WorldWideScience

Sample records for shi yong ji

  1. Individual Differences in Zhong-Yong tendency and Processing Capacity

    Ting-Yun eChang

    2014-11-01

    Full Text Available The present study investigated how an individual’s Zhong-Yong tendency is related to his/her perceptual processing capacity. In two experiments, participants completed a Zhong-Yong Thinking Style Scale and performed a redundant-target detection task. Processing capacity was assessed with a nonparametric approach (systems factorial technology, SFT and a parametric (linear ballistic accumulator model, LBA approach. Results converged to suggest a positive correlation between Zhong-Yong tendency and processing capacity. High middle-way thinkers had larger processing capacity in multiple-signal processing compared with low middle-way thinkers, indicating that they processed information more efficiently and in an integrated fashion. Zhong-Yong tendency positively correlates with the processing capacity. These findings suggest that the individual differences in processing capacity can account for the reasons why high middle-way thinkers tend to adopt a global and flexible processing strategy to deal with the external world. Furthermore, the influence of culturally dictated thinking style on cognition can be revealed in a perception task.

  2. Zhong-Yong as Dynamic Balancing Between Yin-Yang Opposites

    Li, Xin

    2018-01-01

    of Zhong-Yong balancing being incorrect and incomplete, the author proposes an alternative perspective on Zhong-Yong as dynamic balancing between Yin-Yang opposites. Design/methodology/approach: The author first explain why Peter P. Li’s “asymmetry” and “superiority” arguments are flawed by referring...... to the original text of the classical book of Zhong-Yong (中庸) and a comparison between Zhong-Yong and Aristotle’s doctrine of the mean. The author then propose an alternative approach to Zhong-Yong balancing that is embedded in the original text Zhong-Yong but somehow has been neglected by many Chinese scholars...

  3. Women stereotypes in Shi Zhecun's short stories.

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  4. Dr. Shi Hanzhang's Experience in Treating Andropathy

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  5. How to Integrate Tai Ji Quan into Physical Education Programs

    Lu, Chunlei

    2008-01-01

    Tai ji quan, also known as "tai chi," is an ancient Chinese exercise characterized by soft, slow, and meditative movements. It consists of a set of continuous, evenly paced, carefully choreographed, but natural, body shifts. "Tai ji" is an ancient Chinese philosophy, while "tai ji quan" refers to a type of physical activity based on tai ji…

  6. Technology Education and Technology Teacher Education in Taiwan, R.O.C. = Zhong Hua Min Guo Ke Ji Jiao Yu Ji qi shi zi Jiao Yu.

    Lee, Lung-Sheng Steven; Wang, Cheng-Pin Peter; Wang, Yen-chao; Shih, Neng-Mu; Yeh, Chung-ching

    Technology education in Taiwan begins with craft work at the elementary school level, and the most important point is the practical application. All junior high school students are required to take the Living Technology course. Content includes technology and life, information and communication, construction and manufacturing, and energy and…

  7. Developed feedback from the Swedish CDM and JI program; Utvecklad aaterrapportering fraan det svenska CDM- och JI-programmet

    NONE

    2012-11-01

    The Swedish Energy Agency is responsible for the Swedish government program for the Clean Development Mechanism (CDM) and Joint Implementation (JI). CDM and JI is the Kyoto Protocol's two project-based flexible mechanisms. This program focuses on participation in individual CDM- and JI-projects and on participation in multilateral CDM- and JI- funds. In the report the Swedish Energy Agency, on behalf of the Government, presents a proposal for developed reporting for the CDM- and JI-program. Furthermore, issues related to how CDM and JI can assist in meeting the Swedish climate objective by 2020 are discussed. Also, the role for potential new flexible mechanisms under UN Climate Convention is mentioned.

  8. CDM and JI in View of the Sustainability Debate

    Schoot Uiterkamp, A.J.M.

    2001-01-01

    Clean Development Mechanism (CDM), Joint Implementation (JI) and emissions trading are the three flexible instruments incorporated in the Kyoto Protocol. This paper presents a critical assessment of the sustainability of energy-related technology innovation and transfer in the context of CDM and JI.

  9. Zhong-Yong as Dynamic Balancing Between Yin-Yang Opposites

    Li, Xin

    2017-01-01

    Purpose The purpose of this paper is to comment on Peter Ping Li’s understanding of Zhong-Yong balancing, presented in his article titled “Global implications of the indigenous epistemological system from the East: How to apply Yin-Yang balancing to paradox management.” Seeing his understanding....... Originality/value This commentary contributes to the “West meets East” discourse by debunking Peter P. Li’s assertion that Yin-Yang balancing is superior as a solution to paradox management and his prescription that balancing between Yin-Yang opposites must be asymmetric. It also contributes to the Chinese...

  10. Civil Engineering for the SHiP facility

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  11. Radiation protection studies for the SHiP facility

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  12. Dicty_cDB: SHI251 [Dicty_cDB

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  13. Dicty_cDB: SHI867 [Dicty_cDB

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  14. Dicty_cDB: SHI777 [Dicty_cDB

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  15. Dark matter at the SHiP experiment

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  16. Workshop Arboretum Volčji potok

    Ana Kučan

    2012-01-01

    Full Text Available From its constitution onwards, the Volčji Potok Arboretum has been caught between various conflicting orientations. It is both a scientific, research and educational institution, and a cultural monument with exquisite garden and landscape design features and areas of great natural value and built cultural heritage, as well as commercial venue. At the same time, it functions as a park and an area for mass events, a garden centre and nursery. This variety of functions has helped Arboretum to survive the pressures of time; however, partial and uncoordinated interventions have threatened its original mission and its image and generated a number of conflicting situations. The workshop, organised on the initiative of the Institute for the Protection of Cultural Heritage of Slovenia, which involved students from the Faculty of Architecture and students from the Department of Landscape Architecture of the Biotechnical Faculty in mixed groups, generated eight proposals to solve some of the most urgent problems by introducing optimised development with clearly defined goals and priorities.

  17. CDM and JI in View of the Sustainability Debate

    Schoot Uiterkamp, A.J.M.

    2001-01-01

    Clean Development Mechanism (CDM), Joint Implementation (JI) and emissions trading are the three flexible instruments incorporated in the Kyoto Protocol. This paper presents a critical assessment of the sustainability of energy-related technology innovation and transfer in the context of CDM and JI. The rebound effect is discussed by comparing intended and unintended project and process outcomes. Attention is given to the role of nations and key actors like multinationals in achieving sustain...

  18. Valores, Creencias Y Objectivos: Base del programa de la Escuela Experimental P.K. Yonge. (Values, Beliefs and Objectives: The Basis of Experimental Schools P.K. Yonge's Program.)

    Florida Univ., Gainesville. Coll. of Education.

    The values, beliefs, and objectives that form the core of the program at the Experimental School P.K. Yonge in the University of Florida are presented in this paper which is written in Spanish. This experimental school serves approximately 900 students from grades one through twelve. The function of the school is to conduct research to solve…

  19. Transforming traditional Tai Ji Quan techniques into integrative movement therapy-Tai Ji Quan: Moving for Better Balance.

    Li, Fuzhong

    2014-03-01

    Tai Ji Quan, developed as a martial art, has traditionally served multiple purposes, including self-defense, competition/performance, and health promotion. With respect to health, the benefits historically and anecdotally associated with Tai Ji Quan are now being supported by scientific and clinical research, with mounting evidence indicating its potential value in preventing and managing various diseases and improving well-being and quality of life in middle-aged and older adults. The research findings produced to date have both public health significance and clinical relevance. However, because of its roots in the martial arts, transforming traditional Tai Ji Quan movements and training approaches into contemporary therapeutic programs and functional applications is needed to maximize its ultimate utility. This paper addresses this issue by introducing Tai Ji Quan: Moving for Better Balance , a functional therapy that involves the use of Tai Ji Quan principles and Yang-style-based movements to form an innovative, contemporary therapeutic approach that integrates motor, sensory, and cognitive components to improve postural control, gait, and mobility for older adults and those who have neurodegenerative movement impairments. It provides a synergy of traditional and contemporary Tai Ji Quan practice with the ultimate goal of improving balance and gait, enhancing performance of daily functional tasks, and reducing incidence of falls among older adults.

  20. Transforming traditional Tai Ji Quan techniques into integrative movement therapy—Tai Ji Quan: Moving for Better Balance

    Fuzhong Li

    2014-03-01

    Full Text Available Tai Ji Quan, developed as a martial art, has traditionally served multiple purposes, including self-defense, competition/performance, and health promotion. With respect to health, the benefits historically and anecdotally associated with Tai Ji Quan are now being supported by scientific and clinical research, with mounting evidence indicating its potential value in preventing and managing various diseases and improving well-being and quality of life in middle-aged and older adults. The research findings produced to date have both public health significance and clinical relevance. However, because of its roots in the martial arts, transforming traditional Tai Ji Quan movements and training approaches into contemporary therapeutic programs and functional applications is needed to maximize its ultimate utility. This paper addresses this issue by introducing Tai Ji Quan: Moving for Better Balance, a functional therapy that involves the use of Tai Ji Quan principles and Yang-style-based movements to form an innovative, contemporary therapeutic approach that integrates motor, sensory, and cognitive components to improve postural control, gait, and mobility for older adults and those who have neurodegenerative movement impairments. It provides a synergy of traditional and contemporary Tai Ji Quan practice with the ultimate goal of improving balance and gait, enhancing performance of daily functional tasks, and reducing incidence of falls among older adults.

  1. Long-term prospects of CDM and JI; Langfristige Perspektiven von CDM und JI

    Cames, Martin; Anger, Niels; Boehringer, Christoph; Harthan, Ralph O.; Schneider, Lambert [Oeko-Institut, Berlin (Germany)

    2007-07-15

    This study analyses whether Germany should use the flexible mechanisms under the Kyoto protocol or whether it should continue to achieve its greenhouse gas reduction targets by dint of domestic policies and measures. It estimates the future potential of the project-based Kyoto mechanisms (CDM and JI) and the impacts of its use on the German and the global economy, using an integrated-assessment model. In a Delphi survey, the expectations of international experts on the future prospects of the project-based Kyoto mechanisms are assessed. The study finishes with an analysis of options for promoting the use of the flexible mechanisms in Germany and concludes that the Federal Government of Germany should establish a project-based mechanisms fund of 25 to 50 million Kyoto units to cover the compliance uncertainties due to unexpected temperature or business cycle variations. (orig.) [German] Diese Studie untersucht, ob Deutschland die flexiblen Mechanismen unter dem Kyoto-Protokoll nutzen sollte oder weiterhin seine Treibhausgasreduktionsziele durch inlaendische Politiken und Massnahmen erreichen sollte. Das kuenftige Potenzial der projektbezogenen Kyoto-Mechanismen (CDM und JI) wird untersucht und die Auswirkungen von deren Nutzung auf die deutsche und globale Wirtschaft werden mit einem Integrated-Assessment-Modell abgeschaetzt. In einer Delphi-Befragung werden die Erwartungen internationaler Experten in Hinblick auf die kuenftigen Perspektiven der projektbezogenen Kyoto- Mechanismen ermittelt. Abschliessend werden Moeglichkeiten zur Foerderung der Nutzung der flexiblen Mechanismen in Deutschland analysiert, mit der Schlussfolgerung, dass die Bundesregierung einen 25 bis 50 Millionen Kyoto-Einheiten umfassenden Fonds fuer projektbezogene Mechanismen einrichten sollte, um die Unsicherheiten bei der Erfuellung des Kyoto-Ziels infolge unerwarteter Temperaturschwankungen oder einer Aenderung der Konjunkturentwicklung abzudecken. (orig.)

  2. Tai Ji Quan, the brain, and cognition in older adults

    Yu-Kai Chang

    2014-03-01

    Full Text Available The relationship between physical activity (PA and cognition has received much attention recently. While evidence of improved cognition following PA has consistently been observed, the majority of studies have spotlighted aerobic exercise and the effects of other modes of PA, such as Tai Ji Quan, on cognition have received limited attention. This article provides a brief review of the literature concerning the influence of Tai Ji Quan on cognition in older adults, including those with intact cognition and those with cognitive impairment. In addition, this review proposes potential mechanisms (cardiovascular fitness, motor fitness, movement coordination, social interaction, and meditation statuses as well brain structure and function evaluated from a neuroimaging perspective that may explain the Tai Ji Quan–cognition relationship. Finally, we present suggestions for future research. In conclusion, Tai Ji Quan, with its multi-faceted characteristics, shows promise as a mode of PA for enhancing cognition, as well as brain health, in older adults. Based on the findings in this review, further exploration of the effects of Tai Ji Quan on cognition in older adults is warranted.

  3. The SHiP physics program

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  4. Why investors shy away from coal

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  5. The SHiP project at CERN

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  6. The SHiP experiment at CERN

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  7. Kandelia obovata (S., L.) Yong tolerance mechanisms to Cadmium: Subcellular distribution, chemical forms and thiol pools

    Weng Bosen; Xie Xiangyu; Weiss, Dominik J.; Liu Jingchun; Lu Haoliang; Yan Chongling

    2012-01-01

    Highlights: ► Cadmium tolerance mechanisms of Kandelia obovata was investigated systematacially. ► Thiol pool can play roles in cadmium detoxification mechanisms. ► Increasing cadmium treatment strength caused proportional increase of cadmium uptake. ► More than half of cadmium was localized in cell walls, and lowest in membranes. ► Sodium chloride and acetic acid extractable fractions were dominant. - Abstract: In order to explore the detoxification mechanisms adopted by mangrove under cadmium (Cd) stress, we investigated the subcellular distribution and chemical forms of Cd, in addition to the change of the thiol pools in Kandelia obovata (S., L.) Yong, which were cultivated in sandy culture medium treated with sequential Cd solution. We found that Cd addition caused a proportional increase of Cd in the organs of K. obovata. The investigation of subcellular distribution verified that most of the Cd was localized in the cell wall, and the lowest was in the membrane. Results showed sodium chloride and acetic acid extractable Cd fractions were dominant. The contents of non-protein thiol compounds, Glutathione and phytochelatins in K. obovata were enhanced by the increasing strength of Cd treatment. Therefore, K. obovata can be defined as Cd tolerant plant, which base on cell wall compartmentalization, as well as protein and organic acids combination.

  8. Annual Report 2011 for the Swedish CDM and JI program; Aarsredovisning 2011 foer Sveriges CDM och JI-program

    NONE

    2012-11-01

    The report is an annual report of the Swedish CDM [Clean Development Mechanism] and JI [Joint Implementation]program for 2011. The report shows aims and goals of the business and the work of individual CDM and JI projects and multilateral funds which have been performed over the entire duration of life and especially during 2011. The report presents volume orders, deliveries of emission reduction units as well as the volumes expected to be needed for the fulfillment of the national target by 2020. The report also includes information about the average price for the emission reductions as well as alternative costs.

  9. Kim Wŏn-haeng’s Intellectual Influences on Hong Tae-yong: The Case of Relations between

    Login Lok-yin Law

    2015-08-01

    Full Text Available In the 18th century Chosŏn (1392-1910, some scholars, such as Hong Tae-yong (1731-1783 advocated that Chosŏn should learn the advantages of the Qing (1644-1912 society to reform the social structure and government of Chosŏn. The school of these advocates has been known as Pukhak by historians. The intellectual factors of the school of Pukhak’s formation and development have been overlooked by the academia of Chosŏn intellectual history. In fact, Pukhak was closely related to the idea of the school of Nakhak which believed that nature of things was equivalent to humans. Kim Wŏn-haeng, was one of the supporters of Nakhak and Hong Tae-yong was one of the students of Kim. Hong’s thought and writing exposed that his thought was profoundly influenced by Kim Wŏn-haeng. Hong was deemed to be the first prominent scholar of the Pukhak School during the 18th century Chosŏn. Hong and other scholars of Pukhak advocated learning the new knowledge from Qing China even though it was a barbarian society. Therefore, this paper will investigate the intellectual relationships between Hong Tae-yong and Kim Wŏn-haeng to reveal how intellectuals of Nakhak shaped the formation of Pukhak School and exposed the idea of learning from Qing China.

  10. [Effects of long-term Tai Ji Quan exercise on automatic nervous modulation in the elderly].

    Guo, Feng

    2015-03-01

    To examine the effects of long-term Tai Ji Quan (Chinnese Traditional Exercise) on automatic nervous modulation in the elders. The 18 subjects from Tai Ji Quan exercise class in Liaoning University of Retired Veteran Cadres were assigned into long-term Tai Ji Quan exercise group including 10 subjects and novice group including 8 subjects. Electrocardiography, respiratory and blood pressure data were collected on the following time points: at rest before Tai Ji Qhuan exercise and 30 min or 60 min after Tai Ji Quan exercise. The subjects at rest state in the long-term Tai Ji Quan exercise group showed higher than the subjects in the novice group in resperitory rate (RR), standard deviations of normal to normal intervals (SDNN), total power (TP), low frequency power (LFP), high frequency power (HFP), normalized high frequency power (nHFP), but lower in LFP/HFP, systolic and diastolic blood pressure, and heart rate. At rest state the respiratory rate of subjects in long-term Tai Ji Quan exercise group was significantly lower than the novices. After Tai Ji Quan exercise, TP, nHFP, LFP/HFP, heart rate and systolic pressure showed significantly changes, and the change level of Tai Ji Quan on these indices was larger in Tai Ji Quan exercise group than that in the novice group. Long-term Tai Ji Quan exercise can improve vagal modulations, and tend to reduce the sympathetic modulations.

  11. An Inquiry of Intentions in Kim Hye-yong's 'First Meeting': A North Korean Short Story in Korea Today (2007).

    Alzo David-West

    2013-01-01

    This paper examines the problem of the intentional fallacy in the North Korean short story 'First Meeting' by Kim Hye-yong. Serially published in Korea Today in 2007, the nationalist allegory centres on Shin Ch'ong-mi, a young female journalist in Pyongyang, who falls in love with her penfriend Song-u, a soldier in the Korean People's Army, and struggles to remain devoted to him when he suddenly stops writing. With the literary-critical method of counterintuitive reading, the inquiry analyses...

  12. Brothers or Rivals? Iran and the Shi'a of Iraq

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  13. Extraction and beam transfer for the SHiP facility

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  14. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  15. A SHiP to explore new routes

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  16. An Inquiry of Intentions in Kim Hye-yong's 'First Meeting': A North Korean Short Story in Korea Today (2007.

    Alzo David-West

    2013-11-01

    Full Text Available This paper examines the problem of the intentional fallacy in the North Korean short story 'First Meeting' by Kim Hye-yong. Serially published in Korea Today in 2007, the nationalist allegory centres on Shin Ch'ong-mi, a young female journalist in Pyongyang, who falls in love with her penfriend Song-u, a soldier in the Korean People's Army, and struggles to remain devoted to him when he suddenly stops writing. With the literary-critical method of counterintuitive reading, the inquiry analyses the structural relations of the narrative, its discourse on desire, its apparent intentions, and its contravening elements, revealing an incidental unstable narrative that is symbolically protesting of the moral of the story to affectionately embrace the political authority of the North Korean party-army regime in the military-first (songun era.

  17. Art as a Political Act: Expression of Cultural Identity, Self-Identity, and Gender by Suk Nam Yun and Yong Soon Min

    Caruso, Hwa Young Choi

    2005-01-01

    This cross-cultural study explored the lives of two contemporary Korean/Korean American women artists--Suk Nam Yun and Yong Soon Min--who live in Seoul, South Korea, and Los Angeles, California. The author's research focused on the artists' identity formation, artistic expression, professional achievements, and the role of art as a political act.…

  18. Implementing the Kyoto protocol : why JI and CDM show more promise than international emissions trading

    Woerdman, E.

    The Kyoto protocol allows developed countries to achieve cost-effective greenhouse gas emission reductions abroad by means of international emissions trading (IET), joint implementation (JI) and the clean development mechanism (CDM). The article argues that JI and CDM projects will be more

  19. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  20. $\\mu$-flux measurements for SHiP using NA61/SHINE

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  1. Calibrating the SHiP muon-flux using NA61/SHINE

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  2. SHI induced irradiation effect on Mo/Si interface

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  3. Multifactor Regulation of the MdtJI Polyamine Transporter in Shigella.

    Adriano Leuzzi

    Full Text Available The polyamine profile of Shigella, the etiological agent of bacillary dysentery in humans, differs markedly from that of E. coli, its innocuous commensal ancestor. Pathoadaptive mutations such as the loss of cadaverine and the increase of spermidine favour the full expression of the virulent phenotype of Shigella. Spermidine levels affect the expression of the MdtJI complex, a recently identified efflux pump belonging to the small multi-drug resistance family of transporters. In the present study, we have addressed the regulation of the mdtJI operon in Shigella by asking which factors influence its expression as compared to E. coli. In particular, after identifying the mdtJI promoter by primer extension analysis, in vivo transcription assays and gel-retardation experiments were carried out to get insight on the silencing of mdtJI in E. coli. The results indicate that H-NS, a major nucleoid protein, plays a key role in repressing the mdtJI operon by direct binding to the regulatory region. In the Shigella background mdtJI expression is increased by the high levels of spermidine typically found in this microorganism and by VirF, the plasmid-encoded regulator of the Shigella virulence regulatory cascade. We also show that the expression of mdtJI is stimulated by bile components. Functional analyses reveal that MdtJI is able to promote the excretion of putrescine, the spermidine precursor. This leads us to consider the MdtJI complex as a possible safety valve allowing Shigella to maintain spermidine to a level optimally suited to survival within infected macrophages and, at the same time, prevent toxicity due to spermidine over-accumulation.

