5140, 2014). Here, we describe the encapsulation of a 50 nm DNA nanostructure having the geometry of a wireframe octahedron in a phospholipid membrane containing poly-(ethylene glycol), resulting in biocompatible DNA nanostructures.

  12. Supersymmetry Breaking, Gauge Mediation, and the LHC

    Shih, David

    2015-01-01

    Gauge mediated SUSY breaking (GMSB) is a promising class of supersymmetric models that automatically satisfies the precision constraints. Prior work of Meade, Seiberg and Shih in 2008 established the full, model-independent parameter space of GMSB, which they called 'General Gauge Mediation' (GGM). During the first half of 2010-2015, Shih and his collaborators thoroughly explored the parameter space of GGM and established many well-motivated benchmark models for use by the experimentalists at the LHC. Through their work, the current constraints on GGM from LEP, the Tevatron and the LHC were fully elucidated, together with the possible collider signatures of GMSB at the LHC. This ensured that the full discovery potential for GGM could be completely realized at the LHC.

  13. A Network Analysis of the Teachers and Graduate Students’ Research Topics in the Field of Mass Communication

    Ming-Shu Yuan; Yung-Nan Yu

    2013-01-01

    The completion of a master’s thesis requires the advisor’s guidance on topic selection, data collection, analysis, interpretation and writing. The advisory committee’s input also contributes to the work. This study conducted content analysis and network analysis on a sample of 547 master’s theses from eight departments of the College of Journalism and Communications of Shih Hsin University to examine the relationships between the advisors and committee members as well as the connections of re...

  14. Prevention of Ovarian High Grade Serous Carcinoma by Elucidating Its Early Changes

    2016-10-01

    Cancer Res, in press. PMID: 27590741 31. Ayhan A, Kuhn E, Wu RC, Ogawa H, Talbott AB, Mao TL, Sugimura H, Shih IM, Wang TL. CCNE1 copy number gain...most significant focal DNA somatic copy number alterations were shared between cases with and without STIC lesions. Class comparison of the RNA...significant effort has been placed on determining the menstrual status of samples collected – this included reviewing the endometrium of corresponding

  15. High Seas Buffer: The Taiwan Patrol Force, 1950-1979

    2012-04-01

    It is prohibited to use NWC’s logo on any republication of this book without the express, written permission of the Editor, Naval War College Press, or...watches and developed an English–Chinese signal book to be used in communications between American and Nationalist ships. With the help of foreign... secondhand from Belgium, Canada, Denmark, Germany, and Japan. One of their primary missions was to patrol the strait. On 13 January 1967, Maj. Shih-Lin Hu

  16. Monoamine Oxidase A: A Novel Target for Progression and Metastasis of Prostate Cancer

    2015-12-01

    dye* Corresponding author. Uro -Oncology Research Pr Center, 8750 Beverly Blvd., Atrium 103, Los Angeles, E-mail address: Leland.Chung@cshs.org (L.W.K...INVESTIGATOR: Jean C. Shih, Ph.D. CONTRACTING ORGANIZATION: University of Southern California Los Angeles, CA 90089-0001 REPORT DATE: December 2015...SOUTHERN CALIFORNIA 3720 S. FLOWER STREET LOS ANGELES, CA 90089-0001 9. SPONSORING / MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR/MONITOR’S

  17. Researcher might have found answer to 'birth of the universe'

    2003-01-01

    A National Taiwan University (NTU) research team has discovered a new physical phenomenon that could challenge the well-accepted theory about the birth of the universe. However,Lee Shih-chang, a researcher at Academia Sinica's Institute of Physics, said the new scientific research results will be accepted only after an academic paper detailing the research process and conclusions is released and the research results are verified by experts in the field.

  18. Contribution of Fuzzy Minimal Cost Flow Problem by Possibility Programming

    S. Fanati Rashidi; A. A. Noora

    2010-01-01

    Using the concept of possibility proposed by zadeh, luhandjula ([4,8]) and buckley ([1]) have proposed the possibility programming. The formulation of buckley results in nonlinear programming problems. Negi [6]re-formulated the approach of Buckley by the use of trapezoidal fuzzy numbers and reduced the problem into fuzzy linear programming problem. Shih and Lee ([7]) used the Negi approach to solve a minimum cost flow problem, whit fuzzy costs and the upper and lower bound. ...

  19. Bio-Inspired Nanomaterials: Protein Cage Nano-Architectures

    2008-04-01

    Shevchenko, A. Weizsacker, F. (2004). Hepatitis B virus nucleocapsids (2003). Fast-response proteomics by accelerated in-gel formed by carboxy-terminally...Newman, M. & Shih, C. sin. Proteomics , 5, 2319-2321. (2005). Exposure of RNA templates and encapsidation 60. Prudova, A., Bauman, Z., Braun, A...isolated from the fungus Dactylium dendroides [I]. It is H334, Y329, G513, and T580) and water molecules. composed of three distinct domains, organized

  20. A Quantum Network with Atoms and Photons

    2016-09-01

    98, 111115. 5. Karmakar, S, Shih, Y. Two- color ghost imaging with enhanced angular resolving power. Physical Review A. 2010; 81, 033845. 6. Karmakar...information. We constructed the rubidium (⁸⁷Rb) atomic memory magneto optical trap (MOT) cell and laser controls, and developed protocols, hardware, and...software to control the secure teleportation of information between quantum memories at ARL and JQI. Notably, we performed successful in-laboratory

  1. Sustained release of vancomycin from novel biodegradable nanofiber-loaded vascular prosthetic grafts: in vitro and in vivo study

    Liu, Kuo-Sheng; Lee, Cheng-Hung; Wang, Yi-Chuan; Liu, Shih-Jung

    2015-01-01

    Kuo-Sheng Liu,1 Cheng-Hung Lee,2 Yi-Chuan Wang,3 Shih-Jung Liu3 1Department of Thoracic and Cardiovascular Surgery, Chang Gung Memorial Hospital, Linkou, Taiwan; 2Division of Cardiology, Department of Internal Medicine, Chang Gung Memorial Hospital, Linkou, Taiwan; 3Department of Mechanical Engineering, Chang Gung University, Tao-Yuan, Taiwan Abstract: This study describes novel biodegradable, drug-eluting nanofiber-loaded vascular prosthetic grafts that provide local and sustained...

  2. Two-stage estimation in copula models used in family studies

    Andersen, Elisabeth Anne Wreford

    2005-01-01

    by Shih and Louis (Biometrics vol. 51, pp. 1384-1399, 1995b) and Glidden (Lifetime Data Analysis vol. 6, pp. 141-156, 2000). Because register based family studies often involve very large cohorts a method for analysing a sampled cohort is also derived together with the asymptotic properties...... of the estimators. The proposed methods are studied in simulations and the estimators are found to be highly efficient. Finally, the methods are applied to a study of mortality in twins....

  3. JPRS Report East Asia Southeast Asia

    1987-06-05

    31 Mar 87) 20 Palm Oil Industry Promotion Moves Proposed (Lim Hock Chye ; BUSINESS TIMES, 1 May 87) .. 22 Paper Comments on 5th Malaysia Plan...1 [Article by Lim Hock Chye ] [Text] A GOVERNMENT-INDUSTRY committee has recommended the Implementation of several measures to strengthen the...stopped due to lack of funds for providing subsidies. According to Deputy Education Minister (Yun Shih- Chin ), Chinese-language classes in several

  4. Fiches pratiques: "Oui, je viens de Taiwan"; L'habit ne fait pas le moine; Objets inanimes avez-vous donc une ame?; La Bourse et la voix (Practical Ideas: "Yes, I Come from Taiwan"; The Clothes Don't Make the Man; Inanimate Objects, Do You Have a Soul?; The Stock Exchange and the Voice).

    Durbant, Jean-Claude; And Others

    1988-01-01

    Four ideas for classroom instruction are presented, including an approach to teaching foreign nationals or immigrants, a lesson in clothing and its terminology, an explanation of the symbolism and language of the French Revolution, and a description of how to use radio programs about economics. (MSE)

  5. EVALUACIÓN DE LAS PROPIEDADES QUÍMICAS Y FUNCIONALES DEL ALMIDÓN NATIVO DE ÑAME CONGO ( Dioscorea bulbifera L. PARA PREDECIR SUS POSIBLES USOS TECNOLÓGICOS I EVALUATION OF CHEMICAL AND FUNCTIONAL PROPERTIES OF NATIVE STARCH OF CONGO YAM ( Dioscorea bulbifera L. TO PREDICT ITS POSSIBLE TECHNOLOGICAL USES

    Ninoska Meaño Correa

    2018-04-01

    Full Text Available In Venezuela, the starches are mostly obtained from corn, potato, yuca and rice. Nonetheless, there are other sources for starch production and local consumption whose potential could be exploited, seeking alternatives to increase the added value to local agricultural products. Question arose about to evaluate chemical and functional properties of native starch from congo yam in order to predict its possible uses. With this purpose, bulbs of congo yam were collected in the town of Santa Ana of Anzoategui state, Venezuela, and starch was extracted from them for evaluating the yield, purity, chemical composition, amylose content, gel clarity, swelling power and solubility. The starch yield was 7.44%, and its purity was 99.29%. The chemical composition (on dry basis was of 11.29% moisture, 0.29% protein, 0.21% fat, 0.21% ash and 0.0047% phosphorus. The average content of amylose and amylopectin was 30.63 and 69.37%, respectively. As to the functional properties of starchits swelling power had a maximum of 49.05 g gel/g of starch at 95°C, clear gel formation with a transmittance rate of 91 % and a solubility that increases as the temperature rises. These results indicate that the yam congo is a source of starch with advantageous properties, a high amylose content, a clear gel with high swelling power

  6. Terminal area energy management regime investigations utilizing an 0.030-scale model (47-0) of the space shuttle vehicle orbiter configuration 140A/B/C/R in the Ames Research Center 11 x 11 foot transonic wind tunnel (0A148), volume 1

    Hawthorne, P. J.

    1976-01-01

    Data obtained in wind tunnel tests are presented. The objectives of the tests were to: (1) obtain pressure distributions, forces and moments over the vehicle 5 Orbiter in the terminal area energy management (TAEM) and approach phases of flight; (2) obtain elevon and rudder hinge moments in the TAEM and approach phases of flight; (3) obtain body flap and elevon loads for verification of loads balancing with integrated pressure distributions; and (4) obtain pressure distributions near the short OMS pods in the high subsonic, transonic and low supersonic Mach number regimes. Testing was conducted over a Mach number range from 0.6 to 1.4 with Reynolds number variations from 4.57 million to 2.74 million per foot. Model angle-of-attack was varied from -4 to 16 degrees and angles of side slip ranged from -8 to 8 degrees.

  7. Terminal area energy management regime investigations utilizing an 0.030-scale model (47-0) of the space shuttle vehicle orbiter configuration 140A/B/C/R in the Ames Research Center 11 x 11 foot transonic wind tunnel (OA148), volume 5

    Hawthorne, P. J.

    1976-01-01

    Data obtained in wind tunnel test OA148 are presented. The objectives of the test series were to: (1) obtain pressure distributions, forces and moments over the vehicle 5 orbiter in the thermal area energy management (TAEM) and approach phases of flight; (2) obtain elevon and rudder hinge moments in the TAEM and approach phases of flight; (3) obtain body flap and elevon loads for verification of loads balancing with integrated pressure distributions; and (4) obtain pressure distributions near the short OMS pods in the high subsonic, transonic and low supersonic Mach number regimes.

  8. Terminal area energy management regime investigations utilizing an 0.030-scale model (47-0) of the space shuttle vehicle orbiter configuration 140A/B/C/R in the Ames Research Center 11 x 11 foot transonic wind tunnel (OH/48)

    Hawthorne, P. J.

    1976-01-01

    Data obtained in a wind tunnel test were examined to: (1) obtain pressure distributions, forces and moments over the vehicle 5 Orbiter in the terminal area energy management (TAEM) and approach phases of flight; (2) obtain elevon and rudder hinge moments in the TAEM and approach phases of flight; (3) obtain body flap and elevon loads for verification of loads balancing with integrated pressure distributions; and (4) obtain pressure distributions near the short OMS pods in the high subsonic, transonic and low supersonic Mach number regimes. Testing was conducted over a Mach number range from 0.6 to 1.4 with Reynolds number variations from 7.57 x 1 million to 2.74 x 1 million per foot. Model angle of attack was varied from -4 to 16 degrees and angles of sideslip ranged from -8 to 8 degrees.

  9. A CASE AGAINST SPINNING PAHS AS THE SOURCE OF THE ANOMALOUS MICROWAVE EMISSION

    Hensley, Brandon S.; Draine, B. T. [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Meisner, Aaron M., E-mail: brandon.s.hensley@jpl.nasa.gov [Berkeley Center for Cosmological Physics, Berkeley, CA 94720 (United States)

    2016-08-10

    We employ an all-sky map of the anomalous microwave emission (AME) produced by component separation of the microwave sky to study correlations between the AME and Galactic dust properties. We find that while the AME is highly correlated with all tracers of dust emission, the best predictor of the AME strength is the dust radiance. Fluctuations in the AME intensity per dust radiance are uncorrelated with fluctuations in the emission from polycyclic aromatic hydrocarbons (PAHs), casting doubt on the association between AME and PAHs. The PAH abundance is strongly correlated with the dust optical depth and dust radiance, consistent with PAH destruction in low density regions. We find that the AME intensity increases with increasing radiation field strength, at variance with predictions from the spinning dust hypothesis. Finally, the temperature dependence of the AME per dust radiance disfavors the interpretation of the AME as thermal emission. A reconsideration of other AME carriers, such as ultrasmall silicates, and other emission mechanisms, such as magnetic dipole emission, is warranted.

  10. Proper expression of metabolizable energy in avian energetics

    Miller, M.R.; Reinecke, K.J.

    1984-01-01

    We review metabolizable energy (ME) concepts and present evidence suggesting that the form of ME used for analyses of avian energetics can affect interpretation of results. Apparent ME (AME) is the most widely used measure of food energy available to birds. True ME(TME) differs from AME in recognizing fecal and urinary energy of nonfood origin as metabolized energy. Only AME values obtained from test birds fed at maintenance levels should be used for energy analyses. A practical assay for TME has shown that TME estimates are less sensitive than AME to variation in food intake. The TME assay may be particularly useful in studies of natural foods that are difficult to obtain in quantities large enough to supply test birds with maintenance requirements. Energy budgets calculated from existence metabolism should be expressed as kJ of AME and converted to food requirements with estimates of metabolizability given in kJ AME/g.

  11. Technical paper contest for women 1992. Space challenges: Earth and beyond

    Orans, Robin (Editor)

    1993-01-01

    Two of the major concerns of the NASA Ames Research Center (NASA ARC) Advisory Committee for Women (ACW) are that recruitment of women scientists, engineers, and technicians needs to increase and that barriers to advancement need to be removed for improved representation of women in middle and upper management and scientific positions. One strategy that addressed this concern was the ACW sponsorship of a Technical Paper Contest for Women at Ames Research Center. Other sponsors of the Contest were the Ames Equal Opportunity Council and the Ames Contractor Council. The Technical Paper Contest for Women greatly increased the visibility of both the civil service women and the women who work for contractors at Ames. The women had the opportunity to hone their written and oral presentation skills. Networking among Ames women increased.

  12. Alcohol Mixed with Energy Drinks: Daily Context of Use.

    Linden-Carmichael, Ashley N; Lau-Barraco, Cathy

    2017-04-01

    The link between use of alcohol mixed with energy drinks (AmEDs) and alcohol-related harms is well established, but limited research has examined the context in which AmEDs are consumed. Identifying the social and environmental characteristics of use may illuminate whether AmEDs are used in settings that could increase the likelihood of engaging in risky behaviors or experiencing harms. This study used a 2-week daily diary assessment to compare days in which AmEDs were consumed ("AmED days") and days where other types of alcohol were used ("non-AmED days") on where, when, and with whom drinking occurred. Participants were 122 (90 women) heavy drinking college students who reported mixing caffeine with alcohol at least once in the past week. Data were collected across 389 drinking days; 40 of these days involved AmED use. Multilevel modeling findings revealed that odds of drinking AmEDs were higher on days where individuals drank at a bar or club and drank at home relative to other locations. In addition, odds of pregaming were higher on AmED days as compared to non-AmED days. AmED use was linked with lower odds of drinking game behavior. Overall, AmEDs appear to be consumed in potentially risky contexts. In combination with prior findings that AmED days are linked with heavier alcohol use and more harms experienced, these findings support the unique nature of AmED consumption in terms of the factors that may predict or maintain potentially hazardous drinking patterns. Copyright © 2017 by the Research Society on Alcoholism.

  13. Alcohol Mixed with Energy Drinks: Consumption Patterns and Motivations for Use in U.S. College Students

    Cecile A. Marczinski

    2011-08-01

    Full Text Available Binge drinking in college students is widespread and known to cause significant harms and health hazards for the drinker. One factor that may be exacerbating hazardous drinking in young people is the new popular trend of consuming alcohol mixed with energy drinks (AmED. However, rates of AmED use and motivations for AmED consumption in college students have not been well established. In this study, 706 undergraduate college students from a university in the United States participated in a web-based survey that queried self-reported alcohol, energy drink, and AmED use. In addition, motivations for using AmEDs were assessed. The results indicated that for all participants, 81% reported that they have tried at least one energy drink in the past and 36% reported consumption of at least one energy drink in the past 2 weeks. Alcohol consumption patterns were similar to findings from U.S. national surveys of college drinking, as 37% of respondents were classified as binge drinkers and 23% abstained from drinking. In the whole sample (including the alcohol abstainers, 44% reported trying AmED at least once and 9% reported AmED consumption at least once in the past 2 weeks. 78% of respondents agreed with the statement that AmEDs appeal to underage drinkers. When AmED users were asked about various motivations for consuming AmEDs, users reported that they consumed these beverages to get drunk and reduce sedation compared to alcohol alone. In conclusion, the consumption of AmEDs is common in U.S. college students. Motivations for using AmEDs include the reduction of the sedative effects of alcohol, an important interoceptive cue that one should stop drinking.