  4. Search for New Physics in SHiP and at future colliders

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  5. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  6. Interaction and conflict between Sufism and Shi`ism during Safavid era

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  7. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  8. LBA-ECO CD-06 Physical, Political, and Hydrologic Maps, Ji-Parana River Basin, Brazil

    National Aeronautics and Space Administration — This data set contains physical, hydrologic, political, demographic, and societal maps for the Ji-Parana River Basin, in the state of Rondonia, Brazil. These data...

  9. LBA-ECO CD-06 Physical, Political, and Hydrologic Maps, Ji-Parana River Basin, Brazil

    National Aeronautics and Space Administration — ABSTRACT: This data set contains physical, hydrologic, political, demographic, and societal maps for the Ji-Parana River Basin, in the state of Rondonia, Brazil....

  10. Search for hidden particles with the SHiP experiment

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  11. Pharmacokinetics, tissue distribution and identification of putative metabolites of JI-101 - a novel triple kinase inhibitor in rats.

    Gurav, S D; Gilibili, R R; Jeniffer, S; Mohd, Z; Giri, S; Govindarajan, R; Srinivas, N R; Mullangi, R

    2012-01-01

    JI-101, chemically 1-[1-(2-amino-pyridin-4-ylmethyl)-1H-indol-4-yl]-3-(5-bromo-2-methoxy-phenyl)-urea hydrochloride, is a novel orally active kinase inhibitor, which has shown potent in vitro and in vivo anticancer activity against a variety of cancer cell lines and xenografts. It is currently entering Phase II clinical development for the treatment of solid tumors. The aim of the study is to assess the metabolic stability of JI-101 in various pre-clinical and human liver microsomes, to identify the major CYPs (cytochrome β450) involved in the metabolism of JI-101 and identification of putative metabolites. We have also studied the pharmacokinetics, tissue distribution and excretion of JI-101 in Sprague Dawley rats. JI-101 was found to be stable in various liver microsomes tested. JI-101 is highly permeable and not a substrate for P-gp (permeability glycoprotein). JI-101 excreted through bile along with its mono- and di-hydroxy metabolites. Following oral administration, JI-101 was rapidly absorbed, reaching Cmax within 2 h. The t½ of JI-101 with intravenous and oral route was found to be 1.75 ± 0.79 and 2.66 ± 0.13 h, respectively. The Cl and Vd by intravenous route for JI-101 were found to be 13.0 ± 2.62 mL/min/kg and 2.11 ± 1.42 L/kg, respectively. The tissue distribution of JI-101 was extensive with rapid and preferred uptake into lung tissue. Overall, the oral bioavailability of JI-101 is 55% and the primary route of elimination for JI-101 is feces. © Georg Thieme Verlag KG Stuttgart · New York.

  12. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  13. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  14. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei

    2014-05-01

    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.

  15. Tai Ji Quan: An overview of its history, health benefits, and cultural value

    Yucheng Guo

    2014-03-01

    Full Text Available Tai Ji Quan is considered to be a part of traditional Chinese Wushu (a martial art and comprises various styles that have evolved historically from the Chen, Yang, Wǔ, Wú, and Sun families (schools. Recent simplification of the original classic styles has made Tai Ji Quan easier to adopt in practice. Thus, the traditional legacy of using Tai Ji Quan for self-defense, mindful nurturing of well-being, and fitness enhancement has been expanded to more contemporary applications that focus on promoting physical and mental health, enhancing general well-being, preventing chronic diseases, and being an effective clinical intervention for diverse medical conditions. As the impact of Tai Ji Quan on physical performance and health continues to grow, there is a need to better understand its historical impact and current status. This paper provides an overview of the evolution of Tai Ji Quan in China, its functional utility, and the scientific evidence of its health benefits, as well as how it has been a vehicle for enhancing cultural understanding and exchanging between East and West.

  16. Jičín - město pohádky a cestovní ruch

    Šarbortová, Kateřina

    2011-01-01

    The bachelor's thesis deals with Jičín and festival Jičín - the town of fairytale. First chapter characterizes the importance of tourism, types of tourism, its destination and marketing in tourism. The following part deals with Královéhradecký region, the town of Jičín and its tourist attractions. The next chapter describes festival Jičín - the town of fairytale. The last chapter analyses the influence of the festival on tourism of the town and its surroundings.

  17. Muon-flux measurements for SHiP at H4

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  18. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  19. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  20. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  1. Neutrino scattering physics with the SHiP Experiment

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  2. The SHiP experiment at CERN SPS

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  3. Neutrino scattering physics with the SHiP Experiment

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  4. Neutrino physics with the SHiP experiment

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  5. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  6. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  7. Poster - Thurs Eve-16: Just-in-time tomography (JiTT).

    Pang, G; Rowlands, J A

    2008-07-01

    Soft-tissue target motion is one of the main concerns in high-precision radiation therapy. Cone beam computed tomography (CBCT) has been developed recently to image soft-tissue targets in the treatment room for image-guided radiation therapy. However, due to its relatively long image acquisition time the CBCT approach cannot provide images of the target at the instant of the treatment and thus is not adequate for imaging targets with intrafraction motion. In this work, a new concept for image-guided radiation therapy- just-in-time tomography (JiTT) - is introduced. Differing from CBCT, JiTT takes much less time to generate the needed tomographical, beam's-eye-view images of the treatment target at the right moment to guide the radiation therapy treatment. A system to achieve JiTT is proposed and its feasibility is investigated. Research supported by Siemens. © 2008 American Association of Physicists in Medicine.

  8. Jiří Wolker, osobnost a dílo

    Rufertová, Kamila

    2010-01-01

    Jiří Wolker, a poet born at the beginning of the 20th century, enjoyed great popularity among literary critics as well as readers. The reception of his work was marked with controversial interpretations, which resulted in the critical movement Dosti Wolkera (Enough Wolker) in 1925. Wolker's work has been described as "Proletarian", but his lyrical writings achieved high quality and there is much more in it. Jiří Wolker had been appreciated as a very talented and hard-working personality. He b...

  9. A journey through discrete mathematics a tribute to Jiří Matoušek

    Nešetřil, Jaroslav; Thomas, Robin

    2017-01-01

    This collection of high-quality articles in the field of combinatorics, geometry, algebraic topology and theoretical computer science is a tribute to Jiří Matoušek, who passed away prematurely in March 2015. It is a collaborative effort by his colleagues and friends, who have paid particular attention to clarity of exposition – something Jirka would have approved of. The original research articles, surveys and expository articles, written by leading experts in their respective fields, map Jiří Matoušek’s numerous areas of mathematical interest.

  10. Effects of Tai Ji Quan training on gait kinematics in older Chinese women with knee osteoarthritis: A randomized controlled trial

    Qingguang Zhu

    2016-09-01

    Conclusion: Among older Chinese women with knee OA, a tailored Tai Ji Quan intervention improved gait outcomes. The intervention also improved overall function as indexed by the WOMAC and SPPB. These results support the use of Tai Ji Quan for older Chinese adults with knee OA to both improve their functional mobility and reduce pain symptomatology.

  11. Jiří Musil a sociální teorie

    Skovajsa, Marek

    2012-01-01

    Roč. 48, č. 5 (2012), s. 1003-1008 ISSN 0038-0288 Institutional support: RVO:68378025 Keywords : Czech sociology * social theory * Jiří Musil (1928-2012) Subject RIV: AO - Sociology, Demography Impact factor: 0.652, year: 2012

  12. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  13. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  14. TianShuiShi space breeding current situation and developing trend

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  15. [Research on Japanese monograph of comprehensive dietetic materia medica, the Pao chu bei yong wo ming ben cao (Japanese Materia Medica Prepared for Kitchen)].

    Zhou, M; Ye, J

    2017-11-28

    Japanese physicians of Edo Period (1603-1867) wrote many dietetic books, by combining the knowledge system (content and compiling style) and thoughts of diet therapy from China with local condition in Japan. Among them, the Pao chu bei yong wo ming ben cao ( Japanese Materia Medica Prepared for Kitchen ), written by Mukai Genshou, a physician in the early Edo, is the earliest comprehensive work of dietetic materia medica. In this book, the choice and usage of Japanese dietetic materia medica reveals obvious Japanese local color, including the name, morphology, cultivation, collection, identification, nature and flavor, and indication etc., reflecting the sprouting idea of edible herbal plant at the beginning of Edo period and the characteristic of absorbing Chinese diet thoughts by Japanese physician. This is the important first-hand historical material to understand the development of Japanese dietetic herbalism in early Edo and its dietotherapy culture.

  16. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  17. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  18. Tai Ji Quan and global cognitive function in older adults with cognitive impairment: a pilot study.

    Li, Fuzhong; Harmer, Peter; Liu, Yu; Chou, Li-Shan

    2014-01-01

    This study evaluated whether Tai Ji Quan: Moving for Better Balance (TJQMBB) could improve global cognitive function in older adults with cognitive impairment. Using a nonrandomized control group pretest-posttest design, participants aged ≥65 years who scored between 20 and 25 on the Mini-Mental State Examination (MMSE) were allocated into either a 14-week TJQMBB program (n=22) or a control group (n=24). The primary outcome was MMSE as a measure of global cognitive function with secondary outcomes of 50-ft speed walk, Timed Up&Go, and Activities-Specific Balance Confidence (ABC) scale. At 14 weeks, Tai Ji Quan participants showed significant improvement on MMSE (mean=2.26, pJi Quan participants performed significantly better compared to the controls in both physical performance and balance efficacy measures (p<0.05). Improvement in cognition as measured by MMSE was related to improved physical performance and balance efficacy. These results provide preliminary evidence of the utility of the TJQMBB program to promote cognitive function in older adults in addition to physical benefits. Copyright © 2014 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.

  19. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  20. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  1. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  2. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  3. Hrob nemlčí pevněji nežli Vy : (Dopisy Jiřího Karáska, Arnošta Procházky, Jiřiny Böhmové a Antonína Trýba)

    Färber, Vratislav (ed.)

    2007-01-01

    Roč. 18, č. 4 (2007), s. 163-170 ISSN 0862-6928 R&D Projects: GA ČR GA405/05/2152 Institutional research plan: CEZ:AV0Z90560517 Keywords : Kamil Fiala * Jiří Karásek ze Lvovic * Arnošt Procházka * Jiřina Böhmová * Antnoní Trýb Subject RIV: AJ - Letters, Mass-media, Audiovision

  4. Acupuncture (針灸 Zhēn Jiǔ – An Emerging Adjunct in Routine Oral Care

    Devanand Gupta

    2014-10-01

    Full Text Available Acupuncture (針灸 Zhēn Jiǔ (‘acus’ (needle+‘punctura’ (to puncture is the stimulation of specific points along the skin of the body involving various methods such as penetration by thin needles or the application of heat, pressure, or laser light. Acupuncture (針灸 Zhēn Jiǔ aims to treat a range of medical and dental ailments, though is most commonly used for pain relief. This article reviews about the various possible roles of acupuncture (針灸 Zhēn Jiǔ in clinical dental practice. Acupuncture (針灸 Zhēn Jiǔ has potential in supplementing conventional treatment procedures by its diverse applicability outreach. Role of acupuncture (針灸 Zhēn Jiǔ in dental practice has been well supported by clinical trials. Its role in alleviating facial pain, pre-operative and post-operative dental pain has led to its widespread application. Its role as sole analgesic for treatment procedure has to be tested. It's It is a thought that acupuncture (針灸 Zhēn Jiǔ may prove an indispensible supplement to conventional treatment modalities and more of clinical trials and studies are required to prove the efficacy. Acupuncture (針灸 Zhēn Jiǔ is not a miracle cure and is not going to replace the drill. However, the technique can be a supplement to conventional treatments in TMDs, facial pain, pain management Sjoegrens syndrome, and in phobias and anxiety. The application and use of Acupuncture (針灸 Zhēn Jiǔ comes with some side effects. Proper training needs to be obtained before commencement of any procedure related to acupuncture (針灸 Zhēn Jiǔ. Various training programs are offered to train clinical practitioners the apt method to use acupuncture (針灸 Zhēn Jiǔ.

  5. Design of a detector to study associated charm production in the SHiP beam dump facility

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  6. From State-controlled to Polycentric Governance in Forest Landscape Restoration: The Case of the Ecological Forest Purchase Program in Yong'an Municipality of China.

    Long, Hexing; Liu, Jinlong; Tu, Chengyue; Fu, Yimin

    2018-07-01

    Forest landscape restoration is emerging as an effective approach to restore degraded forests for the provision of ecosystem services and to minimize trade-offs between conservation and rural livelihoods. Policy and institutional innovations in China illustrate the governance transformation of forest landscape restoration from state-controlled to polycentric governance. Based on a case study of the Ecological Forest Purchase Program in Yong'an municipality, China's Fujian Province, this paper explores how such forest governance transformation has evolved and how it has shaped the outcomes of forest landscape restoration in terms of multi-dimensionality and actor configurations. Our analysis indicates that accommodating the participation of multiple actors and market-based instruments facilitate a smoother transition from state-centered to polycentric governance in forest landscape restoration. Governance transitions for forest landscape restoration must overcome a number of challenges including ensurance of a formal participation forum, fair participation, and a sustainable legislative and financial system to enhance long-term effectiveness.

  7. Climate Change Policy Measures in Japan: NEDO's Activities to Promote CDM/JI

    Fukasawa, Kazunori; Seki, Kazuhiko; Sakurai, Takeshi

    2004-01-01

    The Kyoto Protocol, which obliges developed countries to reduce emissions of greenhouse gases (GHG), was adopted at the third session of the conference of the parties to the United Nations Framework Convention on Climate Change (UNFCCC) in Kyoto, Japan, on I I December 1997. Japan subsequently ratified the Kyoto Protocol in 2002 and is required thereunder to reduce GHG emissions by 6% below 1990 levels by 2008-2012. Japan, having already tackled development and promotion of energy conservation technologies after the second oil crisis, emits the lowest level of CO 2 of developed countries approximately 9.4 tons per capita in the year 2000. Consequently, Japan is able to contribute to CO 2 emissions reduction in developing economies as well as in economies in transition by application of Japan's energy conservation technologies. Because the Clean Development Mechanism (CDM) and Joint implementation (JI) of the Kyoto Mechanisms are efficient tools, the Japanese government's policy towards emission reduction makes active use of CDM/JI, thereby supporting domestic efforts in realizing Japan's reduction commitment. The Ministry of Economy, Trade and Industry (METI) of Japan is one of the key ministries to administer Governmental policy making on climate change, and is undertaking establishment of a system to facilitate the Kyoto Mechanisms. The New Energy and Industrial Technology Development Organization (NEDO), under the jurisdiction of METI, supports CDM and JI project activities implemented by Japanese private sector enterprises. In this report, the authors briefly introduce climate change policy measures in Japan and NEDO's activities to promote CDM/Jl. (Author)

  8. Severe haze episodes and seriously polluted fog water in Ji'nan, China.

    Wang, Xinfeng; Chen, Jianmin; Sun, Jianfeng; Li, Weijun; Yang, Lingxiao; Wen, Liang; Wang, Wenxing; Wang, Xinming; Collett, Jeffrey L; Shi, Yang; Zhang, Qingzhu; Hu, Jingtian; Yao, Lan; Zhu, Yanhong; Sui, Xiao; Sun, Xiaomin; Mellouki, Abdelwahid

    2014-09-15

    Haze episodes often hit urban cities in China recently. Here, we present several continuous haze episodes with extremely high PM2.5 levels that occurred over several weeks in early 2013 and extended across most parts of the northern and eastern China-far exceeding the Beijing-Tianjin-Hebei region. Particularly, the haze episode covered ~1 million km(2) on January 14, 2013 and the daily averaged PM2.5 concentration exceeded 360 μg m(-3) in Ji'nan. The observed maximum hourly PM2.5 concentration in urban Ji'nan reached 701 μg m(-3) at 7:00 am (local time) in January 30. During these haze episodes, several fog events happened and the concurrent fog water was found to be seriously polluted. For the fog water collected in Ji'nan from 10:00 pm in January 14 to 11:00 am in January 15, sulfate, nitrate, and ammonium were the major ions with concentrations of 1.54 × 10(6), 8.98 × 10(5), and 1.75 × 10(6) μeq L(-1), respectively, leading to a low in-situ pH of 3.30. The sulfate content in the fog sample was more than 544 times as high as those observed in other areas. With examination of the simultaneously observed data on PM2.5 and its chemical composition, the fog played a role in scavenging and removing fine particles from the atmosphere during haze episodes and thus was seriously contaminated. However, the effect was not sufficient to obviously cleanse air pollution and block haze episodes. Copyright © 2014 Elsevier B.V. All rights reserved.

  9. Water footprint of Jing-Jin-Ji urban agglomeration in China

    Zhao, D.

    2017-12-01

    A rapidly expanding economy and increasing water demand for economic production is placing enormous stress on water quantity and aquatic environment in Northern China, especially the so-called Jing-Jin-Ji (Beijing-Tianjin-Hebei) urban agglomeration. Several studies have focused on energy consumption, air pollution, CO2 emissions and regional blue water footprint (WF) following release of the Jing-Jin-Ji Integration Strategy by the China government. However, a comprehensive assessment distinguishing blue, green and grey WF amongst different industrial sectors, ascertaining how WF transfers internally and beyond the region and final demand consumption is not available. In this study, we quantified the WF and virtual water flow on a sectoral basis for the year 2010 through coupling the multi-regional input-output model (MRIO) with WF assessment. The results showed that Beijing and Tianjin are net importers of green, blue and grey water from Hebei and other provinces to support their needs. Conversely, Hebei exports all WF colors to Beijing, Tianjin and other provinces in China, more than 60% of WF is transferred as virtual water. For the overall Jing-Jin-Ji region a small amount of blue water (2,086 million m3) is exported, but huge amounts of green water (15,573 million m3) and grey water (30,620 million m3) are outsourced. A "Virtual Water Strategy" is one measure which could alleviate water stress at the regional scale, with consideration of financial compensation from water receiving regions made to water supplying regions for achieving water management targets. We also found that physical water transfer to Jing-Jin-Ji could not balance virtual blue water exports. Our research suggests that a continuation of an export-based economic development model will worsen Hebei's water stress. Reducing the dependency of Hebei's sectoral economy on export of water intensive and low value added agricultural products may be one strategy to reduce the pressure on regional water

  10. ν{sub τ}-physics with the SHiP experiment

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  11. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  12. Economic Evaluation of a Tai Ji Quan Intervention to Reduce Falls in People With Parkinson Disease, Oregon, 2008-2011.

    Li, Fuzhong; Harmer, Peter

    2015-07-30

    Exercise is effective in reducing falls in people with Parkinson disease. However, information on the cost effectiveness of this approach is lacking. We conducted a cost-effectiveness analysis of Tai Ji Quan for reducing falls among patients with mild-to-moderate Parkinson disease. We used data from a previous intervention trial to analyze resource use costs related to intervention delivery and number of falls observed during a 9-month study period. Cost effectiveness was estimated via incremental cost-effectiveness ratio (ICER) in which Tai Ji Quan was compared with 2 alternative interventions (Resistance training and Stretching) on the primary outcome of per fall prevented and the secondary outcome of per participant quality-adjusted life years (QALY) gained. We also conducted subgroup and sensitivity analyses. Tai Ji Quan was more effective than either Resistance training or Stretching; it had the lowest cost and was the most effective in improving primary and secondary outcomes. Compared with Stretching, Tai Ji Quan cost an average of $175 less for each additional fall prevented and produced a substantial improvement in QALY gained at a lower cost. Results from subgroup and sensitivity analyses showed no variation in cost-effectiveness estimates. However, sensitivity analyses demonstrated a much lower ICER ($27) when only intervention costs were considered. Tai Ji Quan represents a cost-effective strategy for optimizing spending to prevent falls and maximize health gains in people with Parkinson disease. While these results are promising, they warrant further validation.

  13. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  14. Study of nu-tau properties with the SHiP experiment

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  15. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  16. Investigation of JI and DI CMOS FXR response at different spectral energies

    Honnold, V.R.; Goldberg, M.; Schreiner, W.A.; Witteles, A.A.

    1975-01-01

    The transient response of both junction isolated (JI) and dielectrically isolated (DI) CMOS circuits has been investigated in three FXR environments of differing energy spectrums. The offset recovery times have been measured and analyzed for both structures. It is shown that while the DI circuit (HD4007) did not exhibit a four layer type latchup action, its transient response persisted for a time longer than is expected for this type of device. A possible mechanism for this observed response is developed and discussed. JI circuits (CD4007) exposed under the same conditions exhibited four layer device action and one sample at low spectral energies latched-up. The conditions for the latchup to occur including the four layer device paths are discussed. Finally, the dependence of the x-ray transient response on the spectral energy is considered. For the lower energy FXR source, latchup was observed in a CD4007 sample. This latchup was not observed at more than double the dose rate when a high energy FXR was used. This result is attributed to dose enhancement, and a device enhancement factor may also be involved. The dose enhancement factor is estimated from the work of Long, and points up the importance of accounting for the spectral energy content in simulating a given nuclear threat spectrum

  17. [Regional ecological planning and ecological network construction: a case study of "Ji Triangle" Region].

    Li, Bo; Han, Zeng-Lin; Tong, Lian-Jun

    2009-05-01

    By the methods of in situ investigation and regional ecological planning, the present ecological environment, ecosystem vulnerability, and ecological environment sensitivity in "Ji Triangle" Region were analyzed, and the ecological network of the study area was constructed. According to the ecological resources abundance degree, ecological recovery, farmland windbreak system, environmental carrying capacity, forestry foundation, and ecosystem integrity, the study area was classified into three regional ecological function ecosystems, i. e., east low hill ecosystem, middle plain ecosystem, and west plain wetland ecosystem. On the basis of marking regional ecological nodes, the regional ecological corridor (Haerbin-Dalian regional axis, Changchun-Jilin, Changchun-Songyuan, Jilin-Songyuan, Jilin-Siping, and Songyuan-Siping transportation corridor) and regional ecological network (one ring, three links, and three belts) were constructed. Taking the requests of regional ecological security into consideration, the ecological environment security system of "Ji Triangle" Region, including regional ecological conservation district, regional ecological restored district, and regional ecological management district, was built.

  18. JiTTree: A Just-in-Time Compiled Sparse GPU Volume Data Structure

    Labschutz, Matthias

    2015-08-12

    Sparse volume data structures enable the efficient representation of large but sparse volumes in GPU memory for computation and visualization. However, the choice of a specific data structure for a given data set depends on several factors, such as the memory budget, the sparsity of the data, and data access patterns. In general, there is no single optimal sparse data structure, but a set of several candidates with individual strengths and drawbacks. One solution to this problem are hybrid data structures which locally adapt themselves to the sparsity. However, they typically suffer from increased traversal overhead which limits their utility in many applications. This paper presents JiTTree, a novel sparse hybrid volume data structure that uses just-in-time compilation to overcome these problems. By combining multiple sparse data structures and reducing traversal overhead we leverage their individual advantages. We demonstrate that hybrid data structures adapt well to a large range of data sets. They are especially superior to other sparse data structures for data sets that locally vary in sparsity. Possible optimization criteria are memory, performance and a combination thereof. Through just-in-time (JIT) compilation, JiTTree reduces the traversal overhead of the resulting optimal data structure. As a result, our hybrid volume data structure enables efficient computations on the GPU, while being superior in terms of memory usage when compared to non-hybrid data structures.

  19. JiTTree: A Just-in-Time Compiled Sparse GPU Volume Data Structure

    Labschutz, Matthias; Bruckner, Stefan; Groller, M. Eduard; Hadwiger, Markus; Rautek, Peter

    2015-01-01

    Sparse volume data structures enable the efficient representation of large but sparse volumes in GPU memory for computation and visualization. However, the choice of a specific data structure for a given data set depends on several factors, such as the memory budget, the sparsity of the data, and data access patterns. In general, there is no single optimal sparse data structure, but a set of several candidates with individual strengths and drawbacks. One solution to this problem are hybrid data structures which locally adapt themselves to the sparsity. However, they typically suffer from increased traversal overhead which limits their utility in many applications. This paper presents JiTTree, a novel sparse hybrid volume data structure that uses just-in-time compilation to overcome these problems. By combining multiple sparse data structures and reducing traversal overhead we leverage their individual advantages. We demonstrate that hybrid data structures adapt well to a large range of data sets. They are especially superior to other sparse data structures for data sets that locally vary in sparsity. Possible optimization criteria are memory, performance and a combination thereof. Through just-in-time (JIT) compilation, JiTTree reduces the traversal overhead of the resulting optimal data structure. As a result, our hybrid volume data structure enables efficient computations on the GPU, while being superior in terms of memory usage when compared to non-hybrid data structures.

  20. JiTTree: A Just-in-Time Compiled Sparse GPU Volume Data Structure.

    Labschütz, Matthias; Bruckner, Stefan; Gröller, M Eduard; Hadwiger, Markus; Rautek, Peter

    2016-01-01

    Sparse volume data structures enable the efficient representation of large but sparse volumes in GPU memory for computation and visualization. However, the choice of a specific data structure for a given data set depends on several factors, such as the memory budget, the sparsity of the data, and data access patterns. In general, there is no single optimal sparse data structure, but a set of several candidates with individual strengths and drawbacks. One solution to this problem are hybrid data structures which locally adapt themselves to the sparsity. However, they typically suffer from increased traversal overhead which limits their utility in many applications. This paper presents JiTTree, a novel sparse hybrid volume data structure that uses just-in-time compilation to overcome these problems. By combining multiple sparse data structures and reducing traversal overhead we leverage their individual advantages. We demonstrate that hybrid data structures adapt well to a large range of data sets. They are especially superior to other sparse data structures for data sets that locally vary in sparsity. Possible optimization criteria are memory, performance and a combination thereof. Through just-in-time (JIT) compilation, JiTTree reduces the traversal overhead of the resulting optimal data structure. As a result, our hybrid volume data structure enables efficient computations on the GPU, while being superior in terms of memory usage when compared to non-hybrid data structures.

  1. Vehicle driving cycle performance of the spark-less di-ji hydrogen engine

    Boretti, Alberto A. [School of Science and Engineering, University of Ballarat, PO Box663, Ballarat, VIC 3353 (Australia)

    2010-05-15

    The paper describes coupled CFD combustion simulations and CAE engine performance computations to describe the operation over the full range of load and speed of an always lean burn, Direct Injection Jet Ignition (DI-JI) hydrogen engine. Jet ignition pre-chambers and direct injection are enablers of high efficiencies and load control by quantity of fuel injected. Towards the end of the compression stroke, a small quantity of hydrogen is injected within the spark-less pre-chamber of the DI-JI engine, where it mixes with the air entering from the main chamber and auto-ignites because of the high temperature of the hot glow plug. Then, jets of partially combusted hot gases enter the main chamber igniting there in the bulk, over multiple ignition points, lean stratified mixtures of air and fuel. Engine maps of brake specific fuel consumption vs. speed and brake mean effective pressure are computed first. CAE vehicle simulations are finally performed evaluating the fuel consumption over emission cycles of a vehicle equipped with this engine. (author)

  2. THE TYPES OF PLANS AND INTERIOR DESIGN AT MEMORIAL CLOISTERS OF DAITOKU-JI AND MYOSHIN-JI TEMPLES IN KYOTO IN THE EDO PERIOD [1596~1868] -The Development and Changes of the Sanctuary-

    Antariksa Antariksa

    2003-01-01

    Full Text Available In the early Edo period the number of memorial cloisters (tacchu increased, especially, at Daitoku-ji and Myôshin-ji temples. As a consequence, the hondô (kyakuden, hojo were further developed in all aspects of architectural style, interior design and plan. This study will attempt to clarify the types of plans at memorial cloisters of both temples, by analyzing the arrangement and composition of the sanctuary, during the Edo period. In that period, the requirement of the rooms was interlaced with the function, and even dependent upon everyday life and the activities of religious services.

  3. The pedagogical value of a student-run community-based experiential learning project: The Yong Loo Lin School of Medicine Public Health Screening.

    Wee, Liang En; Yeo, Wei Xin; Tay, Clifton M; Lee, Jeannette J M; Koh, Gerald C H

    2010-09-01

    We assessed the pedagogical value of a student-led community-based experiential learning project called the Public Health Screening (PHS) run by medical and nursing students of the National University of Singapore's Yong Loo Lin School of Medicine (NUS YLLSoM). We conducted a cross-sectional study using a self-administered anonymised questionnaire on medical and nursing students who participated in PHS using the Fund for the Improvement of Postsecondary Education (FIPSE) Survey Instrument. Participants also gave an overall score for their learning experience at the PHS. The participation rate was 93.1% (576/619) for medical students and 100% (37/37) for nursing students. All participants gave the PHS learning experience a high rating (median = 8 out of maximum of 10, inter-quartile range, 7 to 9). A majority of participants felt that PHS had helped them to improve across all domains surveyed. For medical students, those in preclinical years and females were independently more likely to feel that PHS had helped them to improve in communication skills, teamwork, ability to identify social issues, taking action, and gaining and applying their knowledge than those in clinical years and males. Improved ability to interact with patients (β=1.64, 95%CI, 1.01-2.27), appreciation of challenges to healthcare faced by Singaporeans from lower income groups (β=0.93, 95%CI, 0.49-1.37), thinking of others (β=0.70, 95%CI, 0.04-1.37) and tolerance of different people (β =0.63, 95%CI, 0.17-1.10) were strongly associated with the overall rating score. PHS was a positive learning experience in a wide range of domains for all students involved. This suggests that student-organised community-based experiential learning projects have potential educational value for both medical and nursing students.

  4. Marketingový plán fitness centra Expreska Jiřího z Poděbrad

    Štěchová, Kristýna

    2016-01-01

    Title: The marketing plan of fitness center Expreska Jiřího z Poděbrad. Objectives: The main aim of the dimploma thesis is to construct a marketing plan for fitness center Expreska Jiřího z Poděbrad for the year 2017. The proposed marketing strategy, including the implementation plan will be directed to achieve marketing and business goals of the organization. Methods: For analysis of the microenvironment is used Porter matrix. Analysis of macroenvironment is done with the help of PEST analys...

  5. Etiology and radiologic findings of anoxia occurred at Dan-Mu-Ji(Salted radish in rice bran) manufacture: A case report and results of gas analysis

    Park, Choong Ki; Kim, Heung Cheol; Ahn, Bum Gyu; Park, Man Soo; Hwang, Woo Cheol; Choi, Cheol Soon; Kang, Ik Won [College of Medicine, Hallym University, Chunchon (Korea, Republic of); Kim, Man Goo [Kangwon National University, Chunchon (Korea, Republic of)

    1994-07-15

    To identify the main toxic gas released from salted radish in rice bran(Dan-Mu-Ji) and to introduce the radiological findings of the patient who was exposed to the gas. Chest radiographs and CT scans of one survivor among three men who were exposed to the gas from Dan-Mu-Ji were reviewed. Gas obtained from the closed bottle containing Dan-Mu-Ji was analyzed by using the gas chromatography. The radiographic examinations of the survivor were suggestive of pulmonary edema with it's rapidly improving consideration in both lung. The headspace gas within the bottle containing Dan-Mu-Ji was mainly composed with carbon dioxide, ethyl alcohol and hydrogen sulfide, of which hydrogen sulfide was considered the main toxic gas released. Under the anaerobic condition, Dan-Mu-Ji released toxic hydrogen sulfide. Inhalation of hydrogen sulfide might produce non-cardiogenic pulmonary edema.

  6. Numerical Modeling of a Jet Ignition Direct Injection (JI DI LPG Engine

    Albert Boretti

    2017-01-01

    Full Text Available The paper presents indirectly validated simulations of the operation of a LPG engine fitted with Direct Injection (DI and Jet Ignition (JI. It is demonstrated that the engine may have diesel like efficiencies and load control by quantity of fuel injected.  As the liquid propane quickly evaporates after injection in the main chamber, the main chamber mixture may be much closer to stoichiometry than a diesel for a better specific power at low engine speeds. This design also works at the high engine speeds impossible for the diesel, as combustion within the main chamber is controlled by the turbulent mixing rather than the vaporization and diffusion processes of the injected fuel of the diesel. 

  7. Anticancer Principles from Medicinal Piper (胡椒 Hú Jiāo Plants

    Yue-Hu Wang

    2014-01-01

    Full Text Available The ethnomedical uses of Piper (胡椒 Hú Jiāo plants as anticancer agents, in vitro cytotoxic activity of both extracts and compounds from Piper plants, and in vivo antitumor activity and mechanism of action of selected compounds are reviewed in the present paper. The genus Piper (Piperaceae contains approximately 2000 species, of which 10 species have been used in traditional medicines to treat cancer or cancer-like symptoms. Studies have shown that 35 extracts from 24 Piper species and 32 compounds from Piper plants possess cytotoxic activity. Amide alkaloids account for 53% of the major active principles. Among them, piplartine (piperlongumine shows the most promise, being toxic to dozens of cancer cell lines and having excellent in vivo activity. It is worthwhile to conduct further anticancer studies both in vitro and in vivo on Piper plants and their active principles.

  8. Efficacy of rehabilitation with Tai Ji Quan in an Italian cohort of patients with Fibromyalgia Syndrome.

    Maddali Bongi, Susanna; Paoletti, Gianluca; Calà, Michael; Del Rosso, Angela; El Aoufy, Khadija; Mikhaylova, Svetlana

    2016-08-01

    Fibromyalgia Syndrome (FMS) is characterized by musculoskeletal pain, muscle tenderness leading to disability, impaired quality of life (QoL), fatigue and it is accompanied by sleep disorders and psychological distress. Mind body therapies (MBT), such as Tai Ji Quan (TJQ), use different techniques to facilitate the ability of the mind to influence disease characteristics and symptoms. Some studies showed that TJQ, in patients with rheumatic diseases, particularly FMS, improved QoL, disability and psychological distress. To evaluate the efficacy of TJQ on disability, QoL, fatigue, sleep and psychological distress in an Italian cohort of FMS patients. We enrolled 44 FMS patients: 22 patients (Experimental Group) participated to a course of Tai Ji Quan style of (2/week for 16 weeks); 22 patients (Control Group) participated to an educational course about FMS (2/week for 16 weeks). At baseline (T0) and at the end of treatment (T1), patients were assessed for disability [Fibromyalgia Impact Questionnaire (FIQ), Health Assessment Questionnaire (HAQ)], Quality of Life [Short-Form 36 (SF36)], fatigue [Functional Assessment of Chronic Illness-Fatigue (FACIT-F)], pain [Widespread Pain Index (WPI)], tenderness [Tender Points (TP)], Sleep Quality [Pittsburgh Sleep Quality Index (PSQI)] and mood disorders [Hospital Anxiety and Depression Scale (HADS)]. At T1 versus T0, patients of the Experimental Group showed a significant improvement in FIQ, FACIT, SF36 (Summary Physical Index, Physical activity, physical role, bodily pain, general health, vitality, emotional role limitations), in WPI, TP, PSQI (total, sleep duration, and sleep disturbance) and HADS (total score and anxiety subscale), while Patients in the Control Group did not improve in any parameter. In FMS patients TJQ, if performed by an expert physiotherapist, should be regarded as an effective rehabilitation method. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Consumption-based Total Suspended Particulate Matter Emissions in Jing-Jin-Ji Area of China

    Yang, S.; Chen, S.; Chen, B.

    2014-12-01

    The highly-industrialized regions in China have been facing a serious problem of haze mainly consisted of total suspended particulate matter (TSPM), which has attracted great attention from the public since it directly impairs human health and clinically increases the risks of various respiratory and pulmonary diseases. In this paper, we set up a multi-regional input-output (MRIO) model to analyze the transferring routes of TSPM emissions between regions through trades. TSPM emission from particulate source regions and sectors are identified by analyzing the embodied TSPM flows through monetary flow and carbon footprint. The track of TSPM from origin to end via consumption activities are also revealed by tracing the product supply chain associated with the TSPM emissions. Beijing-Tianjin-Hebei (Jing-Jin-Ji) as the most industrialized area of China is selected for a case study. The result shows that over 70% of TSPM emissions associated with goods consumed in Beijing and Tianjin occurred outside of their own administrative boundaries, implying that Beijing and Tianjin are net embodied TSPM importers. Meanwhile, 63% of the total TSPM emissions in Hebei Province are resulted from the outside demand, indicating Hebei is a net exporter. In addition, nearly half of TSPM emissions are the by-products related to electricity and heating supply and non-metal mineral products in Jing-Jin-Ji Area. Based on the model results, we provided new insights into establishing systemic strategies and identifying mitigation priorities to stem TSPM emissions in China. Keywords: total suspended particulate matter (TSPM); urban ecosystem modeling; multi-regional input-output (MRIO); China

  10. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  11. K jubileu prof. JUDr. Zdeňka Jičínského, DrSc

    Grospič, Jiří

    2009-01-01

    Roč. 148, č. 5 (2009), s. 526-527 ISSN 0231-6625 Institutional research plan: CEZ:AV0Z70680506 Keywords : tribute to Zdeněk Jičínský * Czech lawyer * Czech politican Subject RIV: AG - Legal Sciences

  12. SHiP: a new facility to search for heavy neutrinos and study $\

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  13. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  14. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  15. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  16. SHiP: a new multipurpose beam-dump experiment at the SPS.

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  17. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  18. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  19. Air quality assessment by contingent valuation in Ji'nan, China.

    Wang, Yan; Zhang, Yi-Sheng

    2009-02-01

    Along with urbanization and environmental deterioration within China, many residents' desire for improved air quality has increased. To address this topic, this study focuses on the relationship between poor air quality and residents' willingness to pay for improved air quality in the city of Ji'nan. As a means of quantifying an individual's willingness to pay (WTP) for improved air quality, a contingent valuation method (CVM) was employed. A sample of 1500 residents was chosen, based on the stratified sampling method. The respondents' WTP was then elicited through a series of face-to-face interviews, conducted using a range of hypothetical, open-ended scenario questions. The results showed that 59.7% of respondents were able to express a positive WTP, and that the average WTP was 100 Chinese Yuan (CNY) per person, per year. In order to establish the relationship between endogenous variables and WTP, both a Probit model on the probability of a positive WTP, and a stepwise regression model were constructed. Most parameters in the econometric analysis demonstrated the expected results. It was found that annual household income, expenditure on the treatment of respiratory diseases and workers in the family significantly influenced WTP. The rates of positive WTP and the monetary amount were also larger for men than for women. Unlike developed countries, most respondents regard air quality improvement as a government responsibility in that more than 40% of respondents had no incentive to bear the costs of attempting to achieve better air quality, indicating a relatively low environmental consciousness.

  20. Just-in-time tomography (JiTT): a new concept for image-guided radiation therapy

    Pang, G; Rowlands, J A [Toronto-Sunnybrook Regional Cancer Centre, 2075 Bayview Avenue, Toronto M4N 3M5 (Canada); Imaging Research, Sunnybrook and Women' s College Health Sciences Centre, Departments of Radiation Oncology and Medical Biophysics, University of Toronto, Toronto (Canada)

    2005-11-07

    Soft-tissue target motion is one of the main concerns in high-precision radiation therapy. Cone beam computed tomography (CBCT) has been developed recently to image soft-tissue targets in the treatment room and guide the radiation therapy treatment. However, due to its relatively long image acquisition time the CBCT approach cannot provide images of the target at the instant of the treatment and thus it is not adequate for imaging targets with intrafraction motion. In this note, a new approach for image-guided radiation therapy-just-in-time tomography (JiTT)-is proposed. Differing from CBCT, JiTT takes much less time to generate the needed tomographical, beam's-eye-view images of the treatment target at the right moment to guide the radiation therapy treatment. (note)

  1. Just-in-time tomography (JiTT): a new concept for image-guided radiation therapy

    Pang, G; Rowlands, J A

    2005-01-01

    Soft-tissue target motion is one of the main concerns in high-precision radiation therapy. Cone beam computed tomography (CBCT) has been developed recently to image soft-tissue targets in the treatment room and guide the radiation therapy treatment. However, due to its relatively long image acquisition time the CBCT approach cannot provide images of the target at the instant of the treatment and thus it is not adequate for imaging targets with intrafraction motion. In this note, a new approach for image-guided radiation therapy-just-in-time tomography (JiTT)-is proposed. Differing from CBCT, JiTT takes much less time to generate the needed tomographical, beam's-eye-view images of the treatment target at the right moment to guide the radiation therapy treatment. (note)

  2. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  3. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  4. Effect of YangZheng XiaoJi Extract, DME-25, on endothelial cells and their response to Avastin.

    Owen, Sioned; Gao, Y.; Zhi, X.; Wei, C.; Wu, Y.; Jiang, Wen Guo

    2016-01-01

    ackground: Angiogenesis is a cellular process that has been identified as a key target for therapy in solid cancer. However, over the course of anti-angiogenic therapies, cancer cells acquire resistance to these therapies after an initial period of success. DME-25 is an extract from Yang Zheng Xiao Ji, a traditional Chinese medicine that has been reported to benefit patients with cancer by alleviating chemotherapy-associated symptoms and possibly inhibiting key cancer cell traits. This study ...