  14. 1993 Technical Paper Contest for Women. Gear Up 2000: Women in Motion

    Orans, Robin (Editor); Duckett, Sophie (Editor); White, Susan (Editor)

    1994-01-01

    The NASA Ames Research Center Advisory Committee for Women (ACW) sponsored the second ACW Technical paper Contest for Ames women in order to increase the visibility of, and to encourage writing for publication by Ames women scientists, engineers, and technicians. The topics of the contest paper mirrored in the topics of the 1993 Society for Women Engineers (SWE) National Convention, which included technological, workplace, global, and family issues.

  15. Motives for mixing alcohol with energy drinks and other non-alcoholic beverages and its effects on overall alcohol consumption among UK students.

    Johnson, Sean J; Alford, Chris; Verster, Joris C; Stewart, Karina

    2016-01-01

    A UK student survey examined the motivations for consuming energy drinks alone and mixed with alcohol, and aimed to determine whether the type of motive had a differential effect on overall alcohol consumption. The online survey (N = 1873) assessed alcohol consumption and motivations for consumption when mixed with energy drinks (AMED) and mixed with other non-alcoholic beverages (AMOB) using a within-subject design. The most frequent neutral motives reported for AMED consumption included "I like the taste" (66.5%), and "to celebrate a special occasion" (35.2%). 52.6% of AMED consumers reported consuming AMED for at least one of five negative motives, primarily "to get drunk" (45.6%). Despite these negative motives those students reported consuming significantly less alcohol and fewer negative alcohol-related consequences on AMED occasions compared to alcohol-only (AO) occasions. Although the motives for consuming AMED and AMOB were comparable, more participants reported consuming AMED "to celebrate a special occasion", "to get drunk", because they "received the drink from someone else" or "because others drink it as well". However, significantly more students reported consuming AMOB than AMED because "It feels like I can drink more alcohol". Alcohol consumption was significantly less on AMED occasions compared to AMOB occasions, and both occasions significantly less than AO occasions. The majority of reasons for consuming AMED relate to neutral motives. Although 52.6% of students reported one or more negative motives for AMED consumption (predominantly "to get drunk") this had no differential effect on total alcohol consumption. The differences in motives suggest AMED is consumed more to enjoy special occasions and as a group-bonding experience, however alcohol consumption is significantly lower on such occasions in comparison to when AMOB or AO are consumed. Copyright © 2015. Published by Elsevier Ltd.

  16. Effects of Aircraft Noise and Sonic Booms on Domestic Animals and Wildlife: A Literature Synthesis

    1988-06-01

    auditory thresholds of Suffolk ewe lambs (Ames and Arehart 1972; Ames 1978) and cattle (Ames 1974). The threshold curve of the lambs declined...in castrated male pigs exposed to 93-dB (un- specified frequency) continuous noise over several days (Dufour 1980). Excess aldosterone may be induced...34 intake, and behavioral activity of ponies and beef cattle . Pages 170-175 in Proc. Int. Livest. Environ. Symp., University of Nebraska, Lincoln. Am. Soc

  17. Daily conformity drinking motivations are associated with increased odds of consuming alcohol mixed with energy drinks.

    Linden-Carmichael, Ashley N; Lau-Barraco, Cathy

    2018-04-01

    Recent research indicates that individuals drank more heavily and experienced more harms on days they consumed alcohol mixed with energy drinks (AmEDs). Limited research, thus far, has examined predictors of AmED use on a daily level. Drinking motives, or reasons for drinking, are shown to discern AmED users from non-users, but the extent to which daily drinking motives covary with AmED use has not been tested. The current study used a daily diary design to determine how motives differ between AmED and other drinking occasions. Participants included 122 college students (73.8% women) with a mean age of 20.39years. Participants completed up to 14 daily surveys, resulting in 389 drinking days (40days involved AmED use). Participants reported on their drinking motives at baseline as well as on each drinking day. Multilevel models revealed that, after controlling for other motives, AmED use was more likely on days where conformity motives were higher than usual and was less likely when enhancement motives were higher. Daily social and coping motives as well as all motives measured at baseline were unassociated with AmED use. Our findings suggest that conformity motives, or drinking to fit in with others, are the most salient drinking motive predicting AmED use on a drinking day. Given that conformity motives are often less associated with alcohol use outcomes in general, these findings highlight AmEDs as a unique alcoholic beverage. Clinicians and interventionists working with frequent AmED users should consider the unique conditions under which AmEDs are consumed. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Alcohol mixed with energy drinks: consumption patterns and motivations for use in U.S. college students.

    Marczinski, Cecile A

    2011-08-01

    Binge drinking in college students is widespread and known to cause significant harms and health hazards for the drinker. One factor that may be exacerbating hazardous drinking in young people is the new popular trend of consuming alcohol mixed with energy drinks (AmED). However, rates of AmED use and motivations for AmED consumption in college students have not been well established. In this study, 706 undergraduate college students from a university in the United States participated in a web-based survey that queried self-reported alcohol, energy drink, and AmED use. In addition, motivations for using AmEDs were assessed. The results indicated that for all participants, 81% reported that they have tried at least one energy drink in the past and 36% reported consumption of at least one energy drink in the past 2 weeks. Alcohol consumption patterns were similar to findings from U.S. national surveys of college drinking, as 37% of respondents were classified as binge drinkers and 23% abstained from drinking. In the whole sample (including the alcohol abstainers), 44% reported trying AmED at least once and 9% reported AmED consumption at least once in the past 2 weeks. 78% of respondents agreed with the statement that AmEDs appeal to underage drinkers. When AmED users were asked about various motivations for consuming AmEDs, users reported that they consumed these beverages to get drunk and reduce sedation compared to alcohol alone. In conclusion, the consumption of AmEDs is common in U.S. college students. Motivations for using AmEDs include the reduction of the sedative effects of alcohol, an important interoceptive cue that one should stop drinking.

  19. Optimal quantum error correcting codes from absolutely maximally entangled states

    Raissi, Zahra; Gogolin, Christian; Riera, Arnau; Acín, Antonio

    2018-02-01

    Absolutely maximally entangled (AME) states are pure multi-partite generalizations of the bipartite maximally entangled states with the property that all reduced states of at most half the system size are in the maximally mixed state. AME states are of interest for multipartite teleportation and quantum secret sharing and have recently found new applications in the context of high-energy physics in toy models realizing the AdS/CFT-correspondence. We work out in detail the connection between AME states of minimal support and classical maximum distance separable (MDS) error correcting codes and, in particular, provide explicit closed form expressions for AME states of n parties with local dimension \

  20. New Fellows and Honorary Fellow

    Specialization: Chemical Reaction Engineering, Fluidization and Organic Synthesis Engineering ... Department of Chemical Engineering, Iowa State University, 1031, Sweeney Hall, Ames, Iowa 50011-2230, ... Upcoming Refresher Courses.

  1. ORF Alignment: NC_007530 [GENIUS II[Archive

    Full Text Available NC_007530 gi|47530092 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain protein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom

  2. ORF Alignment: NC_003995 [GENIUS II[Archive

    Full Text Available NC_003995 gi|21402596 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain prot...ein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP domain protein [Bacillus anthr...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom

  3. ORF Alignment: NC_005945 [GENIUS II[Archive

    Full Text Available NC_005945 gi|49187443 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain prot...ein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP domain protein [Bacillus anthr...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom

  4. ORF Alignment: NC_003997 [GENIUS II[Archive

    Full Text Available NC_003997 gi|30264621 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain prot...ein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP domain protein [Bacillus anthr...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom

  5. ATROFIA MUSCULAR ESPINAL: MANEJO RESPIRATORIO EN LA PERSPECTIVA DE LOS RECIENTES AVANCES TERAPÉUTICOS

    Dra. María Angélica Palomino; Dra. Claudia Castiglioni

    2017-01-01

    La atrofia muscular espinal (AME) es la primera causa genética de mortalidad en lactantes. La severidad de las manifestaciones clínicas es un continuo, con tres principales subtipos en pediatría: AME1 que se presenta en recién nacidos y no logran sentarse, AME2 en niños que no logran caminar pero sí sentarse y AME3 que logran caminar. La complicación más seria es la insuficiencia respiratoria. El enfoque del manejo respiratorio es preventivo, con toma de decisiones anticipadas por parte de lo...