  5. First reliability test of a surface micromachined microengine using SHiMMeR

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  6. The Measurement of Urbanization Level Based on Entity Space: A Case Study of JingJinJi Region, China

    Wen Fenghua

    2017-01-01

    Full Text Available On the basis of analyzing the pros and cons of different urbanization level measurement methods, this paper puts forward urbanization level measurement method based on entity space and then uses entity space data to describe the urbanization rate of various districts and counties of JingJinJi Region in 2005 and 2009. According to the analysis of time and space differences on such basis, JingJinJi may be divided from high to low order according to the urbanization rate of the entity space: central urban area, urban development area and suburb, which respectively bear different functions. According to the comparison of entity space urbanization rate and population urbanization rate in the aspects of sequence, primacy ratio, zipf index, etc., we find the non-intensive land use status quo of urban development area of JingJinJi and the feature that the distribution of entity space urbanization scale is much uniform than distribution of population urbanization scale. Accordingly, the paper puts forward the following suggestions : (1 The space construction should depend upon function division; (2 The urban development area should pay attention to the construction of the supporting facilities and meanwhile enhance land use rate; (3 The urban construction should be enhanced in small and middle regions and counties surrounding Beijing and Tianjin.

  7. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  8. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  9. [A randomized, double-blind, controlled study: Ji-Tai tablet for the treatment of acute withdrawl syndrome of mild heroin dependence].

    Wang, Yuhong; Tang, Cuiqing; Cheng, Shuang; Cui, Guimei; Zhang, Ruiling; Zhang, Zhiyong; Xie, Lingyin; Lin, Yongxiong; Hao, Wei

    2015-02-01

    To investigate the efficacy and safety of Ji-Tai tablet and Ji-Tai tablet combined with buprenorphine in the treatment of patients with acute withdrawal syndrome of mild heroin dependence. A total of 150 patients with mild heroin dependence were recruited, and were randomly assigned to a Ji-Tai tablet group (n=50), a Ji-Tai tablet combined with buprenorphine group (n=50) and a control group (n=50) during a 10-day clinical trial. Opiate withdrawal scale (OWS) was used to measure the severity of withdrawal symptoms. Anxiety symptoms assessments were made at 0 day (baseline), the day 5 (middle), and the day 10 (end) by the Hamilton anxiety scale (HAMA). Symptoms were assessed before and 1 h or 2 h after medication each day. The total withdrawal symptoms scores and the daily reduction rate were used to measure the effect of Ji-Tai tablet vs Ji- Tai tablet plus buprenorphine. Safety evaluation was carried out by the following measures: baseline of treatment, drug side effects after the treatment, vital signs (blood pressure, heart rate, and respiration rate), laboratory examination (routine blood and urine tests and the liver and kidney function tests), and electrocardiograms. A total of 142 mild heroin dependence patients performed the experiments (including 48 in the Ji-Tai tablet group, 48 in the Ji-Tai tablet with buprenorphine group and 46 in the control group). The scores of baseline withdrawal symptoms were 43.520±19.786, 42.640±17.648 and 47.100±24.450, respectively, with no significant differences among the 3 groups (all P>0.05 ). During the 10-day treatment, the reduction rate of acute withdrawal symptoms scores increased daily, the acute withdrawal syndrome scores and the anxiety symptoms scores declined from day 0 to day 10, there was also no significant difference among the 3 groups (all P>0.05). Ji-Tai tablet did not affect vital signs such as blood pressure, heart rate, and respiration rate. Ji-Tai tablet or Ji-Tai tablet combined with buprenorphine

  10. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  11. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  12. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  13. Analysis of the Constituents in “Zhu She Yong Xue Shuan Tong” by Ultra High Performance Liquid Chromatography with Quadrupole Time-of-Flight Mass Spectrometry Combined with Preparative High Performance Liquid Chromatography

    Lin-Lin Wang

    2015-11-01

    Full Text Available “Zhu She Yong Xue Shuan Tong” lyophilized powder (ZSYXST, consists of a series of saponins extracted from Panax notoginseng, which has been widely used in China for the treatment of strokes. In this study, an ultra-high performance liquid chromatography with quadrupole time-of-flight mass spectrometry (UHPLC-Q-TOF/MS combined with preparative high performance liquid chromatography (PHPLC method was developed to rapidly identify both major and minor saponins in ZSYXST. Some high content components were removed through PHPLC in order to increase the sensitivity of the trace saponins. Then, specific characteristic fragment ions in both positive and negative mode were utilized to determine the types of aglycone, saccharide, as well as the saccharide chain linkages. As a result, 94 saponins, including 20 pairs of isomers and ten new compounds, which could represent higher than 98% components in ZSYXST, were identified or tentatively identified in commercial ZSYXST samples.

  14. 75 FR 60761 - Government-Owned Inventions; Availability for Licensing

    2010-10-01

    ... related to drug resistance. Inventors: Genbin Shi, Gary Shaw, Xinhua Ji (NCI). Patent Status: U.S... Publications: 1. Blaszczyk J, Shi G, Li Y, Yan H, Ji X. Reaction trajectory of pyrophosphoryl transfer...: 15016362]. 2. Blaszczyk J, Shi G, Yan H, Ji X. Catalytic center assembly of HPPK as revealed by the crystal...

  15. The effects of Tai Ji Quan training on limits of stability in older adults

    Li F

    2014-08-01

    Full Text Available Fuzhong Li1,2 1Oregon Research Institute, Eugene, OR, USA; 2Shanghai University of Sport, Shanghai, People’s Republic of ChinaBackground: Limits of stability, defined as the ability to maintain the center of gravity within the boundary of the base of support, is critically important for older adults in performing their activities of daily living. However, few exercise programs specifically tailored to enhance limits of stability exist. The primary purpose of this study was to determine whether a therapeutically designed intervention, Tai Ji Quan: Moving for Better Balance (TJQMBB, could improve limits of stability in older adults. A secondary purpose was to examine concomitant change in limits of stability and physical performance as a result of the intervention.Methods: A single-group design was used in which 145 community-dwelling older adults (average age: 75 years were enrolled in TJQMBB classes, participating twice weekly for 48 weeks. Primary outcome measures were three indicators of limits of stability (LOS (endpoint excursion, movement velocity, and directional control, with secondary measures of physical performance being Timed Up and Go and 50-foot speed walk (in seconds, which were assessed at baseline, 24 weeks, and 48 weeks. Changes in the repeated measures of outcome variables were analyzed via latent curve analysis.Results: At 48 weeks, a significant rate of change (improvement over time was observed in the three limits of stability indicators (endpoint execution: 8.30% LOS, P<0.001; movement velocity: 0.86 degrees/second, P<0.001; directional control: 6.79% of 100, P<0.001; all reached a threshold of real change as judged by the minimal detectable change values. Improvements in the three limits of stability measures were concomitantly correlated with improved (reduced times performance scores in the Timed Up and Go (-0.30, -0.45, and -0.55, ­respectively and 50-foot walk (-0.33, -0.49, and -0.41, respectively

  16. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  17. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  18. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  19. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  20. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  1. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  2. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  3. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  4. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  5. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  6. arXiv Search for new physics with the SHiP experiment at CERN

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  7. Neuronal nitric oxide synthase inhibition prevents cerebral palsy following hypoxia-ischemia in fetal rabbits: comparison between JI-8 and 7-nitroindazole.

    Yu, Lei; Derrick, Matthew; Ji, Haitao; Silverman, Richard B; Whitsett, Jennifer; Vásquez-Vivar, Jeannette; Tan, Sidhartha

    2011-01-01

    Cerebral palsy and death are serious consequences of perinatal hypoxia-ischemia (HI). Important concepts can now be tested using an animal model of cerebral palsy. We have previously shown that reactive oxygen and nitrogen species are produced in antenatal HI. A novel class of neuronal nitric oxide synthase (nNOS) inhibitors have been designed, and they ameliorate postnatal motor deficits when administered prior to the hypoxic-ischemic insult. This study asks how the new class of inhibitors, using JI-8 (K(i) for nNOS: 0.014 μM) as a representative, compare with the frequently used nNOS inhibitor 7-nitroindazole (7-NI; K(i): 0.09 ± 0.024 μM). A theoretical dose equivalent to 75 K(i) of JI-8 or equimolar 7-NI was administered to pregnant rabbit dams 30 min prior to and immediately after 40 min of uterine ischemia at 22 days gestation (70% term). JI-8 treatment resulted in a significant decrease in NOS activity (39%) in fetal brain homogenates acutely after HI, without affecting maternal blood pressure and heart rate. JI-8 treatment resulted in 33 normal kits, 2 moderately and 13 severely affected kits and 5 stillbirths, compared with 8 normal, 3 moderately affected and 5 severely affected kits and 10 stillbirths in the 7-NI group. In terms of neurobehavioral outcome, 7-NI was not different from saline treatment, while JI-8 was superior to saline and 7-NI in its protective effect (p JI-8 significantly improved the locomotion score over both saline and 7-NI scores. JI-8 was also significantly superior to saline in preserving smell, muscle tone and righting reflex function, but 7-NI did not show significant improvement. Furthermore, a 100-fold increase in the dose (15.75 μmol/kg) of 7-NI significantly decreased systolic blood pressure in the dam, while JI-8 did not. The new class of inhibitors such as JI-8 shows promise in the prevention of cerebral palsy and is superior to the previously more commonly used nNOS inhibitor. Copyright © 2011 S. Karger AG, Basel.

  8. Study on embodied CO2 transfer between the Jing-Jin-Ji region and other regions in China: a quantification using an interregional input-output model.

    Chen, Mengmeng; Wu, Sanmang; Lei, Yalin; Li, Shantong

    2018-03-08

    Jing-Jin-Ji region (i.e., Beijing, Tianjin, and Hebei) is China's key development region, but it is also the leading and most serious air pollution region in China. High fossil fuel consumption is the major source of both carbon dioxide (CO 2 ) emissions and air pollutants. Therefore, it is important to reveal the source of CO 2 emissions to control the air pollution in the Jing-Jin-Ji region. In this study, an interregional input-output model was applied to quantitatively estimate the embodied CO 2 transfer between Jing-Jin-Ji region and other region in China using China's interregional input-output data in 2010. The results indicated that there was a significant difference in the production-based CO 2 emissions in China, and furthermore, the Jing-Jin-Ji region and its surrounding regions were the main regions of the production-based CO 2 emissions in China. Hebei Province exported a large amount of embodied CO 2 to meet the investment, consumption, and export demands of Beijing and Tianjin. The Jing-Jin-Ji regions exported a great deal of embodied CO 2 to the coastal provinces of southeast China and imported it from neighboring provinces.

  9. Research on Park Ji-Won in China%朴趾源研究在中国

    张丽娜

    2012-01-01

    朴趾源研究是韩国古典文学研究的一个热点和重点。总体上看,研究队伍中名家济济,以汉文形式发表的研究成果较多。学界对朴趾源的研究主要集中在其思想、小说创作上,《热河日记》是研究的一个焦点。对于朴趾源诗歌、散文和《燕岩集》的整体研究有所欠缺,全面、系统、客观地研究评价朴趾源在韩国文学史、思想史上的地位的专著尚未出现。%Research on Park Ji-Won is a key and hit of Korean classical literature. On the whole, there are many famous experts in the field and lots of research achievements in Chinese. Academic studies focus on his ideas and novels, of which ReHe Diary is a focus. However, an overall study of his poetries, proses and YanYan Collection is not enough. Comprehensive, systematic and objective works have not yet appeared, which study and assess Park Ji -Won's position in the history of Korean literature and intellectual

  10. [Thoughts and methods of study on acupuncture medical history: an example of Mr. MA Ji-Xing].

    Yang, Feng; Zhu, Ling

    2014-03-01

    Mr. MA Ji-xing has devoted himself into the study of acupuncture medical history for more than 70 years. As a result, a great work of Zhenjiuxue Tongshi (see text), History of Acupuncture-Moxibustion) has been completed. The author has expensively studied for history of acupuncture medicine in time and space. Base on abundant historical materials, deliberate textual research as well as strategically situated academic view, it is considered as a masterpiece of acupuncture on real significance. It is worthwhile to note that the book has a systematic and profound explanation on Bian-stone therapy, unearthed literature relics of acupuncture, the bronze figure or illustration of acupoint as well as special topics of Japan and Korea acupuncture history. Filled several gaps of the field, and explored some significant new paths of study, it laid the groundwork for the profound study and unscramble of traditional acupuncture theory as well as the investigation of the academic history, which is considered to have a profound and persistent influence. The careful sorting and profound digging of many distinguish thoughts and methods of Mr. MA Ji-xing in the study of acupuncture medical history has significant meaning in references and enlightenment of the future research on acupuncture medical history.

  11. Interprovincial transfer of embodied energy between the Jing-Jin-Ji area and other provinces in China: A quantification using interprovincial input-output model.

    Chen, Weiming; Wu, Sanmang; Lei, Yalin; Li, Shantong

    2017-04-15

    Commodity trade between regions implies a large amount of energy transfer. As an important economic growth pole of China, the Jing-Jin-Ji area (Beijing-Tianjin-Hebei) is also one of the areas with the largest energy consumption in China. Moreover, the primary energy consumer goods in this area are fossil fuels, such as coal. This has led to serious air pollution in the area. Therefore, the reduction of energy consumption under the premise of maintaining sustained economic growth is an important task of the Jing-Jin-Ji area. In this study, an interprovincial input-output model was applied to quantitatively estimate the embodied energy transfer between Jing-Jin-Ji area and other provinces in China. The results indicated that the Metal and nonmetal mineral processing industry and the Electrical, gas and water industry in the Jing-Jin-Ji area exported a large amount of embodied energy to the Yangtze River Delta and the Pearl River Delta. However, the embodied energy export of the Jing-Jin-Ji area mainly exported by Hebei province. Beijing and Tianjin even have some net import of embodied energy. The embodied energy transfer between Tianjin, Hebei and other provinces was mainly driven by investment, while the main media of embodied energy transfer between Beijing and other provinces was consumption. Therefore, we suggest that the Jing-Jin-Ji area should further increase the degree of dependence on other provinces' energy-intensive products and reduce the export of energy-intensive products. In addition, there should be difference in the energy and industrial policies among Beijing, Tianjin and Hebei, and the problems of high energy consumption and high proportion of heavy industry in Hebei should be first resolved. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. A pilot study of JI-101, an inhibitor of VEGFR-2, PDGFR-β, and EphB4 receptors, in combination with everolimus and as a single agent in an ovarian cancer expansion cohort.

    Werner, Theresa L; Wade, Mark L; Agarwal, Neeraj; Boucher, Kenneth; Patel, Jesal; Luebke, Aaron; Sharma, Sunil

    2015-12-01

    JI-101 is an oral multi-kinase inhibitor that targets vascular endothelial growth factor receptor type 2 (VEGFR-2), platelet derived growth factor receptor β (PDGFR-β), and ephrin type-B receptor 4 (EphB4). None of the currently approved angiogenesis inhibitors have been reported to inhibit EphB4, and therefore, JI-101 has a novel mechanism of action. We conducted a pilot trial to assess the pharmacokinetics (PK), tolerability, and efficacy of JI-101 in combination with everolimus in advanced cancers, and pharmacodynamics (PD), tolerability, and efficacy of JI-101 in ovarian cancer. This was the first clinical study assessing anti-tumor activity of JI-101 in a combinatorial regimen. In the PK cohort, four patients received single agent 10 mg everolimus on day 1, 10 mg everolimus and 200 mg JI-101 combination on day 8, and single agent 200 mg JI-101 on day 15. In the PD cohort, eleven patients received single agent JI-101 at 200 mg twice daily for 28 day treatment cycles. JI-101 was well tolerated as a single agent and in combination with everolimus. No serious adverse events were observed. Common adverse events were hypertension, nausea, and abdominal pain. JI-101 increased exposure of everolimus by approximately 22%, suggestive of drug-drug interaction. The majority of patients had stable disease at their first set of restaging scans (two months), although no patients demonstrated a response to the drug per RECIST criteria. The novel mechanism of action of JI-101 is promising in ovarian cancer treatment and further prospective studies of this agent may be pursued in a less refractory patient population or in combination with cytotoxic chemotherapy.

  13. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  14. The conservation treatment of a contemporary collaged sculpture by Jiří Kolář (1914-2002

    Jessica Crann

    2010-11-01

    Full Text Available Une sculpture représentant une pomme réalisée par collage de l’artiste tchèque Jiří Kolář et datant de 1972, a été soumise à un traitement de conservation-restauration. La sculpture présentait des dommages structurels causés par des facteurs externes ainsi que des surfaces encrassées. Les interrogations déontologiques soulevées lors de la restauration d’une œuvre d’art contemporain ont représenté un aspect important de l’étude. Par conséquent, la majeure partie des recherches a été dévolue à  la compréhension du matériau et de la structure, celle des intentions de l’artiste,tout comme du concept et de la signification de l’œuvre. Ce travail a été étayé par une recherche scientifique ayant pour but d’évaluer l’efficacité du Triammonium citrate comme agent de nettoyage à base aqueuse, ainsi que par une analyse de la construction en trois dimensions de l’œuvre d’art.A collaged sculpture of an apple by the Czech artist Jiří Kolář, dated 1972 was presented for conservation. The sculpture suffered from structural damage caused by external factors and ingrained surface dirt. The ethical implications raised in conserving a contemporary artwork were an important aspect and subsequently an understanding of the materials and structure, the artist’s intentions, concept and meaning of the artwork formed a large part of the research. Combined with this was scientific research into the effectiveness of Tri-ammonium Citrate as an aqueous surface cleaning agent and analysing construction of 3-Dimensional artworks.

  15. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing

    2014-02-12

    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  16. 75 FR 62173 - In the Matter of the Review of the Designation of Jemaah Islamiya (JI and Other Aliases) as a...

    2010-10-07

    ... DEPARTMENT OF STATE [Public Notice: 7196] In the Matter of the Review of the Designation of Jemaah Islamiya (JI and Other Aliases) as a Foreign Terrorist Organization Pursuant to Section 219 of the Immigration and Nationality Act, as Amended Based upon a review of the Administrative Record assembled in this...

  17. Jiří Vacek: Slovanská knihovna – můj osud. Mozaika vzpomínek. Národní knihovna\

    Hašková, Dana

    2017-01-01

    Roč. 86, č. 4 (2017), s. 523-525 ISSN 0037-6736 Institutional support: RVO:68378017 Keywords : Vacek, Jiří * The Slavonic Library * Memories Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  18. Jiří Procháska (1749-1820): Part 2: "De structura nervorum"-Studies on a Structure of the Nervous System.

    Chvátal, Alexandr

    2015-01-01

    Roč. 24, č. 1 (2015), s. 1-25 ISSN 0964-704X Institutional support: RVO:68378041 Keywords : Jiří Procházka * neuroanatomy * nervous tissue Subject RIV: FH - Neurology Impact factor: 0.529, year: 2015

  19. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  20. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  1. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  2. [Editing style of Imwon-Gyeongjeji, Inje-ji and inclusion of the medicinal knowledge of the late period of Joseon - Comparing mainly with Dongui-Bogam -].

    Jeon, Jongwook; Jo, Changrock

    2012-12-01

    Imwon-Gyeongjeji which was created by Seo Yu-gu in the first half of the 19th century is a encyclopedia of practical use in rural life. It consists of 113 volumes, 16 fields, and 2.52 million total characters. Of these, the field of medicine comes 11th of the contents covering 28 volumes and 1.1 million characters. Its name is Inje-ji. This paper examines the academic background of Seo Yu-gu and his life work briefly, and investigates the characteristics of medical knowledge of late Joseon period contained in the Imwon-Gyeongjeji, Inje-ji Here, we made key comparisons especially with Dongui-Bogam, Joseon's leading medical book. Of the pioneers of medical history studies of Joseon, a Japanese researcher Miki Sakae has made a negative evaluation to Inje-ji. But after concrete investigation we have come to conclude as follows. First, familial ancestors of Seo Yu-gu were engaged in the introduction of foreign-language books, so Seo Yu-gu as an officer of proof-reading and editing of the various books, also had a lot of knowledge on the medical books ever in history. On this background and experience, for over 36 years from 1,806 retirement from official position to his death, he had compiled and edited Imwon-Gyeongjeji. Second, unlike Dongui-Bogam which included improving health skill, Inje-ji focused on curing medicine readily accessible from the major population of that time. Its main features are as follows: i) prescriptions directly linked to the diseases and symptoms, ii) greatly increased medicinal knowledge especially on infectious diseases and trauma, iii) detailed index easy to look up for prescription and iv) his 'own opinions'[an-seol] which can indicate relevant contents within the book and organically combines the whole knowledge in it. Third, "Inje-ji" utilizing medical books in China and Korea even those of Japan, collected more massively almost all the medical knowledge, new illness, herbs of local area, private prescription. Meanwhile Inje-ji modified

  3. A strategy for extending the applicability of a validated plasma calibration curve to quantitative measurements in multiple tissue homogenate samples: a case study from a rat tissue distribution study of JI-101, a triple kinase inhibitor.

    Gurav, Sandip Dhondiram; Jeniffer, Sherine; Punde, Ravindra; Gilibili, Ravindranath Reddy; Giri, Sanjeev; Srinivas, Nuggehally R; Mullangi, Ramesh

    2012-04-01

    A general practice in bioanalysis is that, whatever the biological matrix the analyte is being quantified in, the validation is performed in the same matrix as per regulatory guidelines. In this paper, we are presenting the applicability of a validated LC-MS/MS method in rat plasma for JI-101, to estimate the concentrations of JI-101 in various tissues that were harvested in a rat tissue distribution study. A simple protein precipitation technique was used to extract JI-101 and internal standard from the tissue homogenates. The recovery of JI-101 in all the matrices was found to be >70%. Chromatographic separation was achieved using a binary gradient using mobile phase A (acetonitrile) and B (0.2% formic acid in water) at a flow rate of 0.30 mL/min on a Prodigy ODS column with a total run time of 4.0 min. The MS/MS ion transitions monitored were 466.1 → 265 for JI-101 and 180.1 → 110.1 for internal standard. The linearity range was 5.02-4017 ng/mL. The JI-101 levels were quantifiable in the various tissue samples harvested in this study. Therefore, the use of a previously validated JI-101 assay in plasma circumvented the tedious process of method development/validation in various tissue matrices. Copyright © 2011 John Wiley & Sons, Ltd.

  4. Effect of Tai Ji Quan training on self-reported sleep quality in elderly Chinese women with knee osteoarthritis: a randomized controlled trail.

    Lü, Jiaojiao; Huang, Lingyan; Wu, Xie; Fu, Weijie; Liu, Yu

    2017-05-01

    The purpose of this study was to explore the effects of a 24-week Tai Ji Quan training program on sleep quality, quality of life, and physical performance among elderly Chinese women with knee osteoarthritis (OA). A 24-week randomized, controlled trial of 46 elderly women with knee OA. Participants were randomly assigned to either a Tai Ji Quan group (n = 23) or a control group (n = 23). Participants in the Tai Ji Quan group completed training sessions three times per week, while those in the control group had bi-weekly educational classes. The primary outcome was total score of the Pittsburgh Sleep Quality of Index (PSQI). Secondary outcomes were: seven subscales of the PSQI; sleep latency; total sleep time; sleep efficiency; physical component summary (PCS) and mental component summary (MCS) of the 36-item Short Form Health Survey (SF-36); Berg Balance Scale (BBS); and Timed Up and Go (TUG). Compared with the control group, participants in the Tai Ji Quan group had significantly improved primary outcome (global PSQI score, p = 0.006) and secondary outcomes, including three PSQI sub-scores (sleep latency, p = 0.031; sleep duration, p = 0.043; daytime dysfunction, p = 0.007), total sleep time (p = 0.033), and SF-36 PCS (p = 0.006). The Tai Ji Quan group also had significant improvements compared with baseline in three PSQI sub-scores (sleep latency, p = 0.031; habitual sleep efficiency, p = 0.049; sleep disturbance, p = 0.016), sleep latency (p = 0.003), BBS (p = 0.001), and TUG (p = 0.006). Tai Ji Quan training is an effective treatment approach to improve sleep quality and quality of life in elderly Chinese women with knee OA. Chinese Clinical Trial Registry (June 16, 2013): ChiCTR-TRC-13003264. Copyright © 2017 Elsevier B.V. All rights reserved.

  5. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  6. Papīra darbi ka domāšanas veicinātāji pirmsskolā

    Jevdokimova, Jūlija

    2017-01-01

    Jūlija J. (2017.) “Papīra darbi kā domāšanas veicinātāji pirmsskolā”. Kvalifikācijas darbs. Rīga: Latvijas Universitātes Pedagoģijas, psiholoģijas un mākslas fakultāte, 90 lpp, 16 att., 4 tab., bibl. 18 nos., latviešu, angļu val. Darbs sastāv no ievada, 5 nodaļām, secinājumiem un 16 pielikumiem. Autors ir vairākus mēnešus izgājis praksi pirmsskolas pedagoga amatā. Darbā ir veikts pētījums par domāšanas attīstību rokdarbu nodarbībās, veicot papīra darbus Darba mērķis ir izzināt un atklāt bēr...

  7. Research into the functional components and antioxidant activities of North China rice wine (Ji Mo Lao Jiu)

    He, Shuai; Mao, Xiangzhao; Liu, Pei; Lin, Hong; Du, Zuyuan; Lv, Ning; Han, Jichen; Qiu, Cuifang

    2013-01-01

    Over the last decade, considerable experimental evidence has supported the view that grape wine and South China rice wine are rich in diverse nutrients and have powerful antioxidant activity. However, little research has been carried out for North China rice wine, of which Ji Mo Lao Jiu (JMLJ) is the outstanding representative. In this study, the functional components and antioxidant activity of JMLJ were investigated. Twenty-eight free amino acids were found in JMLJ, much more than that previously reported in other Chinese rice wines (16–21). Functional oligosaccharides (5290.222 mg/L), total phenols (722.431 ± 10.970 mg/L), and mineral elements (9) were rich in JMLJ. When compared with synthetic antioxidants, such as butylated hydroxyanisole (BHA) and butylated hydroxytoluene (BHT), JMLJ showed effective 1,1-diphenyl-2-picryl-hydrazyl (DPPH) radical scavenging and reducing capacity. The results of this study lay the foundation for promoting the utilization of JMLJ and the development of North China rice wine in the food industry. PMID:24804035

  8. Research into the functional components and antioxidant activities of North China rice wine (Ji Mo Lao Jiu).

    He, Shuai; Mao, Xiangzhao; Liu, Pei; Lin, Hong; Du, Zuyuan; Lv, Ning; Han, Jichen; Qiu, Cuifang

    2013-07-01

    Over the last decade, considerable experimental evidence has supported the view that grape wine and South China rice wine are rich in diverse nutrients and have powerful antioxidant activity. However, little research has been carried out for North China rice wine, of which Ji Mo Lao Jiu (JMLJ) is the outstanding representative. In this study, the functional components and antioxidant activity of JMLJ were investigated. Twenty-eight free amino acids were found in JMLJ, much more than that previously reported in other Chinese rice wines (16-21). Functional oligosaccharides (5290.222 mg/L), total phenols (722.431 ± 10.970 mg/L), and mineral elements (9) were rich in JMLJ. When compared with synthetic antioxidants, such as butylated hydroxyanisole (BHA) and butylated hydroxytoluene (BHT), JMLJ showed effective 1,1-diphenyl-2-picryl-hydrazyl (DPPH) radical scavenging and reducing capacity. The results of this study lay the foundation for promoting the utilization of JMLJ and the development of North China rice wine in the food industry.

  9. Pražský světící biskup? Jiří Ignác Pospíchal (1635–1699)

    Pučalík, Marek

    2015-01-01

    Roč. 30, č. 1 (2015), s. 159-169 ISSN 0231-7494 R&D Projects: GA ČR(CZ) GA14-05167S Institutional support: RVO:67985963 Keywords : Jiří Ignác Pospíchal * the Knights of the Cross with the Red Star * Prague * Polná * bishop * archbishop Subject RIV: AB - History

  10. The impact of the "Air Pollution Prevention and Control Action Plan" on PM2.5 concentrations in Jing-Jin-Ji region during 2012-2020.

    Cai, Siyi; Wang, Yangjun; Zhao, Bin; Wang, Shuxiao; Chang, Xing; Hao, Jiming

    2017-02-15

    In order to cope with heavy haze pollution in China, the Air Pollution Prevention and Control Action Plan including phased goals of the fine particulate matter (PM 2.5 ) was issued in 2013. In this study, China's emission inventories in the baseline 2012 and the future scenarios of 2017 and 2020 have been developed based on this Action Plan. Beijing-Tianjin-Hebei (Jing-Jin-Ji) region, one of the most polluted regions in China, was taken as a case to assess the impact of phased emission control measures on PM 2.5 concentration reduction using WRF-CMAQ model system. With the implementation of the Action Plan, the emissions of sulfur dioxide (SO 2 ), nitrogen oxides (NO X ) , PM 2.5 , non-methane volatile organic compound (NMVOC), and ammonia (NH 3 ) in 2017 will decrease by36%, 31%, 30%,12%, and -10% from the 2012 levels in Jing-Jin-Ji, respectively. In 2020, the emissions of SO 2 , NO X, PM 2.5 , NMVOC, and NH 3 will decrease by 40%, 44%, 40%, 22%, and -3% from the 2012 levels in Jing-Jin-Ji, respectively. Consequently, the ambient annual PM 2.5 concentration under the scenarios of 2017 and 2020 will be 28.3% and 37.8% lower than those in 2012, respectively. The Action Plan provided an effective approach to alleviate PM 2.5 pollution level in Jing-Jin-Ji region. However, emission control of NMVOC and NH 3 should be paid more attention and be strengthened in future. Meanwhile, emission control of NO x , SO 2 , NH 3 and NMVOC synergistically are highly needed in the future because multiple pollutants impact on PM 2.5 and O 3 concentrations nonlinearly. Copyright © 2016 Elsevier B.V. All rights reserved.

  11. Návrh marketingové kampaně pro Knihovnu Jiřího Mahena v Brně

    Matějková, Kateřina

    2014-01-01

    Subject of this bachelor thesis is design a marketing campaign to increase competitiveness and attendance in Knihovna Jiřího Mahena in Brno. The thesis describes and explains the issues relating to non-profit organizations, in particular governmental organizations. The theoretical part enlarged on ways to finance non-profit organizations, and customer relationship management. Pursuant to available information are compiled an internal and external analysis, an extensive marketing mix analysis ...

  12. Quantum state-to-state dynamics for the quenching process of Br(2P1/2) + H2(v(i) = 0, 1, j(i) = 0).

    Xie, Changjian; Jiang, Bin; Xie, Daiqian; Sun, Zhigang

    2012-03-21

    Quantum state-to-state dynamics for the quenching process Br((2)P(1/2)) + H(2)(v(i) = 0, 1, j(i) = 0) → Br((2)P(3/2)) + H(2)(v(f), j(f)) has been studied based on two-state model on the recent coupled potential energy surfaces. It was found that the quenching probabilities have some oscillatory structures due to the interference of reflected flux in the Br((2)P(1/2)) + H(2) and Br((2)P(3/2)) + H(2) channels by repulsive potential in the near-resonant electronic-to-vibrational energy transfer process. The final vibrational state resolved integral cross sections were found to be dominated by the quenching process Br((2)P(1/2)) + H(2)(v) → Br((2)P(3/2)) + H(2)(v+1) and the nonadiabatic reaction probabilities for Br((2)P(1/2)) + H(2)(v = 0, 1, j(i) = 0) are quite small, which are consistent with previous theoretical and experimental results. Our calculated total quenching rate constant for Br((2)P(1/2)) + H(2)(v(i) = 0, j(i) = 0) at room temperature is in good agreement with the available experimental data. © 2012 American Institute of Physics

  13. THE EFFECT OF PROBLEM SOLVING LEARNING MODEL BASED JUST IN TIME TEACHING (JiTT ON SCIENCE PROCESS SKILLS (SPS ON STRUCTURE AND FUNCTION OF PLANT TISSUE CONCEPT

    Resha Maulida

    2017-11-01

    Full Text Available The purpose of this study was to determine the effect of Problem Solving learning model based Just in Time Teaching (JiTT on students' science process skills (SPS on structure and function of plant tissue concept. This research was conducted at State Senior High School in South Tangerang .The research conducted using the quasi-experimental with Nonequivalent pretest-Postest Control Group Design. The samples of this study were 34 students for experimental group and 34 students for the control group. Data was obtained using a process skill test instrument (essai type that has been tested for its validity and reliability. Result of data analysis by ANACOVA, show that there were significant difference of postest between experiment and control group, by controlling the pretest score (F = 4.958; p <0.05. Thus, the problem-solving learning based on JiTT proved to improve students’ SPS. The contribution of this treatment in improving the students’ SPS was 7.2%. This shows that there was effect of problem solving model based JiTT on students’ SPS on the Structure and function of plant tissue concept.

  14. Ssang Yong 2014 Remote Sensing Experiment

    2016-05-25

    stems from multiple sources: the ocean waves reaching the sands, rivers...I ~ I I I I I 350 550 750 950 1150 1350 1550 1750 1950 2150 2350 Wavelength, nm G-8           Cll ... <: ’" 1:: Cll ...0.6 0.5 0.4 Cll a: 0.3 0 .2 0.1 0.6 0.5 0.4 Cll ... <: ’" 1:: Cll ;;::: Cll a: 0.3 0.2 0.1 DG-2-4 1 1 I I I I ’ I I 1 11 1 Il l I 1

  15. Ultra high performance liquid chromatography coupled with electrospray ionization/quadrupole time-of-flight mass spectrometry for the rapid analysis of constituents in the traditional Chinese medicine formula Wu Ji Bai Feng Pill.

    Duan, Shengnan; Qi, Wen; Zhang, Siwen; Huang, Kunkun; Yuan, Dan

    2017-10-01

    An ultra high performance liquid chromatography coupled with electrospray ionization quadrupole time-of-flight mass spectrometry method in both positive and negative ion modes was established in order to comprehensively investigate the major constituents in Wu Ji Bai Feng Pill. Briefly, a Waters ACQUITY UPLC HSS C 18 column was used to separate the aqueous extract of Wu Ji Bai Feng Pill. A total of 0.1% formic acid in acetonitrile and 0.1% aqueous formic acid v/v were used as the mobile phase. All analytes were determined using quadrupole time-of-flight mass spectrometry with electrospray ionization source in positive and negative ion modes. At length, a total of 173 components including flavones and their glycosides, monoterpene glycosides, triterpene saponins, phenethylalchohol glycosides, iridoid glycosides, phthalides, tanshinones, phenolic acids, sesquiterpenoids and cyclopeptides were identified or tentatively characterized in Wu Ji Bai Feng Pill in an analysis of 16.0 min based on the accurate mass and tandem mass spectrometry behaviors. The developed method is rapid and highly sensitive to characterize the chemical constituents of Wu Ji Bai Feng Pill, which could not only be used for chemical standardization and quality control of Wu Ji Bai Feng Pill, but also be helpful for further study in vivo metabolism of Wu Ji Bai Feng Pill. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. [Textual research on Chen Ye and his Jia cang jing yan fang (Family-preserved Empirical Recipes) of the Song Dynasty].

    Zhang, Xuedan; Zhang, Ruqing; Chen, Dexing

    2014-01-01

    Chen Ye, an official of the Southern Song Dynasty, also known as Chen Rihua as his styled name, was born in Changle, Fuzhou in the reign of Shaoxing, and died during the reign of Duanping. He had been consecutively in the positions of Jiang shi lang (Court Gentleman for Ceremonial Service), Zhi zhou (Prefect) of Lingding, the Ti xing (Judicial Commissioner) of Guangdong, the Zong ling (Overseer-general) of Sichuan, Shan ding (Reviser), Shu lin and other positions in Tongzhou, Yuanzhou. His works included 1 volume of Gu ling xian sheng nian pu (Mr. Guling's Chronological Biography), 1 volume of Tan xie (On Humor), 1 volume of Shi hua (Poetry), 8 volumes of Jin yuan li shu (Jin Yuan's Smart Technique), 3 volumes of Yi jian zhi lei bian (Classified Compilation of Yijian's Annals), (Zeng guang) Suo sui lu (Augmented Records of Trivial Matters), 5 volumes of Jia cang jing yan fang (Family-preserved Empirical Recipes). He also compiled the 8-volume Yin jiang zhi (Yinjiang's Annals), published the 2-volume Jia cang ji yao fang (Collected Essential Recipes from Family Preservation), and other proses and poetry. Jia cang jing yan fang was a formulary compiled by Chen Ye, which was lost. Altogether 74 of its recipes were cited in Fu ren da quan liang fang (Complete Effective Prescriptions for Women's Diseases), Shou qin yang lao shu (A Book for Pursuing Seniors' Longevity and Healthcare), Pu ji fang (Prescriptions for Universal Relief) and Yong le da dian (Yongle Encyclopedia).

  17. [Professor MA Ji-xing and Acupuncture Scientification at the Primary Stage of Establishment of the People's Republic of China].

    Huo, Rui-li; Zhu, Ling; Yang, Feng

    2015-08-01

    In the initial stage (1950s) of the establishment of the People's Republic of China, the Pavlov's theory played an important influence on Chinese biology and medical science fields. At that time, many schools or colleges of traditional Chinese medicine were set up one after another, the first edition of teaching materials or textbook was complete, and a lot of advanced training courses and training classes were developed. In that specific period of "acupuncture scientification", Mr. MA Ji-xing, a professor from China Academy of Traditional Chinese Medicine, is a representative scholar who employed Pavlov's theory to make a scientific explanation about the underlying physiological mechanisms of acupuncture-moxibustion therapy. For example, he employed nerve network or nerve system to explain topical acupuncture stimulation and distal stimulation to induce local effect or distal curative effect, employed the cutaneous-visceral reflex to explain the therapeutic effect of acu-moxibustion for visceral disorders, used the viscera-cutaneous reflex to explain the tender point (sensitized region) or Ashi-point, used the "predominant factor mechanism" or excitation transfer of the stimulated non-sensitized cutaneous region close to the diseased locus to explain the pain-relief of acupuncture stimulation, used the stimulation strength, duration, frequency and distance (to the locus) to explain the needling reinforcing or reducing effect, and so on and so forth. He wrote many articles and books about acupuncturology, one of which was named Jianyao Zhenjiu Xue (Concise Acupuncturology), a well-known demonstration teaching material for advanced training courses, inducing a significant influence on the acu-moxibustion field in both academic field and clinical practice. Looking back this period of history may provide a helpful reference for current research on academic development of acupuncturology.

  18. JI1II

    books, this one is based on a series of articles which origi- nally appeared in the ... Hospital Bone Bank at Harvard Medical School and has made a tremendous ... of Africa; and to the negative impact on the economy, due to direct and indirect ...

  19. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  20. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  1. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  2. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)

    2017-03-01

    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  3. Tai Ji Quan for the aging cancer survivor: Mitigating the accelerated development of disability, falls, and cardiovascular disease from cancer treatment

    Kerri M. Winters-Stone

    2014-03-01

    Full Text Available Currently there are more than 13.7 million cancer survivors living in the U.S., and that figure is projected to increase by 31% in the next decade, adding another 4 million cancer survivors into the healthcare system. Cancer is largely a disease of aging, and the aging of the population will sharply raise the proportion of older cancer survivors, many of whom will be long-term survivors (5+ years post diagnosis. This review will address the potential utility of exercise to address three health problems that are of particular concern for the aging cancer survivor and the healthcare system, i.e., disability, falls, and cardiovascular disease, because the development of these age-related problems may be accelerated by cancer treatment. While there are many different modes of exercise that each produce specific adaptations, Tai Ji Quan may be a particularly suitable strategy to mitigate the development of age- and cancer-treatment-related problems. Based on studies in older adults without cancer, Tai Ji Quan produces musculoskeletal and cardiometabolic adaptations and is more easily performed by older adults due to its low energy cost and slower movement patterns. Since cancer survivors are mostly older, inactive, and often physically limited by the lingering side effects of treatment, they need to engage in safe, practical, and effective modes of exercise. The dearth of published controlled trials examining the efficacy of Tai Ji Quan to mitigate cancer-treatment-related musculoskeletal and cardiovascular side effects points to ample research opportunities to explore the application of this non-Western exercise modality to improve long-term outcomes for aging cancer survivors.

  4. Memory and endurance in the migration to the Amazon: the case of Nova Londrina in Ji-Parana, state of Rondonia, Brazil

    Lediane Fani Felzke; Dalva Felipe de Oliveira; Jania Maria de Paula

    2014-01-01

    The occupation of Rondônia, from the 1970s, occurred in a disorganized way, since it attracted an amount of migrants which was much bigger than the settling projects could sustain. The aim of this research was to analyze the circumstances in which the district of Nova Londrina was settled, utilizing for this reason a bibliographic survey, as well as the Oral History method. The arrival in Nova Londrina, Ji-Paraná, was highlighted by conflicts between the settlers and the settling company Cala...

  5. Uso do res?duo da esta??o de tratamento de ?gua de Ji-Paran?/RO como material ciment?cio

    Rocha, Maria Angelica Froes da

    2016-01-01

    O lodo ? um subproduto inevit?vel no tratamento da ?gua a ser fornecida a uma popula??o, sendo que a sua disposi??o final muitas vezes ? realizada de forma inadequada e n?o sustent?vel. A argamassa ? uma mistura de cimento, areia e ?gua. Este trabalho tem o objetivo de avaliar a substitui??o parcial do agregado mi?do pelo lodo produzido na esta??o de tratamento de ?gua de Ji-Paran? na produ??o de argamassa. A metodologia utilizada no presente estudo consistiu na coleta e secagem do lodo, cara...