  6. Dicty_cDB: SFH564 [Dicty_cDB

    Full Text Available *lflfy*siikl*klgikmmlnnfltiihlvlnlvvdfimilkfqh*ME QFMDLQXNGFVDFPENPGFEESGFYLDQSVDMVEDRLGADGRPVYKNGNEPFIVTNKE...ame B: cwptgs*rp*f*lflfy*siikl*klgikmmlnnfltiihlvlnlvvdfimilkfqh*ME QFMDLQXNGFVDF

  7. ORF Alignment: NC_005945 [GENIUS II[Archive

    Full Text Available NC_005945 gi|49185498 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci

  8. ORF Alignment: NC_003995 [GENIUS II[Archive

    Full Text Available NC_003995 gi|21400565 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci

  9. ORF Alignment: NC_003997 [GENIUS II[Archive

    Full Text Available NC_003997 gi|30262655 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci

  10. ORF Alignment: NC_007530 [GENIUS II[Archive

    Full Text Available NC_007530 gi|47527965 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci

  11. The morphology of the Anomalous Microwave Emission in the Planck 2015 data release

    Hausegger, Sebastian von; Liu, Hao, E-mail: s.vonhausegger@nbi.dk, E-mail: liuhao@nbi.dk [The Niels Bohr Institute and Discovery Center, Blegdamsvej 17, 2100 Copenhagen Ø (Denmark)

    2015-08-01

    We calculate weighted mosaic correlations between the recently published Planck 2015 foreground maps— both anomalous microwave emission (AME) maps, free-free emission, synchrotron radiation and thermal dust emission. The weighting coefficients are constructed taking account of the signal-to-error ratio given by the data product. Positive correlation is found for AME compared with thermal dust emission as well as synchrotron radiation. We find AME and free-free emission tending to be anti-correlated, however, when investigating different scales, their relationship appears to be more complex. We argue that dust particles responsible for AME are pushed out of hot zones in the interstellar medium (ISM)

  12. Dicty_cDB: CHP689 [Dicty_cDB

    Full Text Available date 2002.10.25 Translated Amino Acid sequence tvgllvvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakw ...ames) Frame A: tvgllvvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakw tspen

  13. Fasting urinary calcium-to-creatinine and oxalate-to-creatinine ratios in dogs with calcium oxalate urolithiasis and breed-matched controls.

    Furrow, E; Patterson, E E; Armstrong, P J; Osborne, C A; Lulich, J P

    2015-01-01

    Hypercalciuria and hyperoxaluria are risk factors for calcium oxalate (CaOx) urolithiasis, but breed-specific reports of urinary metabolites and their relationship with stone status are lacking. To compare urinary metabolites (calcium and oxalate) and blood ionized calcium (iCa) concentrations between CaOx stone formers and breed-matched stone-free controls for the Miniature Schnauzer, Bichon Frise, and Shih Tzu breeds. Forty-seven Miniature Schnauzers (23 cases and 24 controls), 27 Bichons Frise (14 cases and 13 controls), and 15 Shih Tzus (7 cases and 8 controls). Prospective study. Fasting spot urinary calcium-to-creatinine and oxalate-to-creatinine ratios (UCa/Cr and UOx/Cr, respectively) and blood iCa concentrations were measured and compared between cases and controls within and across breeds. Regression models were used to test the effect of patient and environmental factors on these variables. UCa/Cr was higher in cases than controls for each of the 3 breeds. In addition to stone status, being on a therapeutic food designed to prevent CaOx stone recurrence was associated with higher UCa/Cr. UOx/Cr did not differ between cases and controls for any of the breeds. Blood iCa was higher in cases than controls in the Miniature Schnauzer and Bichon Frise breeds and had a moderate correlation with UCa/Cr. Hypercalciuria is associated with CaOx stone status in the Miniature Schnauzer, Bichon Frise, and Shih Tzu breeds. UOx/Cr did not correlate with stone status in these 3 breeds. These findings may influence breed-specific stone prevention recommendations. Copyright © 2015 by the American College of Veterinary Internal Medicine.

  14. Cervical intervertebral disk herniation in chondrodystrophoid and nonchondrodystrophoid small-breed dogs: 187 cases (1993-2013).

    Hakozaki, Takaharu; Iwata, Munetaka; Kanno, Nobuo; Harada, Yasuji; Yogo, Takuya; Tagawa, Masahiro; Hara, Yasushi

    2015-12-15

    To identify characteristics of chondrodystrophoid and nonchondrodystrophoid small-breed dogs with cervical intervertebral disk herniation (IVDH). Retrospective case series. 187 small-breed (≤ 15 kg [33 lb]) dogs that underwent surgery because of cervical IVDH. Medical records were reviewed for information on breed, sex, age, weight, location of affected intervertebral disks, duration and severity of neurologic signs, and recovery time. 55 of the 187 (29.4%) dogs were Beagles. The most frequently affected intervertebral disk was C2-3 (81/253 [32.0%]), and this was the more frequently affected intervertebral disk in dogs of several chondrodystrophoid breeds, including Beagles (29/66 [43.9%]), Dachshunds (13/37 [35.1%]), Shih Tzus (16/41 [39.0%]), and Pekingese (3/10 [30.0%]). However, caudal disks (C5-6 or C6-7) were more frequently affected in Yorkshire Terriers (13/24 [54.2%]) and Chihuahuas (9/13 [69%]). Shih Tzus and Yorkshire Terriers were significantly older at the time of surgery (mean ± SD age, 9.6 ± 2.3 years and 9.5 ± 2.5 years, respectively) than were Pomeranians (6.2 ± 2.3 years), and Yorkshire Terriers had a significantly higher number of affected disks (2.0 ± 0.9) than did Dachshunds (1.1 ± 0.3). Mean recovery time was significantly longer in Yorkshire Terriers (36.7 ± 13.0 days) than in Beagles (16.5 ± 17.1 days), Shih Tzus (17.8 ± 14.5 days), or Chihuahuas (12.2 ± 7. 2 days). Results suggested that there may be breed-specific differences in the characteristics of cervical IVDH in small-breed dogs.

  15. Are energy drinks unique mixers in terms of their effects on alcohol consumption and negative alcohol-related consequences?

    Johnson, Sean J; Alford, Chris; Stewart, Karina; Verster, Joris C

    2018-01-01

    Previous research has suggested that consuming alcohol mixed with energy drinks (AMED) increases overall alcohol consumption. However, there is limited research examining whether energy drinks are unique in their effects when mixed with alcohol, when compared with alcohol mixed with other caffeinated mixers (AOCM). Therefore, the aim of this survey was to investigate alcohol consumption on AMED occasions, to that on other occasions when the same individuals consumed AOCM or alcohol only (AO). A UK-wide online student survey collected data on the frequency of alcohol consumption and quantity consumed, as well as the number of negative alcohol-related consequences reported on AO, AMED and AOCM occasions (N=250). Within-subjects analysis revealed that there were no significant differences in the number of alcoholic drinks consumed on a standard and a heavy drinking session between AMED and AOCM drinking occasions. However, the number of standard mixers typically consumed was significantly lower on AMED occasions compared with AOCM occasions. In addition, when consuming AMED, students reported significantly fewer days consuming 5 or more alcohol drinks, fewer days mixing drinks, and fewer days being drunk, compared with when consuming AOCM. There were no significant differences in the number of reported negative alcohol-related consequences on AMED occasions to AOCM occasions. Of importance, alcohol consumption and negative alcohol-related consequences were significantly less on both AMED and AOCM occasions compared with AO occasions. The findings that heavy alcohol consumption occurs significantly less often on AMED occasions compared with AOCM occasions is in opposition to some earlier claims implying that greatest alcohol consumption occurs with AMED. The overall greatest alcohol consumption and associated negative consequences were clearly associated with AO occasions. Negative consequences for AMED and AOCM drinking occasions were similar, suggesting that energy

  16. GLOBAL CONVERGENCE FOR THE XOR BOOLEAN NETWORKS

    Ho, Juei-Ling

    2009-01-01

    Shih and Ho have proved a global convergent theorem for boolean network: if a map from $\\{0,1\\}^{n}$ to itself defines a boolean network has the conditions: (1) each column of the discrete Jacobian matrix of each element of $\\{0,1\\}^{n}$ is either a unit vector or a zero vector; (2) all the boolean eigenvalues of the discrete Jacobian matrix of this map evaluated at each element of $\\{0,1\\}^{n}$ are zero, then it has a unique fixed point and this boolean network is global convergent to the fi...

  17. People’s Republic of China Scientific Abstracts No. 164.

    1977-02-23

    of these articles. CONTENTS PAGE K’ O-HSUEH SHIH-YEN /SCIENTIFIC EXPERIMENT/ No 8, Äug 76 1 CHIH-WU HSUEH-PAO /ÄCTA BOTANICA SINICA/ Vol 18, No...AUTHOR: None ORG: Digital Control Teaching Group, Shanghai Sparetime Industrial University TITLE: "On the Principles of Digital Machine Tool Control...8217 College" SOURCE: Peking CHIH-WU HSUEH-PAO [AGTA BOTANICA SINICA] Vol 18 No 3, Sep 76 pp 198-201 EXCERPT OF ENGLISH ABSTRACT: The May-7 Agricultural

  18. People’s Republic of China Scientific Abstracts No. 179

    1977-11-08

    No 2, April 1977 7 CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICA] No 2, June 1977 22 I-CH’UAN HSUEH-PAO [ACTA GENETICA SINICA] No 1...2^-129 ^675] WANG Hsiang-yun [37*9 7^9 0061] ORG: Roth of Office of Microbiology Teaching and Research, First College of Military...2799 2973 3163], SHIH Wei-k’ang [2457 3262 1660], et al. AtmiOR: None ORG: Third Teaching and Research Group, Department of Hygiene

  19. People’s Republic of China Scientific Abstracts, Number 185

    1978-02-14

    CONTENTS PAGE HANG-K’UNG CHIH-SHIH [AERONAUTICAL KNOWLEDGE] No 10, October 1977 .... 1 CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICA] No 3, September 1977 8...launch units; 3) Chairman Hua visiting an earthquake damaged region; 4) a group of female pilots of a minority race. 3012 CSO: 4009 ACTA BOTANICA ...CHIH-WU HSUEH-PAO [ACTA BOTANICA SINICä] in Chinese Vol 19 No 3, Sep 77 pp 167-171 TEXT OF ENGLISH ABSTRACT: 1. The process of microsporogenesis

  20. Implementing general gauge mediation

    Carpenter, Linda M.; Dine, Michael; Festuccia, Guido; Mason, John D.

    2009-01-01

    Recently there has been much progress in building models of gauge mediation, often with predictions different than those of minimal gauge mediation. Meade, Seiberg, and Shih have characterized the most general spectrum which can arise in gauge-mediated models. We discuss some of the challenges of building models of general gauge mediation, especially the problem of messenger parity and issues connected with R symmetry breaking and CP violation. We build a variety of viable, weakly coupled models which exhibit some or all of the possible low energy parameters.

  1. 正史乐志书写方式对《礼记・乐记》的继承与发展

    史, 文

    2016-01-01

    Yueji is the most important document for systematically recording the music of the pre-Qin period. The Annals of Music in the official Chinese history books has become the main text carrier after the book of Yueji. Yueji had a profound influence on later music literature, either on the concept of music or on the description of music, though it does not especially record the music’s history. Based on the analysis of Yueji, this thesis will take the Annals of Music in Shih Chi, Hanshu and Songs...

  2. Migration of a retained surgical swab into the jejunum in a dog.

    Day, J L; Pechman, R D; Bahr, R J

    2012-12-01

    A two-year-old spayed female shih-tzu was referred with a 10-month history of lethargy, chronic diarrhoea and weight loss. On presentation, a partial response to antibiotics was noted. Physical examination revealed an abdominal mass, and serum biochemistry and haematology revealed a mature neutrophilia, hypoalbuminaemia and a non-regenerative anaemia. Contrast radiography and abdominal ultrasound were suggestive of an intraluminal foreign body. Exploratory laparotomy revealed a surgical swab in the lumen of the jejunum that was associated with severe adhesions. Histopathology showed evidence of transmural migration of the swab from the peritoneal cavity to the lumen of the jejunum. © 2012 British Small Animal Veterinary Association.

  3. Pseudomembranous colitis within radiotherapy field following concurrent chemoradiation therapy: a case report

    Hsieh, Chen-Hsi; Shen,Bing-Jie; Lin,Shih-Chiang; Shueng,Pei-Wei; Tseng,Li-Ming; Chou,

    2013-01-01

    Bing-Jie Shen,1 Shih-Chiang Lin,2 Pei-Wei Shueng,1,3 Yueh-Hung Chou,4 Li-Ming Tseng,5 Chen-Hsi Hsieh1,6,71Division of Radiation Oncology, Department of Radiology, Far Eastern Memorial Hospital, Taipei, Taiwan; 2Division of Oncology and Hematology, Department of Internal Medicine, Far Eastern Memorial Hospital, Taipei, Taiwan; 3Department of Radiation Oncology, National Defense Medical Center, Taipei, Taiwan; 4Department of Anatomical Pathology, Far Eastern Memorial Hospital, Taipei, Taiwan; 5...

  4. Outstanding Student Paper Awards

    2004-04-01

    The following members in the Space Physics & Aeronomy Section received Outstanding Student Paper Awards at the 2003 AGU Fall Meeting in San Francisco, California. Arve Aksnes; Aroh Barjatya; Jacob Bortnik; Amir Caspi; Ruben Delgado; Galen Fowler; Paul G. Hanlon; Sid Henderson; Tara B. Hiebert; Chia-Lin Huang; Steven P. Joy; Eun-Hwa Kim; Colby Lemon; Yingjuan Ma; Elizabeth A. MacDonald; Jaco Minnie; Mitsuo Oka; Yoshitaka Okazaki; Erin J. Rigler; Ina P. Robertson; Patrick A. Roddy; Sang-Il Roh; Albert Y. Shih; Christopher Smithtro; Emma Spanswick; Maria Spasojevic; Hiroki Tanaka; Linghua Wang; Deirdre E. Wendel; Jichun Zhang>

  5. Popper's Experiment: A Modern Perspective

    Tabish Qureshi

    2012-11-01

    Full Text Available Karl Popper had proposed an experiment to test the standard interpretation of quantum mechanics. The proposal survived for many year in the midst of no clear consensus on what results it would yield. The experiment was realized by Kim and Shih in 1999, and the apparently surprising result led to lot of debate. We review Popper's proposal and its realization in the light of current era when entanglement has been well studied, both theoretically and experimentally. We show that the "ghost-diffraction" experiment, carried out in a different context, conclusively resolves the controversy surrounding Popper's experiment. Quanta 2012; 1: 19–32.

  6. Conformal sequestering simplified

    Schmaltz, Martin; Sundrum, Raman

    2006-01-01

    Sequestering is important for obtaining flavor-universal soft masses in models where supersymmetry breaking is mediated at high scales. We construct a simple and robust class of hidden sector models which sequester themselves from the visible sector due to strong and conformally invariant hidden dynamics. Masses for hidden matter eventually break the conformal symmetry and lead to supersymmetry breaking by the mechanism recently discovered by Intriligator, Seiberg and Shih. We give a unified treatment of subtleties due to global symmetries of the CFT. There is enough review for the paper to constitute a self-contained account of conformal sequestering

  7. SM-ND Age and REE Systematics of Larkman Nunatek 06319: Closed System Fractional Crystallization of a Shergottite Magma

    Shafer, J. T.; Brandon, A. D.; Lapen T. J.; Righter, M.; Peslier, A. H.

    2010-01-01

    Sm-Nd isotopic data were collected on mineral separates and bulk rock powders of LAR 06319, yielding an age of 180+/-13 Ma (2(sigma)). This age is concordant with the Lu-Hf age (197+/-29 Ma, [1]) determined in conjunction with these data and the Sm-Nd age (190+/-26 Ma) of Shih et al., 2009 [2]. The Sm-Nd data form at statistically significant isochron (Fig. 1) that is controlled largely by leachate-residue pairs (samples with the R suffix are residues after leaching in cold 2N HCl for 10 minutes).

  8. Contribution of Fuzzy Minimal Cost Flow Problem by Possibility Programming

    S. Fanati Rashidi

    2010-06-01

    Full Text Available Using the concept of possibility proposed by zadeh, luhandjula ([4,8] and buckley ([1] have proposed the possibility programming. The formulation of buckley results in nonlinear programming problems. Negi [6]re-formulated the approach of Buckley by the use of trapezoidal fuzzy numbers and reduced the problem into fuzzy linear programming problem. Shih and Lee ([7] used the Negi approach to solve a minimum cost flow problem, whit fuzzy costs and the upper and lower bound. In this paper we shall consider the general form of this problem where all of the parameters and variables are fuzzy and also a model for solving is proposed

  9. Sustained release of bactericidal concentrations of penicillin in the pleural space via an antibiotic-eluting pigtail catheter coated with electrospun nanofibers: results from in vivo and in vitro studies

    Chao, Yin-Kai; Lee, Cheng-Hung; Liu, Kuo-Sheng; Wang, Yi-Chuan; Wang, Chih-Wei; Liu, Shih-Jung

    2015-01-01

    Yin-Kai Chao,1 Cheng-Hung Lee,2 Kuo-Sheng Liu,1 Yi-Chuan Wang,3 Chih-Wei Wang,4 Shih-Jung Liu3 1Department of Thoracic and Cardiovascular Surgery, Chang Gung Memorial Hospital-Linkou, College of Medicine, Chang Gung University, Taoyuan, Taiwan; 2Division of Cardiology, Department of Internal Medicine, Chang Gung Memorial Hospital-Linkou, College of Medicine, Chang Gung University, Taoyuan, Taiwan; 3Department of Mechanical Engineering, Chang Gung University, Taoyuan, Taiwan; 4Department of P...

  10. RADIATION THERAPY COMMUNICATION-REIRRADIATION OF A NASAL TUMOR IN A BRACHYCEPHALIC DOG USING INTENSITY MODULATED RADIATION THERAPY.

    Rancilio, Nicholas J; Custead, Michelle R; Poulson, Jean M

    2016-09-01

    A 5-year-old spayed female Shih Tzu was referred for evaluation of a nasal transitional carcinoma. A total lifetime dose of 117 Gy was delivered to the intranasal mass in three courses over nearly 2 years using fractionated intensity modulated radiation therapy (IMRT) to spare normal tissues. Clinically significant late normal tissue side effects were limited to bilaterally diminished tear production. The patient died of metastatic disease progression 694 days after completion of radiation therapy course 1. This case demonstrates that retreatment with radiation therapy to high lifetime doses for recurrent local disease may be well tolerated with IMRT. © 2016 American College of Veterinary Radiology.

  11. 40 Years of the Salmonella Mutagenicity Assay: Implications for 21st Century Toxicology

    The Salmonella (Ames) mutagenicity assay was developed and introduced by Bruce Ames and colleagues in 1971. Since then, it has become the standard assay for hazard identification of mutagens worldwide. It is a first-tier test for mutagenic activity in the pharmaceutical and chemi...