  6. The Impact of Land Use and Land Cover Change on Water Yield in the Jing- Jin-Ji Region in China

    Li, Suxiao; Yang, Hong

    2017-04-01

    Water yield is one of the key ecosystem services sustaining both people's life and economic development. However, the water yield function is sensitive to anthropogenic activity especially the land use and land cover change (LUCC). Assessment of historical LUCC and its impact on water yield could benefit designing and implementing appropriate land use strategy that enhance the water yield capacity. Beijing (Jing) and its surrounding areas of Tianjin (Jin) and Hebei (Ji) is the political, cultural and economic center of China. The region is facing increasingly water crisis. Taking the Jing-Jin-Ji region as a study area, this study analyzed the historical LUCC and its impact on water yield by using the Integrated Valuation of Ecosystem Services and Tradeoffs (InVEST) model to spatially map and quantify the changes of water yield from 1995 to 2010. The results showed there was main decline in area of wetland and forest and increase in area of crop land and built up land. An abrupt decline in water yield was found for year 2000. The water yield was influenced to a great extent by precipitation and evapotranspiration, but the land use played an important role in the water yield capacity (water yield per unit area) through plant cover that affected evapotranspiration, soil water permeability and the capacity of holding the moisture content. By general ranking, the water yield capacity of different land use type was as follows: built-up>bare land>cropland> grassland>forest >wetland, which illustrated that the built-up and bare land had higher run off rate while the vegetation area had higher capacity to control surface run off to increase the groundwater. A good understanding of temporal-spatial allocation of historical LUCC and Water yield of the Jing-Jin-Ji region could help guide land use policy decisions that take into consideration of tradeoffs with respect to spatial distribution of ecosystem services amongst the three administrative entities (Jing-Jin-Ji) and

  7. Conversion of acid hydrolysate of oil palm empty fruit bunch to L-lactic acid by newly isolated Bacillus coagulans JI12.

    Ye, Lidan; Hudari, Mohammad Sufian Bin; Zhou, Xingding; Zhang, Dongxu; Li, Zhi; Wu, Jin Chuan

    2013-06-01

    Cost-effective conversion of lignocellulose hydrolysate to optically pure lactic acid is commercially attractive but very challenging. Bacillus coagulans JI12 was isolated from natural environment and used to produce L-lactic acid (optical purity > 99.5 %) from lignocellulose sugars and acid hydrolysate of oil palm empty fruit bunch (EFB) at 50 °C and pH 6.0 without sterilization of the medium. In fed-batch fermentation with 85 g/L initial xylose and 55 g/L xylose added after 7.5 h, 137.5 g/L lactic acid was produced with a yield of 98 % and a productivity of 4.4 g/L h. In batch fermentation of a sugar mixture containing 8.5 % xylose, 1 % glucose, and 1 % L-arabinose, the lactic acid yield and productivity reached 98 % and 4.8 g/L h, respectively. When EFB hydrolysate was used, 59.2 g/L of lactic acid was produced within 9.5 h at a yield of 97 % and a productivity of 6.2 g/L h, which are the highest among those ever reported from lignocellulose hydrolysates. These results indicate that B. coagulans JI12 is a promising strain for industrial production of L-lactic acid from lignocellulose hydrolysate.

  8. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.

    2013-01-01

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  9. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)

    2013-12-15

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  10. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Curie Virág

    2014-10-01

    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  11. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  12. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  13. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  14. Memory and endurance in the migration to the Amazon: the case of Nova Londrina in Ji-Parana, state of Rondonia, Brazil

    Lediane Fani Felzke

    2014-12-01

    Full Text Available The occupation of Rondônia, from the 1970s, occurred in a disorganized way, since it attracted an amount of migrants which was much bigger than the settling projects could sustain. The aim of this research was to analyze the circumstances in which the district of Nova Londrina was settled, utilizing for this reason a bibliographic survey, as well as the Oral History method. The arrival in Nova Londrina, Ji-Paraná, was highlighted by conflicts between the settlers and the settling company Calama S/A. In spite of the company’s violence, the colonists resisted until there was an intervention from INCRA, through a land regularization program. In this context, the Urban Center for Rural Support (NUAR was implanted, intending to support the agricultural workers

  15. Chemical display of pyrimidine bases flipped out by modification-dependent restriction endonucleases of MspJI and PvuRts1I families.

    Evelina Zagorskaitė

    Full Text Available The epigenetic DNA modifications 5-methylcytosine (5mC and 5-hydroxymethylcytosine (5hmC in eukaryotes are recognized either in the context of double-stranded DNA (e.g., by the methyl-CpG binding domain of MeCP2, or in the flipped-out state (e.g., by the SRA domain of UHRF1. The SRA-like domains and the base-flipping mechanism for 5(hmC recognition are also shared by the recently discovered prokaryotic modification-dependent endonucleases of the MspJI and PvuRts1I families. Since the mechanism of modified cytosine recognition by many potential eukaryotic and prokaryotic 5(hmC "readers" is still unknown, a fast solution based method for the detection of extrahelical 5(hmC would be very useful. In the present study we tested base-flipping by MspJI- and PvuRts1I-like restriction enzymes using several solution-based methods, including fluorescence measurements of the cytosine analog pyrrolocytosine and chemical modification of extrahelical pyrimidines with chloroacetaldehyde and KMnO4. We find that only KMnO4 proved an efficient probe for the positive display of flipped out pyrimidines, albeit the method required either non-physiological pH (4.3 or a substitution of the target cytosine with thymine. Our results imply that DNA recognition mechanism of 5(hmC binding proteins should be tested using a combination of all available methods, as the lack of a positive signal in some assays does not exclude the base flipping mechanism.

  16. Tua Ji Peh: The Intricacies of Liminality in the Deification of Chinese non-Buddhist Supernatural Beings in Chinese-Malaysian Communities

    Whitney Webb

    2012-05-01

    Full Text Available The pragmatic, responsive, and syncretic nature of popular Chinese religion is well known and is thought to result, in part, from the religion’s close connection to the fluxes of the social system in which its adherents live. These characteristics often result in considerable change when the social fabric is greatly disrupted, such as in the immigration of Chinese to new and unfamiliar places. This process of change is commonly seen among Chinese deities. Tua Peh大伯 and Ji Peh 二伯 (in Hokkien dialect “First Uncle” and “Second Uncle”, two ghostly deities of popular Chinese Malaysian religion, are understood to have an ambiguous status in the Chinese pantheon as they possess characteristics of both gods and ghosts. In China, these figures were simply part of the otherworldly bureaucracy of the hell realm with a very limited role and were worshipped infrequently. In the past 20 years, their worship has become extremely ubiquitous, with many shrines and temples proliferating. Now a variety of people come to them for wealth, for healings, and for protection. This coincides during a time in which the economic situation of Chinese Malaysians has become more difficult which parallels a significant rise in political tensions between Malays and non-Malays. This has caused a shift towards favorability in the deities’ reputation, the demographics of their worshippers, and the reasons patrons seek their assistance. Overall, the elevation of Tua Ji Peh seems to work towards lending legitimacy to those desperately seeking efficacious aid in a increasingly discriminatory and poltically unstable environment with harsher realities.

  17. [Gao Jingyi. Han yu yu bei Ou yu yan : Han yu yu Wula'er yu yan ji Yin Ou yu yan tong yuan tan jiu] / Ago Künnap

    Künnap, Ago, 1941-

    2010-01-01

    Arvustus: Gao Jingyi. Han yu yu bei Ou yu yan : Han yu yu Wula'er yu yan ji Yin Ou yu yan tong yuan tan jiu = Chinese language and languages of northern Europe. Beijing : Zhongguo she hui ke xue chu ban she, 2008

  18. Reconstruction of eroded monogenic Strombolian cones of Miocene age: A case study on character of volcanic activity of the Jičín Volcanic Field (NE Bohemia) and subsequent erosional rates estimation

    Rapprich, V.; Cajz, Vladimír; Košťák, M.; Pécskay, Z.; Řídkošil, T.; Raška, P.; Radoň, M.

    2007-01-01

    Roč. 52, 3-4 (2007), s. 169-180 ISSN 0449-2560 R&D Projects: GA AV ČR IAA300130612 Institutional research plan: CEZ:AV0Z30130516 Keywords : cinder cone * Strombolian eruption * volcanic facies * erosion rate * Jičín Volcanic Field * Bohemian Paradise GeoPark Subject RIV: DB - Geology ; Mineralogy

  19. Der Österreich-Spiegel? – Jiří Grušas Essays Beneš als Österreicher und die Gebrauchsanweisung für Tschechien und Prag als Beispiele transkulturellen essayistischen Schreibens

    Antošíková, Lucie; Budňák, J.; Schörkhuber, E.

    -, č. 8 (2014), s. 13-32. ISBN 978-3-7069-0726-2. ISSN 1802-6419 Institutional support: RVO:68378068 Keywords : Gruša, Jiří * Beneš, Edvard * German-language essays * construction of national narratives * transcultural writing Subject RIV: AJ - Letters, Mass-media, Audiovision

  20. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  1. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  2. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  3. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  4. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  5. The effect of Ga-mee-gwui-ryong-tang and Yuk-mee ji-hwang-tang Herbal-acupuncture on the growth of mice

    Min-jung Kim

    2006-12-01

    Full Text Available Objectives : To investigate the effect of Ga-mee-Gwui-ryong-tang herbal acupuncture (GR-HA at GB39 and ST36 and the effect of Yuk-mee ji-hwang-tang herbal acupuncture (YM-HA at GB39 and KI10 on growth in mice. Methods : Mice were divided into 7 groups(n=10 ; saline-ST36, saline-GB39, saline-KI10, GR-HA-ST36 group treated with GR-HA at right ST36, GR-HA-GB39 group treated with GR-HA at right GB39, YM-HA-GB39 group treated with YM-HA at right GB39, YM-HA-KI10 group treated with YM-HA at right KI10. Saline-ST36 group, saline-GB39 group and saline-KI10 group were injected with saline at right ST36, GB39, KI10 respectively. Saline injection and HA were performed 3 times a week for 18 days. The length(total height, body length and tail length, weight and the protein efficiency ratio were measured as well as IGF-1 level in serum. Results : 1. GR-HA at GB39 and GR-HA at ST36 promoted growth in weight, tail length and total height but there was no statistical significance. 2. GR-HA at GB39 significantly promoted protein efficiency on the 14th day and GR-HA at ST36 on the 3rd day. 3. GR-HA at GB39 significantly increased serum IGF-1. GR-HA at ST36 increased IGF-1 slightly but with no statistical significance. 4. YM-HA at GB39 and YM-HA at KI10 promoted growth in weight, height, tail length and total height but there was no statistical relevance. 5. YM-HA at GB39 and YM-HA at KI10 significantly promoted protein efficiency on the 14th day. 6. YM-HA at GB39 and YM-HA at KI10 significantly increased serum IGF-1. Serum IGF-1 level of YM-HA-KI10 group was significantly higher than that of YM-HA-GB39 group. 7. Serum IGF-1 level of GR-HA-GB39 group was significantly higher than that of YM-HA-GB39 group. Conclusions : GR-HA and YM-HA both may promote growth. This study suggests that herbal acupuncture at GB39 is more effective with Gwui-ryong-tang than Yuk-mee ji-hwang-tang to promote growth. It also suggests that Yuk-mee ji-hwang-tang herbal acupuncture is more

  6. Space-time PM2.5 mapping in the severe haze region of Jing-Jin-Ji (China) using a synthetic approach.

    He, Junyu; Christakos, George

    2018-05-07

    Long- and short-term exposure to PM 2.5 is of great concern in China due to its adverse population health effects. Characteristic of the severity of the situation in China is that in the Jing-Jin-Ji region considered in this work a total of 2725 excess deaths have been attributed to short-term PM 2.5 exposure during the period January 10-31, 2013. Technically, the processing of large space-time PM 2.5 datasets and the mapping of the space-time distribution of PM 2.5 concentrations often constitute high-cost projects. To address this situation, we propose a synthetic modeling framework based on the integration of (a) the Bayesian maximum entropy method that assimilates auxiliary information from land-use regression and artificial neural network (ANN) model outputs based on PM 2.5 monitoring, satellite remote sensing data, land use and geographical records, with (b) a space-time projection technique that transforms the PM 2.5 concentration values from the original spatiotemporal domain onto a spatial domain that moves along the direction of the PM 2.5 velocity spread. An interesting methodological feature of the synthetic approach is that its components (methods or models) are complementary, i.e., one component can compensate for the occasional limitations of another component. Insight is gained in terms of a PM 2.5 case study covering the severe haze Jing-Jin-Ji region during October 1-31, 2015. The proposed synthetic approach explicitly accounted for physical space-time dependencies of the PM 2.5 distribution. Moreover, the assimilation of auxiliary information and the dimensionality reduction achieved by the synthetic approach produced rather impressive results: It generated PM 2.5 concentration maps with low estimation uncertainty (even at counties and villages far away from the monitoring stations, whereas during the haze periods the uncertainty reduction was over 50% compared to standard PM 2.5 mapping techniques); and it also proved to be computationally very

  7. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  8. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  9. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  10. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  11. Study on the Correlation between Gene Expression and Enzyme Activity of Seven Key Enzymes and Ginsenoside Content in Ginseng in Over Time in Ji'an, China.

    Yin, Juxin; Zhang, Daihui; Zhuang, Jianjian; Huang, Yi; Mu, Ying; Lv, Shaowu

    2017-12-11

    Panax ginseng is a traditional medicine. Fresh ginseng is one of the most important industries related to ginseng development, and fresh ginseng of varying ages has different medicinal properties. Previous research has not systematically reported the correlation between changes in key enzyme activity with changes in ginsenoside content in fresh ginseng over time. In this study, for the first time, we use ginseng samples of varying ages in Ji'an and systematically reported the changes in the activity of seven key enzymes (HMGR, FPS, SS, SE, DS, CYP450, and GT). We investigated the content of ginsenoside and gene expression of these key enzymes. Ginsenoside content was measured using HPLC. HPLC, GC-MS, and LC-MS were combined to measure the enzyme activity of the key enzymes. Quantitative PCR was used in the investigation of gene expression. By analyzing the correlation between the enzyme activity and the transcription level of the key enzymes with ginsenoside content, we found that DS and GT enzyme activities are significantly correlated with the ginsenoside content in different ages of ginseng. Our findings might provide a new strategy to discriminate between ginseng of different years. Meanwhile, this research provides important information for the in-depth study of ginsenoside biosynthesis.

  12. Impacts of Land-Use and Land-Cover Changes on Water Yield: A Case Study in Jing-Jin-Ji, China

    Suxiao Li

    2018-03-01

    Full Text Available Knowing the impact of land-use and land-cover (LULC changes on the distribution of water yield (WY is essential for water resource management. Using the Integrated Valuation of Ecosystem Services and Tradeoffs (InVEST model, we investigated the spatial-temporal variations of WY from 1990 to 2015 in China’s northern semi-arid region of Beijing–Tianjin–Hebei (Jing-Jin-Ji. We quantified the combined effects of LULC dynamics and climatic variation on WY. Furthermore, we identified the relative contribution of main LULC types to WY. For our study region, the built-up area increased by 35.66% (5380 km2 during the study period. In the meantime, cropland, grassland, and wetland decreased continuously. The expansion of built-up area and decline of vegetated land led to an increase of 1047 million m3 (5.1% in total WY. The impacts of LULC changes on WY were mainly determined by the biophysical characteristics of LULC composition. Vegetated land has relatively lower WY coefficients due to higher rates of evapotranspiration and water infiltration. Built-up areas and bare land have higher WY coefficients as a result of their impermeable surface. The spatial-temporal analysis of WY with specification of WY coefficients by LULC types can facilitate integrated land-use planning and water resource management.

  13. Production of high concentration of l-lactic acid from oil palm empty fruit bunch by thermophilic Bacillus coagulans JI12.

    Juturu, Veeresh; Wu, Jin Chuan

    2018-03-01

    Thermophilic Bacillus coagulans JI12 was used to ferment hemicellulose hydrolysate obtained by acid hydrolysis of oil palm empty fruit bunch at 50 °C and pH 6, producing 105.4 g/L of l-lactic acid with a productivity of 9.3 g/L/H by fed-batch fermentation under unsterilized conditions. Simultaneous saccharification and fermentation (SSF) was performed at pH 5.5 and 50 °C to convert both hemicellulose hydrolysate and cellulose-lignin complex in the presence of Cellic Ctec2 cellulases using yeast extract (20 g/L) as the nitrogen source, giving 114.0 g/L of l-lactic acid with a productivity of 5.7 g/L/H. The SSF was also conducted by replacing yeast extract with equal amount of dry Bakers' yeast, achieving 120.0 g/L of l-lactic acid with a productivity of 4.3 g/L/H. To the best of our knowledge, these lactic acid titers and productivities are the highest ever reported from lignocellulose hydrolysates. © 2017 International Union of Biochemistry and Molecular Biology, Inc.

  14. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动

    李秋菊

    2017-01-01

    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  15. Assessment of benzene-induced hematotoxicity using a human-like hematopoietic lineage in NOD/Shi-scid/IL-2Rγnull mice.

    Masayuki Takahashi

    Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.

  16. Heat flow from Io /JI/

    Matson, D. L.; Ransford, G. A.; Johnson, T. V.

    1981-01-01

    The existing ground-based measurements of Io's thermal emission at infrared wavelengths of 8.4, 10.6, and 21 microns have been reexamined. Present in these data is the signature of hot spots, presumably similar to the hot spots seen by the IRIS experiment on Voyager. It is possible to extract from these data the total amount of power radiated. Since the hot spots are believed to be a result of deep-seated activity in Io and since the remainder of Io's surface is an extraordinarily poor thermal conductor, the power radiated by the hot spots is essentially the total heat flow. The analysis yields a heat flow of 2 + or - 1 W/sq m. This value is tremendously large in comparison to the average heat flow of the earth (0.06 W/sq m) and the moon (0.02 W/sq m), but is characteristic of active geothermal areas on the earth. A heat flow this large requires that the interior of Io be at least partially molten on a global scale.

  17. Sheng-ji Hua-yu formula promotes diabetic wound healing of re-epithelization via Activin/Follistatin regulation.

    Kuai, Le; Zhang, Jing-Ting; Deng, Yu; Xu, Shun; Xu, Xun-Zhe; Wu, Min-Feng; Guo, Dong-Jie; Chen, Yu; Wu, Ren-Jie; Zhao, Xing-Qiang; Nian, Hua; Li, Bin; Li, Fu-Lun

    2018-01-29

    Sheng-ji Hua-yu(SJHY) formula is one of the most useful Traditional Chinese medicine (TCM) in the treatment of the delayed diabetic wound. However, elucidating the related molecular biological mechanism of how the SJHY Formula affects excessive inflammation in the process of re-epithelialization of diabetic wound healing is a task urgently needed to be fulfilled. The objectives of this study is to evaluate the effect of antagonisic expression of pro-/anti-inflammatory factors on transforming growth factor-β(TGF-β) superfamily (activin and follistatin) in the process of re-epithelialization of diabetic wound healing in vivo, and to characterize the involvement of the activin/follistatin protein expression regulation, phospho-Smad (pSmad2), and Nuclear factor kappa B p50 (NF-kB) p50 in the diabetic wound healing effects of SJHY formula. SJHY Formula was prepared by pharmaceutical preparation room of Yueyang Hospital of Integrated Traditional Chinese and Western Medicine. Diabetic wound healing activity was evaluated by circular excision wound models. Wound healing activity was examined by macroscopic evaluation. Activin/follistatin expression regulation, protein expression of pSmad2 and NF-kB p50 in skin tissue of wounds were analyzed by Real Time PCR, Western blot, immunohistochemistry and hematoxylin and eosin (H&E) staining. Macroscopic evaluation analysis showed that wound healing of diabetic mice was delayed, and SJHY Formula accelerated wound healing time of diabetic mice. Real Time PCR analysis showed higher mRNA expression of activin/follistatin in diabetic delayed wound versus the wound in normal mice. Western Blot immunoassay analysis showed reduction of activin/follistatin proteins levels by SJHY Formula treatment 15 days after injury. Immunohistochemistry investigated the reduction of pSmad2 and NF-kB p50 nuclear staining in the epidermis of diabetic SJHY versus diabetic control mice on day 15 after wounding. H&E staining revealed that SJHY Formula

  18. The southwestern extension of the Jiao-Liao-Ji belt in the North China Craton: Geochronological and geochemical evidence from the Wuhe Group in the Bengbu area

    Liu, Chaohui; Zhao, Guochun; Liu, Fulai; Cai, Jia

    2018-04-01

    The Wuhe complex is located at the southeastern margin of the North China Craton. The complex consists of metamorphosed Paleoproterozoic potassic granitoids and supracrustal rocks, of which the latter include the Fengyang and Wuhe groups. Meta-mafic rocks from the lower Wuhe Group have igneous zircon U-Pb ages of 2126 ± 37 Ma with εHf(t) values of -6.22 to +8.38, and xenocrystic zircons of 2.39-2.36 Ga, 2.55-2.54 Ga and 2.77-2.69 Ga. Geochemically, the meta-mafic rocks can be classified into two groups. Group 1 island arc tholeiites display flat to slightly right declined REE patterns and moderately negative Nb, Ta, Zr, and Ti anomalies. Group 2 mature arc calcalkaline basalts display strongly fractionated chondrite-normalized REE patterns and evidently negative Nb, Ta and Ti anomalies. These meta-mafic rocks formed by partial melting of sub-arc depleted mantle wedge which had been modified by slab-derived melts at an active continental margin. Depositional age of the group can be constrained in the period of 2.16-2.10 Ga based on ages of the youngest detrital zircons and latter intrusions. U-Pb ages of detrital zircons yield major age peaks of 2.69 Ga and 2.52 Ga, with minor peaks at 2.88 Ga, 2.78 Ga, 2.35 Ga and 2.17 Ga, most of which are derived from the late Mesoarchean to early Paleoproterozoic granitoids in the Wuhe complex and the Jiaodong Terrane. Metamorphic zircons in the marbles coexisting with garnet amphibolites or granulites occur as either single grains or overgrowth (or recrystallization) rims surrounding magmatic zircon cores and yield ages of 1882 ± 19 Ma to 1844 ± 15 Ma. The comparable ca. 2.1 Ga potassic granites with A-type granite affinity, the ca. 2.1 Ga meta-mafic rocks with arc-like geochemical features, the 2.1-1.9 Ga meta-sedimentary units and the 1.9-1.8 Ga subduction- and collision-related granulite-facies metamorphism suggest that the Wuhe complex and the Jiao-Liao-Ji Belt share the same late Paleoproterozoic tectonic evolution

  19. Multi-level natural resources governance based on local community: A case study on semi-natural grassland in Tarōji, Nara, Japan

    Daisaku Shimada

    2015-09-01

    beneficiaries. This paper examines the multi-level management of a semi-natural grassland at Tarōji, in Soni village, in Nara prefecture. In Soni village, members of the local community provide key management input, while local government at the village and prefecture levels share management costs.