  12. Yeast Interacting Proteins Database: YNL189W, YDR318W [Yeast Interacting Proteins Database

    Full Text Available ponent of the COMA complex (Ctf19p, Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits that are in cont...t of the COMA complex (Ctf19p, Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits that are in contact w

  13. Improved prediction of meat and bone meal metabolizable energy content for ducks through in vitro methods.

    Garcia, R A; Phillips, J G; Adeola, O

    2012-08-01

    Apparent metabolizable energy (AME) of meat and bone meal (MBM) for poultry is highly variable, but impractical to measure routinely. Previous efforts at developing an in vitro method for predicting AME have had limited success. The present study uses data from a previous publication on the AME of 12 MBM samples, determined using 288 White Pekin ducks, as well as composition data on these samples. Here, we investigate the hypothesis that 2 noncompositional attributes of MBM, particle size and protease resistance, will have utility in improving predictions of AME based on in vitro measurements. Using the same MBM samples as the previous study, 2 measurements of particle size were recorded and protease resistance was determined using a modified pepsin digestibility assay. Analysis of the results using a stepwise construction of multiple linear regression models revealed that the measurements of particle size were useful in building models for AME, but the measure of protease resistance was not. Relatively simple (4-term) and complex (7-term) models for both AME and nitrogen-corrected AME were constructed, with R-squared values ranging from 0.959 to 0.996. The rather minor analytical effort required to conduct the measurements involved is discussed. Although the generality of the results are limited by the number of samples involved and the species used, they suggest that AME for poultry can be accurately predicted through simple and inexpensive in vitro methods.

  14. Data Mining Tools Make Flights Safer, More Efficient

    2014-01-01

    A small data mining team at Ames Research Center developed a set of algorithms ideal for combing through flight data to find anomalies. Dallas-based Southwest Airlines Co. signed a Space Act Agreement with Ames in 2011 to access the tools, helping the company refine its safety practices, improve its safety reviews, and increase flight efficiencies.

  15. 75 FR 47059 - Notice To Rescind Notice of Intent To Prepare an Environmental Impact Statement: Warren County, IA

    2010-08-04

    ... Prepare an Environmental Impact Statement: Warren County, IA AGENCY: Federal Highway Administration (FHWA... Realty Manager, FHWA Iowa Division Office, 105 Sixth Street, Ames, IA 50010, Phone 515-233-7302; or James... Lincoln Way, Ames, IA 50010, Phone 515-239-1798. SUPPLEMENTARY INFORMATION: Electronic Access An...

  16. Implementation of a Computerized Maintenance Management System

    Shen, Yong-Hong; Askari, Bruce

    1994-01-01

    A primer Computerized Maintenance Management System (CMMS) has been established for NASA Ames pressure component certification program. The CMMS takes full advantage of the latest computer technology and SQL relational database to perform periodic services for vital pressure components. The Ames certification program is briefly described and the aspects of the CMMS implementation are discussed as they are related to the certification objectives.

  17. 76 FR 41824 - NASA Advisory Council; Science Committee; Meeting

    2011-07-15

    ... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice: (11-068)] NASA Advisory Council; Science... Aeronautics and Space Administration (NASA) announces a meeting of the Science Committee of the NASA Advisory..., 2011, 7:30 a.m. to 11:30 a.m., Local Time. ADDRESSES: NASA Ames Research Center, NASA Ames Conference...

  18. 77 FR 52067 - NASA Advisory Council; Commercial Space Committee; Meeting

    2012-08-28

    ... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [12-069] NASA Advisory Council; Commercial Space.... DATES: Tuesday, September 18, 2012, 11:45 a.m.-5:30 p.m.; Local Time. ADDRESSES: NASA Ames Research Center (ARC), The Showroom, Building M-3, NASA Ames Conference Center, 500 Severyns Road, NASA Research...

  19. The Decline of Air Assault Operations

    2016-05-26

    Anthology (Carlisle Barracks: US Army War College, 2000), 6-7. 94 Clausewitz, 198; Sun Tzu , The Art of Warfare, trans. Robert Ames (New York...Encyclopedia of World War II. Santa Barbara: ABC-CLIO, 2004. Tzu , Sun . The Art of Warfare. Trans. Robert Ames. New York: Ballentine Books, 1993. 55... Bibliography ...................................................................................................................................51 iv

  20. Role of Reconnaissance in the Counterattack.

    2016-05-26

    Bejing: Foreign Language Press, 1967), 107. Sun - Tzu , The Art of Warfare, translated by Robert Ames (New York: Ballantine Books, 1993), 113. 14 B.H...dhat: qissat hayati. Cairo, Egypt: al-Maktab al-Misri al-Hadith, 1985. Sun - Tzu . The Art of Warfare. Translated by Robert Ames. New York: Ballantine...39 Bibliography

  1. Research and Technology 1997

    1998-01-01

    This report highlights the challenging work accomplished during fiscal year 1997 by Ames research scientists and engineers. The work is divided into accomplishments that support the goals of NASA s four Strategic Enterprises: Aeronautics and Space Transportation Technology, Space Science, Human Exploration and Development of Space (HEDS), and Earth Science. NASA Ames Research Center s research effort in the Space, Earth, and HEDS Enterprises is focused i n large part to support Ames lead role for Astrobiology, which broadly defined is the scientific study of the origin, distribution, and future of life in the universe. This NASA initiative in Astrobiology is a broad science effort embracing basic research, technology development, and flight missions. Ames contributions to the Space Science Enterprise are focused in the areas of exobiology, planetary systems, astrophysics, and space technology. Ames supports the Earth Science Enterprise by conducting research and by developing technology with the objective of expanding our knowledge of the Earth s atmosphere and ecosystems. Finallv, Ames supports the HEDS Enterprise by conducting research, managing spaceflight projects, and developing technologies. A key objective is to understand the phenomena surrounding the effects of gravity on living things. Ames has also heen designated the Agency s Center of Evcellence for Information Technnlogv. The three cornerstones of Information Technology research at Ames are automated reasoning, human-centered computing, and high performance computing and networking.

  2. Translation on Its Own Terms? Toward Education for Global Culture

    Saito, Naoko

    2017-01-01

    Roger Ames' keynote provides a powerful orientation for thinking about translation. Against the background of his outstanding research career as a mediator between East and West, he offers a clear vision of global cultivation through what he calls "cultural translation." Encouraging and insightful as Ames' account of translation is, and…

  3. On Teacher Hope, Sense of Calling, and Commitment to Teaching

    Bullough, Robert V., Jr; Hall-Kenyon, Kendra M.

    2012-01-01

    Teacher motivation long has been a topic of interest to researchers (Ames & Ames, 1984; Sylvia & Hutchison, 1985). It is widely recognized that the motivations residing behind teachers' actions profoundly shape the nature and quality of those actions and their effects on young people. Surprisingly, while often recognized especially by…

  4. Optimum O2:CH4 Ratio Promotes the Synergy between Aerobic Methanotrophs and Denitrifiers to Enhance Nitrogen Removal

    Jing Zhu

    2017-06-01

    Full Text Available The O2:CH4 ratio significantly effects nitrogen removal in mixed cultures where aerobic methane oxidation is coupled with denitrification (AME-D. The goal of this study was to investigate nitrogen removal of the AME-D process at four different O2:CH4 ratios [0, 0.05, 0.25, and 1 (v/v]. In batch tests, the highest denitrifying activity was observed when the O2:CH4 ratio was 0.25. At this ratio, the methanotrophs produced sufficient carbon sources for denitrifiers and the oxygen level did not inhibit nitrite removal. The results indicated that the synergy between methanotrophs and denitrifiers was significantly improved, thereby achieving a greater capacity of nitrogen removal. Based on thermodynamic and chemical analyses, methanol, butyrate, and formaldehyde could be the main trophic links of AME-D process in our study. Our research provides valuable information for improving the practical application of the AME-D systems.

  5. 24 CFR 902.5 - Applicability.

    2010-04-01

    ... HOUSING ASSESSMENT SYSTEM General Provisions § 902.5 Applicability. (a) PHAs, RMCs, AMEs.(1) Scoring of... PHAS scores. The performance of the AME contributes to the PHAS score of the PHA or PHAs for which they... (Financial), #3 (Management Operations), and #4 (Resident Service and Satisfaction). The PHA must comply with...

  6. Combined alcohol and energy drink use: hedonistic motives, adenosine, and alcohol dependence.

    Marczinski, Cecile A

    2014-07-01

    Consumption of alcohol mixed with energy drinks (AmED) has been associated with both short- and long-term risks beyond those observed with alcohol alone. AmED use has been associated with heavy episodic (binge) drinking, risky behaviors, and risk of alcohol dependence. Laboratory research has demonstrated that AmED beverages lead to greater motivation to drink versus the same amount of alcohol consumed alone. However, the reason consumers find AmED beverages particularly appealing has been unclear. A recent report by Droste and colleagues (Alcohol Clin Exp Res 2014; 38:2087-2095) is the first study to investigate motivations related to AmED consumption and to determine which motives predict AmED consumption patterns, experience of drinking-related harms, and risk of alcohol dependence. The findings of this study significantly enhance our understanding of why AmED consumption is related to the risk of alcohol dependence and change our understanding of why consumers choose AmED beverages. The authors report that hedonistic motives strongly predicted AmED use and the harms associated with use. While intoxication-reduction motives predicted self-reported accidents and injuries, these motives did not predict AmED consumption patterns and risk of dependence. The risk of alcohol dependence may arise from repeated experiences when drinking alcohol is more pleasurable when energy drinks are consumed with the alcohol. This commentary will focus on why energy drinks might increase the rewarding properties of alcohol in social drinkers. In addition, discussion is provided explaining why more research on the neurotransmitter, adenosine, may actually inform us about the mechanisms contributing to the development of alcohol dependence. Copyright © 2014 by the Research Society on Alcoholism.

  7. Combined Alcohol and Energy Drink Use: Hedonistic Motives, Adenosine, and Alcohol Dependence

    Marczinski, Cecile A.

    2014-01-01

    Consumption of alcohol mixed with energy drinks (AmED) has been associated with both short and long-term risks beyond those observed with alcohol alone. AmED use has been associated with heavy episodic (binge) drinking, risky behaviors, and risk of alcohol dependence. Laboratory research has demonstrated that AmED beverages lead to greater motivation to drink versus the same amount of alcohol consumed alone. However, the reason consumers find AmED beverages particularly appealing has been unclear. A recent report by Droste and colleagues (2014) is the first study to investigate motivations related to AmED consumption and to determine which motives predict AmED consumption patterns, experience of drinking-related harms, and risk of alcohol dependence. The findings of this study significantly enhance our understanding of why AmED consumption is related to the risk of alcohol dependence and change our understanding of why consumers chose AmED beverages. The authors report that hedonistic motives strongly predicted AmED use and the harms associated with use. While intoxication-reduction motives predicted self-reported accidents and injuries, these motives did not predict AmED consumption patterns and risk of dependence. The risk of alcohol dependence may arise from repeated experiences when drinking alcohol is more pleasurable when energy drinks are consumed with the alcohol. This commentary will focus on why energy drinks might increase the rewarding properties of alcohol in social drinkers. In addition, discussion is provided explaining why more research on the neurotransmitter, adenosine, may actually inform us about the mechanisms contributing to the development of alcohol dependence. PMID:25040590

  8. Alcohol mixed with energy drink use among u.s. 12th-grade students: prevalence, correlates, and associations with unsafe driving.

    Martz, Meghan E; Patrick, Megan E; Schulenberg, John E

    2015-05-01

    The consumption of alcohol mixed with energy drinks (AmED) is a risky drinking behavior, most commonly studied using college samples. We know little about rates of AmED use and its associations with other risk behaviors, including unsafe driving, among high school students. This study examined the prevalence and correlates of AmED use among high school seniors in the United States. Nationally representative analytic samples included 6,498 12th-grade students who completed Monitoring the Future surveys in 2012 and 2013. Focal measures included AmED use, sociodemographic characteristics, academic and social factors, other substance use, and unsafe driving (i.e., tickets/warnings and accidents) after alcohol consumption. Approximately one in four students (24.8%) reported AmED use during the past 12 months. Rates of AmED use were highest among males and white students. Using multivariable logistic regression models controlling for sociodemographic characteristics, results indicate that students who cut class, spent more evenings out for fun and recreation, and reported binge drinking, marijuana use, and illicit drug use had a greater likelihood of AmED use. AmED use was also associated with greater odds of alcohol-related unsafe driving, even after controlling for sociodemographic, academic, and social factors and other substance use. AmED use among 12th-grade students is common and associated with certain sociodemographic, academic, social, and substance use factors. AmED use is also related to alcohol-related unsafe driving, which is a serious public health concern. Copyright © 2015 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

  9. An analytical model and parametric study of electrical contact resistance in proton exchange membrane fuel cells

    Wu, Zhiliang; Wang, Shuxin; Zhang, Lianhong [School of Mechanical Engineering, Tianjin University, Tianjin 300072 (China); Hu, S. Jack [Department of Mechanical Engineering, The University of Michigan, Ann Arbor, MI 48109-2125 (United States)

    2009-04-15

    This paper presents an analytical model of the electrical contact resistance between the carbon paper gas diffusion layers (GDLs) and the graphite bipolar plates (BPPs) in a proton exchange membrane (PEM) fuel cell. The model is developed based on the classical statistical contact theory for a PEM fuel cell, using the same probability distributions of the GDL structure and BPP surface profile as previously described in Wu et al. [Z. Wu, Y. Zhou, G. Lin, S. Wang, S.J. Hu, J. Power Sources 182 (2008) 265-269] and Zhou et al. [Y. Zhou, G. Lin, A.J. Shih, S.J. Hu, J. Power Sources 163 (2007) 777-783]. Results show that estimates of the contact resistance compare favorably with experimental data by Zhou et al. [Y. Zhou, G. Lin, A.J. Shih, S.J. Hu, J. Power Sources 163 (2007) 777-783]. Factors affecting the contact behavior are systematically studied using the analytical model, including the material properties of the two contact bodies and factors arising from the manufacturing processes. The transverse Young's modulus of chopped carbon fibers in the GDL and the surface profile of the BPP are found to be significant to the contact resistance. The factor study also sheds light on the manufacturing requirements of carbon fiber GDLs for a better contact performance in PEM fuel cells. (author)

  10. The Higgs and Supersymmetry at Run II of the LHC

    Shih, David [Rutgers Univ., Piscataway, NJ (United States)

    2016-04-14

    Prof. David Shih was supported by DOE grant DE-SC0013678 from April 2015 to April 2016. His research during this year focused on the phenomenology of super-symmetry (SUSY) and maximizing its future discovery potential at Run II of the LHC. SUSY is one of the most well-motivated frameworks for physics beyond the Standard Model. It solves the "naturalness" or "hierarchy" problem by stabilizing the Higgs mass against otherwise uncontrolled quantum corrections, predicts "grand unification" of the fundamental forces, and provides many potential candidates for dark matter. However, after decades of null results from direct and indirect searches, the viable parameter space for SUSY is increasingly constrained. Also, the discovery of a Standard Model-like Higgs with a mass at 125 GeV places a stringent constraint on SUSY models. In the work supported on this grant, Shih has worked on four different projects motivated by these issues. He has built natural SUSY models that explain the Higgs mass and provide viable dark matter; he has studied the parameter space of "gauge mediated supersymmetry breaking" (GMSB) that satisfies the Higgs mass constraint; he has developed new tools for the precision calculation of flavor and CP observables in general SUSY models; and he has studied new techniques for discovery of supersymmetric partners of the top quark.

  11. Comparison of the results of wide plate tests with the predictions of several fracture concepts

    Rosezin, H.J.; Dahl, W.

    1985-01-01

    With the results of wide plate tests on center cracked specimens the concept of the plastic limit load, the Burdekin-Dawes-design-concept, the J-design-curve according to Turner, the estimation proceeding according to Shih and Kumar, the Two-Criteria-Approach and the FAD according to Pellini were examined and the limits of their application exhibited. The maximum loads of wide plate specimens can be estimated by the plastic limit load, if no low-stress-fractures occur. Corresponding to the Pellini-concept no low-stress-fractures occured at test temperatures above NDT, if the NDT-temperature of the region of material was used, in which the crack was located. With the concept according to Shih and Kumar an estimation of the instability loads of wide plate specimens is possible, if the fracture behaviour is fully ductile, but not in all cases conservative predictions were made. A prediction of critical stresses and crack sizes is possible with the other concepts examined, if the evaluations are based on the critical values for the onset of stable or unstable crack growth. (orig.) [de

  12. The Higgs and Supersymmetry at Run II of the LHC

    Shih, David

    2016-01-01

    Prof. David Shih was supported by DOE grant DE-SC0013678 from April 2015 to April 2016. His research during this year focused on the phenomenology of super-symmetry (SUSY) and maximizing its future discovery potential at Run II of the LHC. SUSY is one of the most well-motivated frameworks for physics beyond the Standard Model. It solves the 'naturalness' or 'hierarchy' problem by stabilizing the Higgs mass against otherwise uncontrolled quantum corrections, predicts 'grand unification' of the fundamental forces, and provides many potential candidates for dark matter. However, after decades of null results from direct and indirect searches, the viable parameter space for SUSY is increasingly constrained. Also, the discovery of a Standard Model-like Higgs with a mass at 125 GeV places a stringent constraint on SUSY models. In the work supported on this grant, Shih has worked on four different projects motivated by these issues. He has built natural SUSY models that explain the Higgs mass and provide viable dark matter; he has studied the parameter space of 'gauge mediated supersymmetry breaking' (GMSB) that satisfies the Higgs mass constraint; he has developed new tools for the precision calculation of flavor and CP observables in general SUSY models; and he has studied new techniques for discovery of supersymmetric partners of the top quark.

  13. [Promoting Research Integrity].