  20. Wadi Ladid Al-JI,Dan Alkali Feldspar Granites and Associated Pegmatites, North Eastern Eser, Egypt:Geology,Mineralogy and Radioactivity

    Abu Steet, A.A.; Ayoub, R.R.; Bakhit, A.F.

    2013-01-01

    This article deals with the geology, structure, mineralogy and radioactivity of the alkali feldspar granites at wadi Ladid al-Ji,dan, north Eastern Desert of Egypt. Geologically, the area consists mainly of alkali feldspar granites. These granites are medium to coarse grained, pink to red in colour and form numbers of moderate to relatively high elevated outcrops. These rocks are altered in some parts due to secondary processes especially along the fault zones and contacts. The area displays primary and secondary structures. Primary structures comprise layering, volcanic flows, vesicular tops of lavas and volcanic bombs. The secondary structures are represented by exfoliation, joints and faults. The granites are dissected by several sets of joints predominating in the N-S direction, dipping 84°-88° mainly to west; E-W direction, dipping 70°-75° mainly to south and NW-SE direction, dipping 80°-82° to SW direction. The majority of joints are tension ones. These tension joints are commonly filled with quartz, feldspars, epidote, iron oxides, manganese oxides and aplite. The studied area is dissected by major regional faults. Along the fault zones; the granites are marked by fault breccia and alteration features, especially silicification, hematitization, kaolinitization and chloritization. The area is cutting by faults trending mainly in N-S, NE-SW and NNW-SSE directions. The average uranium and thorium contents of the alkali feldspar granites are 12 and 23 ppm and reaches up to 36 and 37 ppm in the normal pegmatites. In the anomalous pegmatites the maximum values recorded are 91 and 72 ppm. Generally, the averages of uranium and thorium contents in the studied pegmatites are higher than that of the world and Egyptian uraniferous pegmatites. The high uranium content in alkali feldspar granites is related to the presence of some accessory minerals such as zircon, fluorite and apatite but the high uranium content in the pegmatites is related to the presence of

  1. Report on a survey in fiscal 1999. Survey and study on the 'measures for promoting discharge right transaction/joint implementation (JI) / clean development mechanism (CDM) project'; 1999 nendo 'haishutsuken torihiki / JI / CDM project suishin hosaku' ni kansuru chosa kenkyu hokokusho

    NONE

    2000-03-01

    The third conference (COP3) of the United Nations Framework Convention on Climate Change held in December 1997 in Kyoto has adopted the Kyoto mechanisms (the 'discharge right transaction', the 'joint implementation (JI)' among advanced countries, and the 'clean development mechanism (CDM)' applied to developing countries). The Kyoto mechanisms are intended to provide flexibility to the methods to achieve the greenhouse effect gas reduction targets established in the Kyoto Protocol. The Kyoto mechanisms are considered to be implemented even during the year 2000, whose details are scheduled to be decided at COP6. Since the advanced countries have established the targets for reduction of greenhouse effect gas emission, governments and research institutes are taking various approaches. In addition, since the targets for reduction of greenhouse effect gas emission have been established, discussions are indispensable on methodology to establish the quantity of discharge and absorption of greenhouse effect gases (the so-called base line) when no project exists, as required to calculate the discharge reduction quantity as a result of implementing the project. The present survey has held study meetings attended by learned people, and compiled the results of the discussions. (NEDO)

  2. Memória e resistência na migraçao para a Amazônia : O caso de Nova Londrina em Ji-Paraná, estado de Rondônia, Brasil

    Felzke, Lediane Fani; Oliveira, Dalva Felipe de; Paula, Jania Maria de

    2014-01-01

    The occupation of Rondônia, from the 1970s, occurred in a disorganized way, since it attracted an amount of migrants which was much bigger than the settling projects could sustain. The aim of this research was to analyze the circumstances in which the district of Nova Londrina was settled, utilizing for this reason a bibliographic survey, as well as the Oral History method. The arrival in Nova Londrina, Ji-Paraná, was highlighted by conflicts between the settlers and the settling company Cala...

  3. Applying dam height-storage curve to geomorphic features analysis within virtual geographic environment: a case study of the Hong-Shi-Mao watershed

    Wang, Daojun; Gong, Jianhua; Ma, Ainai; Li, Wenhang; Wang, Xijun

    2005-10-01

    There are generally two kinds of approaches to studying geomorphic features in terms of the quantification level and difference of major considerations. One is the earlier qualitative characterization, and the other is the 2-dimension measurement that includes section pattern and projection pattern. With the development of geo-information technology, especially the 3-D geo-visualization and virtual geographic environments (VGE), 3-dimension measurement and dynamic interactive between users and geo-data/geo-graphics can be developed to understand geomorphic features deeply, and to benefit to the effective applications of such features for geographic projects like dam construction. Storage-elevation curve is very useful for site selection of projects and flood dispatching in water conservancy region, but it is just a tool querying one value from the other one. In fact, storage-elevation curve can represent comprehensively the geomorphic features including vertical section, cross section of the stream and the landform nearby. In this paper, we use quadratic regression equation shaped like y = ax2 + bx + c and the DEM data of Hong-Shi-Mao watershed, Zi Chang County, ShaanXi Province, China to find out the relationship between the coefficients of the equation and the geomorphic features based on VGE platform. It's exciting that the coefficient "a" appear to be correlative strongly with the stream scale, and the coefficient "b" may give an index to the valley shape. In the end, we use a sub-basin named Hao-Jia-Gou of the watershed as an application. The result of correlative research about quadratic regression equation and geomorphic features can save computing and improve the efficiency in silt dam systems planning.

  4. Dynamic Changes Analysis and Hotspots Detection of Land Use in the Central Core Functional Area of Jing-Jin-Ji from 2000 to 2015 Based on Remote Sensing Data

    Yafei Li

    2017-01-01

    Full Text Available The article uses GIS spatial analysis and grid technologies to study the dynamic changes, hotspot regions, and driving forces in land use of the central core functional area of Jing-Jin-Ji. The research results are as follows: from 2000 to 2015, the main types of land use in the central core functional area of Jing-Jin-Ji are cultivated land, woodland, and built-up land. In the period of 2005–2010, the transfer between built-up land and cultivated land was frequent. The dynamic degree of single land use in unused land was highest. It also finds out that the dynamic degree of the integrated land use from 2005 to 2010 was higher. The center of gravity transfer of the dynamic degree of integrated land use was concentrated in research area. As for the hotspots, their number and scope are increasing, and the positions located in the edge of original main urban area and developed transportation network. The main characteristics of land use dynamic change in the study area are the rapid decrease of cultivated land area and rapid growth of built-up land. The spatial agglomeration of economic factors caused by human activities has an important influence on the spatial and temporal dynamic changes of land use.

  5. Augsnes ķīmisko īpašību raksturojums bioloģiski vērtīgajos un daļēji dabiskajos zālājos Vaives pagastā

    Elksnītis, Daniels

    2016-01-01

    Bioloģiski vērtīgos un daļēji dabiskos zālājus būtiski ietekmē augsnes īpašības. No augsnes īpašībām ir atkarīga šo zālāju kvalitāte, apsaimniekošanas veids un līdz ar to arī to sniegtie ekosistēmu pakalpojumi. Bioloģiski vērtīgo un daļēji dabisko zālāju nozīme arvien pieaug, turklāt jau pagājušā gadsimta otrajā pusē sākās strauja to platību samazināšanās gan Latvijā, gan Eiropā kopumā. Tāpēc ir ļoti būtiski noskaidrot bioloģiski vērtīgo zālāju augšņu īpašību ietekmējošos faktorus gan lokālā,...

  6. Pituitary-dependent hyperadrenocorticism in a shi tzu dog treated with twice-daily oral trilostane: a case reportHyperadrenocorticismo hipófise dependente em um cão shi tzu tratado com trilostane oral a cada 12 horas: relato de caso

    Lucas Alécio Gomes

    2012-10-01

    Full Text Available Hyperadrenocorticism can be defined as a chronic high circulating cortisol, and is a relatively common disease in dogs when compared to cats. Of dogs with naturally occurring HAC, 80 to 85% have pituitary-dependent hyperadrenocorticism (PDH, which is an excessive secretion of ACTH by the pituitary, causing bilateral adrenal hyperplasia and excessive secretion of glucocorticoids. More than 90% of dogs with PDH have a pituitary tumor. The aim of this article is to report a case of a dog, seven years old, female, Shi Tzu, that presented with panting, polyuria/polydipsia, polyphagia, pendulous abdomen and bilateral abdominal alopecia, and intermittent weakness in the pelvic limbs. Based on laboratorial and screening tests a pituitary-dependent hyperadrenocorticism was diagnosed and treated with twice-daily trilostane, orally. In the early monitoring period, ACTH test was performed with an unusual interval (to 30 days. In this case, the starting dose didn’t show improvement in the cutaneous alterations, requiring an increase on the dosage. Hiperadrenocorticismo (HAC é uma doença relativamente comum em cães quando comparado aos gatos e pode ser definido como aumento persistente do cortisol na circulação sanguínea. Quanto ao tipo de manifestação o HAC hipófise-dependente ocorre em 80 a 85% dos casos, causando secreção excessiva de ACTH pela hipófise levando ao aumento bilateral das glândulas adrenais. Mais de 90% dos casos de HAC hipófise-dependente (em cães ocorrem devido a tumores na glândula. O objetivo deste trabalho é relatar o caso de uma cadela da raça Shi Tzu, com sete anos de idade, que apresentou respiração ofegante, poliúria/polidipsia, polifagia, abdome pendular, alopecia bilateral simétrica e fraqueza intermitente em membros pélvicos. Os exames laboratoriais de rotina associados aos testes de triagem confirmaram a suspeita de hiperadrenocorticismo hipófise dependente. O tratamento desde o início tem sido com

  7. Prevalence of swallowing and speech problems in daily life after chemoradiation for head and neck cancer based on cut-off scores of the patient-reported outcome measures SWAL-QOL and SHI.

    Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René

    2016-07-01

    The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.

  8. 石氏针药结合治疗急性踝关节扭伤早期疗效研究%Clinical Observation on the Treatment of Acute Ankle Sprain by Shi's Acupuncture Therapy Combined with Compound Zijing Plaster

    李涛; 郭海玲; 杨光月; 商海滨; 赵咏芳

    2017-01-01

    目的:研究石氏针刺结合复方紫荆消伤膏外用治疗急性踝关节扭伤早期症状改善特点,评价石氏针刺结合外用膏药治疗急性踝关节扭伤、弹力绷带固定治疗和功能锻炼治疗的优效性.方法:对上海市浦东新区6家医院2014年1月至2016年10月收治的300例急性踝关节扭伤患者随机分为针药结合治疗组、弹力绷带固定组和功能锻炼组,三组受试者分别予石氏针刺结合膏药外用治疗,弹力绷带固定结合膏药治疗和功能锻炼处方结合膏药治疗.在入组时(入组)、第7天(第1周、访视一)、第28天(第4周、访视二)和第42天(第6周、访视三)采用美国足踝外科学会AOFAS踝后足评分量表、VAS疼痛评分进行优效性评价.结果:三种治疗方法对急性踝关节扭伤均有疗效(P<0.05).在第7天,针药结合组AOFAS评分与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组AOFAS评分高于绷带固定组和功能锻炼组评分.在第7天、第28天针药结合组VAS疼痛评分变化与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组VAS疼痛评分改善大于弹力绷带固定组和功能锻炼组.针药结合组AOFAS疗效评定痊愈率和VAS疼痛疗效评定痊愈率高于绷带固定组和功能锻炼组(P<0.05).结论:石氏针药结合治疗急性踝关节扭伤临床疗效明确,对损伤早期的疼痛改善和功能恢复疗效优于弹力绷带固定治疗和功能锻炼治疗.%Objective:To study the improvement characteristics of early symptoms of acute ankle sprain treated with the Shi's acupuncture therapy combined with compound Zijing plaster,and to evaluate the superiority of the Shi's therapy combined with topical plaster,elastic bandage fixation and functional exercise therapy in the treatment of acute ankle sprain.Methods:All 300 cases of acute ankle sprain patients were randomly assigned to groups of Shi's therapy

  9. Efeitos das mudanças do uso da terra na biogeoquímica dos corpos d'água da bacia do rio Ji-Paraná, Rondônia Effects of land use changes in the biogeochemistry of fluvial systems of the Ji-Paraná river basin, Rondônia

    Alex Vladimir Krusche

    2005-06-01

    Full Text Available Este trabalho discute os efeitos das mudanças do uso do solo na biogequímica dos rios da bacia de drenagem do rio Ji-Paraná (Rondônia. Nesta região, a distribuição espacial do desmatamento e das propriedades do solo resultam em sinais diferentes, possibilitando a divisão dos sistemas fluviais em três grupos: rios com águas pobres em íons e baixo impacto; rios com conteúdo iônico intermediário e impacto médio e rios com elevados conteúdo iônico e impacto antropogênico. As características biogeoquímicas dos rios têm relação significativa com a área de pasto, melhor parâmetro para prever a condutividade elétrica (r² = 0,87 e as concentrações de sódio (r² = 0,75, cloreto (r² = 0,69, potássio (r² = 0,63, fosfato (r² = 0.78, nitrogênio inorgânico (r² = 0.52, carbono inorgânico (r² = 0.81 e carbono orgânico (rain ² = 0.51 dissolvidos. Cálcio e magnésio tiveram sua variância explicada pelas características do solo e pastagem. Nossos resultados indicam que as mudanças observadas na micro-escala constituem "sinais biogeoquímicos" gerados pelo processamento do material nas margens dos rios. A medida em que os rios evoluem para ordens superiores, os sinais persistentes nos canais fluviais estão mais associdados às características da bacia de drenagem (solos e uso da terra. Apesar dos efeitos das mudanças observadas no uso do solo não serem ainda detectáveis na macro-escala (bacia amazônica, a disrupção da estrutura e funcionamento dos ecossistemas é detectável nas micro e meso escalas, com alterações significativas na ciclagem de nutrientes nos ecossistemas fluviais.In this article we present the results of the effects of land use change on the river biogeochemistry of the Ji-Paraná basin (Rondônia. In this region, the spatial distribution of deforestation and soil properties result in different biogeochemical signals, allowing the division of the fluvial systems into three groups: rivers with

  10. USO DA ANÁLISE ESPACIAL PARA AVALIAÇÃO DE INDICADORES DE QUALIDADE DO LEITE NA MICRO-REGIÃO DE JI-PARANÁ, RONDÔNIA, 2011 Use of spatial analys for milk quality indicators evaluation from micro-region of Ji-Paraná, Rondônia, 2011

    Gilvânia Lúcia de Oliveira Carvalho

    2014-06-01

    Full Text Available Os atributos geográficos relacionados à localização dos rebanhos e seus indicadores de qualidade do leite podem ser explorados em termos geoestatísticos para análise e identificação de áreas (territórios com características geográficas semelhantes e providas de correlação espacial para variáveis de interesse. O objetivo do presente estudo foi analisar a viabilidade da análise espacial para avaliação de indicadores de qualidade do leite. O trabalho foi desenvolvido com informações sobre as coordenadas geográficas, teores de gordura, proteína, lactose, contagem de células somáticas (CCS e contagem total de bactérias (CTB de 217 rebanhos localizados no Estado de Rondônia. A área de estudo foi de 25.088,40 km2, localizada na microrregião de Ji-Paraná. A dependência espacial para os indicadores de qualidade do leite foi avaliada por meio de semivariogramas. Havendo dependência espacial, estimaram-se valores do indicador em estudo para os locais não amostrados dentro do espaço, sem tendenciosidade e com variância mínima, pelo método denominado Krigagem, para interpolação de dados. Os resultados mostraram que houve dependência espacial para a gordura, lactose, estrato seco desengordurado (ESD, contagem de células somáticas (CCS e contagem total de bactérias (CTB. Foi observada uma dependência espacial fraca para gordura e ESD. Entretanto, foi identificada uma dependência espacial moderada para lactose, CCS e CTB. Sugere-se que a dependência espacial fraca e moderada encontrada no estudo foi devido ao número de fazendas incluídas no estudo até o momento. Os mapas gerados no estudo mostraram as áreas com valores diferenciados para os indicadores de qualidade do leite. A análise espacial dos indicadores de qualidade do leite mostrou ser uma ferramenta viável para avaliar a variação dos componentes do leite, CCS e CTB entre áreas de uma mesma região. As informações geradas por meio de mapas de

  11. Art Theory or Political Philosophy?---Further Discussion on the Nature of Music Theory by Ji Kang%艺术理论抑或政治哲学?*--嵇康乐论的性质再探讨

    杨杰

    2016-01-01

    学者多认为《声无哀乐论》是一篇艺术理论文献或者音乐美学文献,事实上它是一篇哲学文献。嵇康认为声音只有音阶节奏是否平和的体性,而没有哀乐的属性;哀乐是人的情感属性,平和的音乐只是宣导人本有的哀乐之情。他进一步认为音乐本身也没有德行、功用等“象”。他认为音乐是有教化作用的,首先要实行无为之政的良善政治,使得人心平和,产生平和之乐,二者相互涵养天下才会大治。与儒家以礼乐为主的乐教观不同,嵇康的乐教思想是以人心平和,从而实际上是以无为政治为首要目的的。因此嵇康的音乐理论最终指向的是乐教何以可能的政治哲学问题,《声论》是一篇政治哲学文献。%Most scholars regard No Funeral Music Theory as a literature about art theory or music aes‐thetics ,actually ,it is a literature about political philosophy .Ji Kang thinks that music only has the harmonious melody ,and has nothing to do with the human emotion related to political situation and other circumstances .The point is that grief and joy is the attribute of human emotion ,and the peace‐ful music only a tool to express this emotion .Furthermore ,he put forward that the music itself doesn't have the properties about virtue or function .He held the opinion that music had the function of in‐doctrination ,and we must carry out inaction in governance ,which drives everyone's emotion to a calm ,thus peaceful music being generated ,and the two sides promoting each other can eventually produce a well governed society .Different from Confucian view about music education ,Ji Kang regar‐ded inaction in governance is more important than music education .Therefore ,the finally aim of Ji kang's music theory is the possibility of music education ,which is a political problem ,as a conse‐quence ,No Funeral Music Theory is a literature about political philosophy .

  12. Interneta sociālie tīkli draugiem.lv, mammam/tetiem.lv un twitter.com kā reklāmas nesēji Latvijā (2009.gads)

    Vismane, Inese

    2010-01-01

    Maģistra darba tēma ir „Interneta sociālie tīkli draugiem.lv, mammam/tetiem.lv un twitter.com kā reklāmas nesēji Latvijā (2009.gads)”. Darba mērķis ir izpētīt Latvijas interneta sociālo tīklu vidi kā potenciāli augošu un reklāmai piemērotu, kā arī izpētīt pamanāmākos reklāmas gadījumus šajos portālos. Teorijas daļā tiek apskatīta Web 2.0 ēra, interneta reklāmas un sociālo mediju mārketinga īpatnības, sociālo tīklu fenomens un teorijas, Latvijas reklāmas tirgus un auditorija, kā arī sociāl...