    Suzuki, Hiromichi

    2018-01-01

     Japan Agency for Medical Research and Development (AMED) was launched in April 2015 to promote integrated medical research and development (R&D) ranging from basic research to practical applications, in order to smoothly achieve the nationwide application of research outcomes, and to establish an environment therefor. AMED consolidates budgets for R&D expenses, which had previously been allocated from different sources, such as the Ministry of Education, Culture, Sports, Science and Technology, the Ministry of Health, Labour and Welfare, and the Ministry of Economy, Trade and Industry. It provides funds strategically to universities, research institutions, etc. By promoting medical R&D, AMED aims to achieve the world's highest level of medical care/services to contribute to a society in which people live long and healthy lives. To achieve this mission, it is imperative that R&D funded by AMED is widely understood and supported. Maintaining and improving research integrity is a prerequisite to this end. AMED is taking various measures to ensure fair and appropriate R&D. It is asking researchers to participate in its responsible conduct in research (RCR) education program and to comply with its rules for managing conflicts of interest (COI). In addition, AMED also conducts a grant program to create and distribute a variety of educational materials on RCR and other matters. Further, AMED is establishing a platform that allows researchers to exchange information about research integrity, and it is undertaking additional measures, such as holding meetings and international symposia on research integrity.

  14. Energy Drinks Mixed with Alcohol: What are the Risks?

    Marczinski, Cecile A.; Fillmore, Mark T.

    2014-01-01

    Energy drinks are popular beverages that typically include high levels of caffeine and other ingredients such as taurine, or caffeine-containing herbs, such as guarana. While energy drinks are often consumed alone, they are also frequently used as mixers for alcoholic beverages. This review summarizes what is known about the scope of use of alcohol mixed with energy drinks (AmED), the risks associated with AmED, and the objective laboratory data examining how AmED differs from alcohol alone. The weight of the evidence reveals that AmED beverages are riskier than alcohol alone and constitute a public health concern. AmED beverage consumption is frequent, especially in young and underage drinkers. AmED use is associated with elevated rates of binge drinking, impaired driving, risky sexual behavior, and risk of alcohol dependence when compared with alcohol alone. Laboratory research (human and animal) has demonstrated that AmED beverages lead to altered subjective states including decreased perceived intoxication, enhanced stimulation, and increased desire to drink/increased drinking compared to alcohol alone. Possible underlying mechanisms explaining these observations are highlighted. PMID:25293549

  15. Ethanol Extract of Atractylodes macrocephala Protects Bone Loss by Inhibiting Osteoclast Differentiation

    Youn-Hwan Hwang

    2013-06-01

    Full Text Available The rhizome of Atractylodes macrocephala has been used mainly in Traditional Chinese Medicine for invigorating the functions of the stomach and spleen. In the present study, we investigated the inhibitory effect of the 70% ethanol extract of the rhizome of Atractylodes macrocephala (AMEE on osteoclast differentiation. We found that AMEE inhibits osteoclast differentiation from its precursors induced by receptor activator of nuclear factor-κB ligand (RANKL, an essential cytokine required for osteoclast differentiation. AMEE attenuated RANKL-induced activation of NF-κB signaling pathway, subsequently inhibiting the induction of osteoclastogenic transcription factors, c-Fos and nuclear factor of activated T cells cytoplasmic 1. Consistent with the in vitro results, administration of AMEE protected RANKL-induced bone loss in mice. We also identified atractylenolide I and II as active constituents contributing to the anti-osteoclastogenic effect of AMEE. Taken together, our results demonstrate that AMEE has a protective effect on bone loss via inhibiting osteoclast differentiation and suggest that AMEE may be useful in preventing and treating various bone diseases associated with excessive bone resorption.

  16. Effect of Bioactive Compound of Aronia melanocarpa on Cardiovascular System in Experimental Hypertension

    Martina Cebova

    2017-01-01

    Full Text Available Aronia melanocarpa has attracted scientific interest due to its dense contents of different polyphenols. We aimed to analyse effects of Aronia melanocarpa (AME extract on blood pressure (BP, lipid peroxidation, cytokine level, total NOS activity in the left ventricle (LV, and aorta of L-NAME-induced hypertensive rats. 12-week-old male WKY rats were assigned to the control group and groups treated with AME extract (57.90 mg/kg/day, L-NAME (40 mg/kg/day, or combination of L-NAME (40 mg/kg/day and AME (57.90 mg/kg/day in tap water for 3 weeks. NOS activity, eNOS protein expression, and conjugated diene (CD concentration were determined in the LV and aorta. After 3 weeks of L-NAME treatment, BP was increased by 28% and concomitant treatment with AME reduced it by 21%. NOS activity of the LV and aorta in the L-NAME group was decreased by about 40%, while AME increased it almost on the control level. AME-induced eNOS upregulation may contribute to increase NOS activity. Moreover, AME decreased CD concentration in the LV and aorta and TNF-α and IL-6 production in the plasma were increased by L-NAME treatment. In conclusion, our results showed that active substances of Aronia melanocarpa may have a positive effect on blood pressure, NOS activity, and proinflammatory processes in L-NAME-induced hypertension.

  17. Planck intermediate results. XV. A study of anomalous microwave emission in Galactic clouds

    Ade, P. A. R.; Aghanim, N.; Alves, Marie-Helene

    2014-01-01

    radiation field, G0. Modelling of this trend suggests that both radiative and collisional excitation are important for the spinning dust emission. The most significant AME regions tend to have relatively less ionized gas (free-free emission), although this could be a selection effect. The infrared excess......Anomalous microwave emission (AME) is believed to be due to electric dipole radiation from small spinning dust grains. The aim of this paper is a statistical study of the basic properties of AME regions and the environment in which they emit. We used WMAP and Planck maps, combined with ancillary...... for the AME regions. The AME regions tend to be associated with cooler dust in the range 14−20 K and an average emissivity index, βd, of +1.8, while the non-AME regions are typically warmer, at 20−27 K. In agreement with previous studies, the AME emissivity appears to decrease with increasing column density...

  18. Alcohol Mixed with Energy Drink Use as an Event-Level Predictor of Physical and Verbal Aggression in Bar Conflicts.

    Miller, Kathleen E; Quigley, Brian M; Eliseo-Arras, Rebecca K; Ball, Natalie J

    2016-01-01

    Young adult use of alcohol mixed with caffeinated energy drinks (AmEDs) has been globally linked with increased odds of interpersonal aggression, compared with the use of alcohol alone. However, no prior research has linked these behaviors at the event level in bar drinking situations. The present study assessed whether AmED use is associated with the perpetration of verbal and physical aggression in bar conflicts at the event level. In Fall 2014, a community sample of 175 young adult AmED users (55% female) completed a web survey describing a recent conflict experienced while drinking in a bar. Use of both AmED and non-AmED alcoholic drinks in the incident were assessed, allowing calculation of our main predictor variable, the proportion of AmEDs consumed (AmED/total drinks consumed). To measure perpetration of aggression, participants reported on the occurrence of 6 verbal and 6 physical acts during the bar conflict incident. Linear regression analyses showed that the proportion of AmEDs consumed predicted scores for perpetration of both verbal aggression (β = 0.16, p bar environments, and total number of drinks. Results of this study suggest that in alcohol-related bar conflicts, higher levels of young adult AmED use are associated with higher levels of aggression perpetration than alcohol use alone and that the elevated risk is not attributable to individual differences between AmED users and nonusers or to contextual differences in bar drinking settings. While future research is needed to identify motivations, dosages, and sequencing issues associated with AmED use, these beverages should be considered a potential risk factor in the escalation of aggressive bar conflicts. Copyright © 2016 by the Research Society on Alcoholism.

  19. Alcohol mixed with energy drinks: Associations with risky drinking and functioning in high school.

    Tucker, Joan S; Troxel, Wendy M; Ewing, Brett A; D'Amico, Elizabeth J

    2016-10-01

    Mixing alcohol with energy drinks is associated with heavier drinking and related problems among college students. However, little is known about how high school drinkers who mix alcohol with energy drinks (AmED) compare to those who do not (AwoED). This study compares high school AmED and AwoED users on their alcohol use during middle and high school, as well as key domains of functioning in high school. Two surveys were conducted three years apart in adolescents initially recruited from 16 middle schools in Southern California. The analytic sample consists of 696 past month drinkers. Multivariable models compared AmED and AwoED users on alcohol use, mental health, social functioning, academic orientation, delinquency and other substance use at age 17, and on their alcohol use and related cognitions at age 14. AmED was reported by 13% of past month drinkers. AmED and AwoED users did not differ on alcohol use or cognitions in middle school, but AmED users drank more often, more heavily, and reported more negative consequences in high school. AmED users were also more likely to report poor grades, delinquent behavior, substance use-related unsafe driving, public intoxication, and drug use than AwoED users in high school. Group differences were not found on mental health, social functioning, or academic aspirations. AmED use is common among high school drinkers. The higher risk behavioral profile of these young AmED users, which includes drug use and substance use-related unsafe driving, is a significant cause for concern and warrants further attention. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  20. Task Allocation for Single Pilot Operations: A Role for the Ground

    Johnson, Walter; Lachter, Joel; Feary, Mike; Comerford, Doreen; Battiste, Vernol; Mogford, Richard

    2012-01-01

    Researchers at NASA Ames Research Center and NASA Langley Research Center are jointly investigating issues associated with potential configurations for an environment in which a single pilot, or reduced crew, might operate. The research summarized in this document represents several of the efforts being put forth at NASA Ames Research Center. Specifically, researchers at NASA Ames Research Center coordinated and hosted a technical interchange meeting in order to gain insight from members of the aviation community. A description of this meeting and the findings are presented first. Thereafter, plans for ensuing research are presented.