  13. The Impacts of Different PBL Schemes on the Simulation of PM2.5 during Severe Haze Episodes in the Jing-Jin-Ji Region and Its Surroundings in China

    Tian Li

    2016-01-01

    Full Text Available In this study, three schemes [Yonsei University (YSU, Mellor-Yamada-Janjic (MYJ, and Bougeault-Lacarrère (Boulac] were employed in the Weather Research and Forecasting/Chemistry (WRF-Chem model to simulate the severe haze that occurred in February 2014 in the Jing-Jin-Ji region and its surroundings. The PM2.5 concentration simulated using the three schemes, together with the meteorological factors closely related to PM2.5 (wind speed, local vertical diffusivity, and PBL height, was evaluated through comparison with observations. The results indicated that the eastern plain cities produced better simulation results than the western cities, and the cities under the eastern root of Taihang Mountain produced the worst results in simulating high PM2.5 concentration in haze. All three schemes simulated very similar variation trends of the surface PM2.5 concentration compared with observations. The diurnal variations of simulated surface PM2.5 were not as reasonable as their reflection of daily averaged variation. The simulated concentrations of surface PM2.5 using the YSU, MYJ, and Boulac schemes all showed large negative errors during daytime in polluted days due to their inefficient descriptions of local atmospheric stability or diffusion processes in haze. The lower ability of PBL schemes in distinguishing the diffusion between haze and clean days in the complex topography areas in China is an important problem for PM2.5 forecasting, which is worthy of being studied in detail.

  14. [The affinity between Le family of Tong Ren Tang and acu-moxibustion as viewed from Mian xue tang zhen jiu ji cheng (Mian Xuetang's Synthetic Work of Acu-moxibustion)].

    Huang, L X

    2017-11-28

    This compilation process of Mian xue tang zhen jiu ji cheng ( Mian Xuetang ' s Synthetic Work of Acu - moxibustion )was quite mysterious, the book's advent coincidentally met with several major historical events which made its value of decoding its historical functions far beyond its academic value. The editor of this book is Le Xianyang, the founder of Tong Ren Tang. While compiling this book, he also made a replica of Ming-Dynasty's Zhengtong bronze statue. More than 200 years later, Le Jingyu, the 12th generation of the Le family revised Ming Tang Tu inherited from his ancestors and engraved Ming Tang Tu on the stone for its standardization. This great achievement of Le family was no less than the recasting of the Tiansheng bronze statue and the reengraving Tong ren shu xue zhen jiu tu jing ( Illustrated Manual of Acupuncture Points of the Bronze Figure ) by support of state power for building the Beijing Imperial Hospital in the eighth year of the Zhengtong reign (1443).

  15. Sima Qian and His Historical Records

    2003-01-01

    <正> Sima Qian (145-86 BC), a native of Xiayang (now Hancheng, Shaanxi Province), is regarded as China’s greatest historiographer. He is best known for his history book, Historical Records (Shi Ji).Son of Sima Tan, who held the post of the Grand Historian (Tai Shi Ling ) of the Han Dynasty (206 BC-AD 25), Sima

  16. Střípky dějin – brněnské pracoviště Ústavu pro etnografii a folkloristiku ČSAV v korespondenci Karla Vetterla s Jiřím Horákem

    Bahenská, Marie; Jůnová Macková, Adéla

    2017-01-01

    Roč. 9, č. 2 (2017), s. 63-106 ISSN 1803-9448 R&D Projects: GA ČR GA15-03754S Institutional support: RVO:67985921 Keywords : Karel Vetterl * Jiří Horák * history of ethnology Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  17. Japan's healthcare policy for the elderly through the concepts of self-help (Ji-jo), mutual aid (Go-jo), social solidarity care (Kyo-jo), and governmental care (Ko-jo).

    Sudo, Kyoko; Kobayashi, Jun; Noda, Shinichiro; Fukuda, Yoshiharu; Takahashi, Kenzo

    2018-03-18

    Elderly care is an emerging global issue threatening both developed and developing countries. The elderly in Japan increased to 26.7% of the population in 2015, and Japan is classified as a super-aged society. In this article, we introduce the financial aspects of the medical care and welfare services policy for the elderly in Japan. Japan's universal health insurance coverage system has been in place since 1961. Long-term care includes welfare services, which were separated from the medical care insurance scheme in 2000 when Japan was already recognized as an aging society. Since then, the percentage of the population over 65 has increased dramatically, with the productive-age population on the decrease. The Japanese government, therefore, is seeking to implement "The Community-based Integrated Care System" with the aim of building comprehensive up-to-the-end-of-life support services in each community. The system has four proposed elements: self-help (Ji-jo), mutual aid (Go-jo), social solidarity care (Kyo-jo), and government care (Ko-jo). From the financial perspective, as the government struggles against the financial burdens of an aging population, they are considering self-help and mutual aid. Based on Japan's present situation, both elements could lead to positive results. The Japanese government must also entrust the responsibility for implementing preventive support to municipalities through strongly required regional autonomy. As Japan has resolved this new challenge through several discussions over a long period of time, other aging countries could learn from the Japanese experience of solving barriers to healthcare policy for the elderly.

  18. The Militia of Jin-Cha-Ji Border Area in the Anti-Japanese War Period%抗战时期晋察冀边区的民兵

    栾盈菊

    2013-01-01

    晋察冀民兵是在共产党的动员和领导下建立和壮大起来的不脱离生产的群众武装。民兵的任务是进行游击战、配合部队作战和担任抗战勤务。民兵的军事战术有麻雀战、地雷战、地道战、扭击战和伏击战等。在民兵队伍中,由于有党的政治动员、党员的带头作用、有组织的军事政治教育和组织的民主性等原因,民兵成为打败日寇的重要力量,同时民兵也是主力军与游击队的助手,是主力军的重要兵源。%The militia of Jin-Cha-Ji border area was the armed masses without departing from the pro-duction,which was established and grew under the leadership of the Party.Its mission was to carry outguerrilla warfare,cooperate with the troops and act as war service.It had many tactics,such as sparrowwarfare,mine warfare,tunnel warfare,torsional warfare and ambush operation.Due to the Party’s politi-cal mobilization and the Party members’leading role,with organized military and political education anddemocratic nature of the organization,the militia was not only an important force to beat the Japanese,butalso assistant of the main force and the guerrillas,and the important sources for the recruits of the mainforce troops.

  19. Journal of Chemical Sciences | Indian Academy of Sciences

    Home; Journals; Journal of Chemical Sciences. Hai-Liang Zhu. Articles written in Journal of Chemical Sciences. Volume 121 Issue 4 July 2009 pp 463-470. Synthesis, antimicrobial activity of lamotrigine and its ammonium derivatives · Yong Qian Peng-Cheng Lv Lei Shi Rui-Qin Fang Zhong-Cheng Song Hai-Liang Zhu.

  20. Genetic dissection of seed vigour traits in maize (Zea mays L.) under ...

    subjected to cold stress and frequently exhibit poor early- season vigour that ... Yong Shi, Guohui Li and Zhiqiang Tian contributed equally to this work. Yu82 × Shen137 is .... Other vigour-related traits within the three parental lines exhibited no ...

  1. Biological and Clinical Characterization of Novel lncRNAs Associated with Metastatic Prostate Cancer

    2014-10-01

    Matthew K. Iyer, Yang Shi, Xia Jiang, June Escara-Wilke, Rachell Brendenis, Dmitry Borkin, Anastasia K. Yocum, Dattatreya Mellacheruvu, Yuanyuan... Anastasia Yocum, Anton Poliakov, Vishal Kothari, Xiaojun Jing, Harika Gundlapalli, Xuhong Cao, Xiaoju Wang, Rohit Malik, PhD...Yuanyuan Qiao, Anton Poliakov, Anastasia K. Yocum, Yong Li, Wei Chen, Xuhong Cao, Xia Jiang, Arun Dahiya, Clair Harris, Felix Y. Feng, Sundeep Kalantry

  2. Journal of Genetics | Indian Academy of Sciences

    Identification of twelve novel polymorphic microsatellite loci in the severe weed, Stellera chamaejasme L. (Thymelaeaceae) · Yong Hong Zhang Ji Pei Yue Hang Sun · More Details Fulltext PDF. pp e27-e30. Polymorphism of Prophet of Pit-1 gene and its relationship with litter size of Small Tail Han sheep · Qiuyue Liu Caixia ...

  3. Growth characteristics and productivity of cold-tolerant “Kowinearly ...

    Growth characteristics and productivity of cold-tolerant “Kowinearly” Italian ryegrass in the northern part of South Korea. Gi Jun Choi, Hee Chung Ji, Ki-Yong Kim, Hyung Soo Park, Sung Seo, Ki-Won Lee, Sang-Hoon Lee ...

  4. Expression of porcine myosin heavy chain 1 gene in Berkshire loins ...

    Expression of porcine myosin heavy chain 1 gene in Berkshire loins with a high pH24 value. Jin Hun Kang, Woo Young Bang, Eun Jung Kwon, Yong Hwa Lee, Da Hye Park, Eun Seok Cho, Min Ji Kim, Jong-Soon Choi, Hwa Chun Park, Beom Young Park, Chul Wook Kim ...

  5. High frequency plant regeneration from mature seed- derived callus ...

    PRECIOUS

    2009-12-15

    Dec 15, 2009 ... Ki-Won Lee, Gi Jun Choi, Ki-Yong Kim, Hee Chung Ji, Hyung Soo Park, Sei Hyung Yoon and ... Gramineae family plants (Ha et al., 2001; Dong and Qu, ..... Lee SH, Ahsan N, Lee KW, Kim DH, Lee DG, Kwak SS, Kwon SY, ...

  6. Towards the identification of alkaline phosphatase binding ligands in Li-Dan-Hua-Shi pills: A Box-Behnken design optimized affinity selection approach tandem with UHPLC-Q-TOF/MS analysis.

    Tao, Yi; Huang, Surun; Gu, Xianghui; Li, Weidong; Cai, Baochang

    2018-05-30

    Alkaline phosphatase conjugated magnetic microspheres were synthesized via amide reaction, and employed as an effective adsorbent in affinity selection of binding ligands followed by UHPLC-Q-TOF/MS analysis. The analytical validity of the developed approach was evaluated under optimized conditions and the following figures of merit were obtained: linearity, 0.01-0.5 g L -1 with good determination coefficients (R 2  = 0.9992); limits of detection (LODs), 0.003 g L -1 ; and limits of quantitation (LOQ), 0.01 g L -1 . The precision (RSD%) of the proposed affinity selection approach was studied based on intra-day (0.8%) and inter-day (1.3%) precisions. Finally, the adsorbent was successfully applied to identification of binding ligands in Li-Dan-Hua-Shi pills and good recoveries were obtained in the range from 96.9 to 99.4% (RSDs 1.6-3.0%). Copyright © 2018 Elsevier B.V. All rights reserved.

  7. Efficiently and easily integrating differential equations with JiTCODE, JiTCDDE, and JiTCSDE

    Ansmann, Gerrit

    2018-04-01

    We present a family of Python modules for the numerical integration of ordinary, delay, or stochastic differential equations. The key features are that the user enters the derivative symbolically and it is just-in-time-compiled, allowing the user to efficiently integrate differential equations from a higher-level interpreted language. The presented modules are particularly suited for large systems of differential equations such as those used to describe dynamics on complex networks. Through the selected method of input, the presented modules also allow almost complete automatization of the process of estimating regular as well as transversal Lyapunov exponents for ordinary and delay differential equations. We conceptually discuss the modules' design, analyze their performance, and demonstrate their capabilities by application to timely problems.

  8. Kirjastus JI esitles uusi raamatuid / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2009-01-01

    18. veebr. Kirjanike Majas Tallinnas esitleti luulekogusid: Kaus, Jan. Miniatuurid ; fs. Alasti ja elus ; Aru, Toomas F. Tahaks keppi Jääääre saatel, ehk, Georges Charles de Heeckeren d’Anthèsi pihtimus (Pärnu : Jumalikud Ilmutused, 2009)

  9. Implementación de un equipo de laboratorio para la planta piloto de lácteos campus Juan Lunardi, para el análisis de la leche en tres razas de vacas (Holstein, Jersey y Criollas) de la comuna indígena de Shiña-Nabón

    Ascaribay Andrade, Saúl Geovani

    2013-01-01

    El presente trabajo de grado trata sobre la implementación de un equipo de laboratorio para el análisis comparativo de la leche entre tres razas de vacas, (Holstein, Jersey y Criollas), este análisis se lo realizo en la Asociación de Productores Agropecuarios de la comuna indígena de Shiña perteneciente al cantón Nabón provincia del Azuay, los parámetros a ser analizados están basados dentro de las normas técnicas que dicta el INEN, las normas que fueron analizadas fueron: Leche Cruda Requisi...

  10. The SHiP facility at CERN

    AUTHOR|(SzGeCERN)452451

    2016-01-01

    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in dierent theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment and outline the performances of a detector operating at the same facility for the search for the tau --> mu mu mu decay

  11. Coaxing shy particles into an atomic jar

    Hellemans, A

    2000-01-01

    A Dutch-American team claim they can produce anti-hydrogen atoms in far greater quantities than any other current method. They use rubidium ions to trap electrons by applying a pulsed electric field in a series of steps (1 page).

  12. Do talented women shy away from competition?

    Hoyer, Britta; van Huizen, T.M.; Keijzer, L.M.; Rezaei Khavas, T.; Rosenkranz, S.; Westbrock, B.

    2016-01-01

    We study the willingness to compete in a cognitive task among an entire cohort of fresh man business and economics students. Combining data from a lab-in-thefield experiment with university admissions data, we trace the gender gap in competitiveness at different levels of high school performance.

  13. Biased Facial Expression Interpretation in Shy Children

    Kokin, Jessica; Younger, Alastair; Gosselin, Pierre; Vaillancourt, Tracy

    2016-01-01

    The relationship between shyness and the interpretations of the facial expressions of others was examined in a sample of 123 children aged 12 to 14?years. Participants viewed faces displaying happiness, fear, anger, disgust, sadness, surprise, as well as a neutral expression, presented on a computer screen. The children identified each expression…

  14. Preparation and characterization of solid lipid nanoparticles loaded with frankincense and myrrh oil

    Shi F

    2012-04-01

    Full Text Available Feng Shi, Ji-Hui Zhao, Ying Liu, Zhi Wang, Yong-Tai Zhang, Nian-Ping FengSchool of Pharmacy, Shanghai University of Traditional Chinese Medicine, Shanghai, People's Republic of ChinaAbstract: The aim of the present study was to prepare solid lipid nanoparticles (SLNs for the oral delivery of frankincense and myrrh essential oils (FMO. Aqueous dispersions of SLNs were successfully prepared by a high-pressure homogenization method using Compritol 888 ATO as the solid lipid and soybean lecithin and Tween 80 as the surfactants. The properties of the SLNs such as particle size, zeta potential (ZP, and drug encapsulation efficiency (EE were investigated. The morphology of SLNs was observed by transmission electron microscopy (TEM. The crystallinity of the formulation was analyzed by differential scanning calorimetry (DSC and X-ray diffraction (XRD. In addition, drug evaporation release and antitumor activity were also studied. Round SLNs with a mean size of 113.3 ± 3.6 nm, a ZP of -16.8 ± 0.4 mV, and an EE of 80.60% ± 1.11% were obtained. DSC and XRD measurements revealed that less ordered structures were formed in the inner cores of the SLN particles. Evaporation loss of the active components in FMO could be reduced in the SLNs. Furthermore, the SLN formulation increased the antitumor efficacy of FMO in H22-bearing Kunming mice. Hence, the presented SLNs can be used as drug carriers for hydrophobic oil drugs extracted from traditional Chinese medicines.Keywords: solid lipid nanoparticles, frankincense oil, myrrh oil, evaporation release, antitumor activity, traditional Chinese medicine

  15. 从对电视剧《施琅大将军》的争论看 中国文化民族主义复兴的困境 (The Dilemma of Chinese Cultural Nationalism: the Case of the TV Program 'General Shi Lang'

    Mobo Gao

    2007-01-01

    Full Text Available With the rise of China's status on international stage as a result of its economic development there is an increasingly audible voice of Chinese cultural nationalism. More and more educators and intellectuals are calling for the revival of Chinese traditional culture values. However, the very issues of who are the Chinese and what are traditional Chinese cultural values present a huge dilemma. The debates on a recent a TV program "General Shi Lang" consist a good case to illustrate this dilemma. Shi Lang was a general of the last days of the Ming Dynasty, but had surrendered to the Manchu Qing dynasty invaders and fought for the Machus take over Taiwan from a Chinese ruler. The debates show that the dilemma has its cause in at least three issues. First, it is not at all obvious who should be categorized as Chinese. Secondly, it is not at all obvious what Chinese cultural values are. And finally it is the issue of evaluation of traditional values against the universal claim of the values of liberal democracy.

  16. Chemical profiling approach to evaluate the influence of traditional and simplified decoction methods on the holistic quality of Da-Huang-Xiao-Shi decoction using high-performance liquid chromatography coupled with diode-array detection and time-of-flight mass spectrometry.

    Yan, Xuemei; Zhang, Qianying; Feng, Fang

    2016-04-01

    Da-Huang-Xiao-Shi decoction, consisting of Rheum officinale Baill, Mirabilitum, Phellodendron amurense Rupr. and Gardenia jasminoides Ellis, is a traditional Chinese medicine used for the treatment of jaundice. As described in "Jin Kui Yao Lue", a traditional multistep decoction of Da-Huang-Xiao-Shi decoction was required while simplified one-step decoction was used in recent repsorts. To investigate the chemical difference between the decoctions obtained by the traditional and simplified preparations, a sensitive and reliable approach of high-performance liquid chromatography coupled with diode-array detection and electrospray ionization time-of-flight mass spectrometry was established. As a result, a total of 105 compounds were detected and identified. Analysis of the chromatogram profiles of the two decoctions showed that many compounds in the decoction of simplified preparation had changed obviously compared with those in traditional preparation. The changes of constituents would be bound to cause the differences in the therapeutic effects of the two decoctions. The present study demonstrated that certain preparation methods significantly affect the holistic quality of traditional Chinese medicines and the use of a suitable preparation method is crucial for these medicines to produce special clinical curative effect. This research results elucidated the scientific basis of traditional preparation methods in Chinese medicines. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Lin-Na and Yong-Xiu Afr J Tradit Complement Altern Med. (2014) 11 ...

    cadewumi

    Evaluation of anti-athletic fatigue activity of Schizandra chinensis aqueous extracts in mice. Afr J Pharm Pharmacol 3: 593-597. 4. Cao, Y., Hu, Y., Liu, P., Zhao, H.X., Zhou, X.J., and Wei, Y.M. (2012). Effects of a Chinese traditional formula Kai Xin San (KXS) on chronic fatigue syndrome mice induced by forced wheel running ...

  18. The Shi’a Crescent: A Misconception of Shi’a Alliance

    2014-12-01

    Iranian origin to Iran.33 After the Iraq-Iran War started, Saddam’s regime encouraged Iraqi men who were married to Iranian women to divorce their...region, indicating that “The Shi’a point to a pattern of negligence and poverty resulting from discriminatory practices of governments from Ottoman...decreased the authority of the sayyids, who were tribal counselors on marriages, divorces , and inheritances,26 and marked the success of the Sunni

  19. Filtering reaction dynamics using nearside-farside theory and local angular momentum theory: application to the angular scattering of the H + D2(v(i) = 0, j(i) = 0) --> HD(v(f) = 3, j(f) = 0) + D reaction in the energy and time domains.

    Monks, P D D; Connor, J N L; Bouakline, F

    2009-04-23

    We investigate methods for filtering reaction mechanisms in the angular scattering of the state-to-state reaction, H + D(2)(v(i) = 0, j(i) = 0, m(i) = 0) --> HD(v(f) = 3, j(f) = 0, m(f) = 0) + D, where v(i), j(i), and m(i) and v(f), j(f), and m(f) are initial and final vibrational, rotational, and helicity quantum numbers, respectively. The input to our filtrations is a new set of accurate quantum scattering matrix elements for total energies in the range 1.52-2.50 eV (in steps of 0.01 eV) and for total angular momentum quantum numbers in the range, 0-40, in steps of unity. We filter reaction mechanisms in both the energy domain and the time domain. The time-domain calculations employ the plane wave packet formulation of time-dependent scattering. The theoretical tools used are nearside-farside (NF) analysis of partial wave series for scattering amplitudes, together with NF local angular momentum (LAM) theory. An energy-domain LAM analysis reveals the existence of an important dynamical feature in the N scattering, a "trench" which bisects the (energy, angle) plane. We use the location of this trench to approximately filter two reaction mechanisms. Transformation to the time domain demonstrates that the two reaction mechanisms correspond to direct and delayed (by about 25 fs) scattering. Further analysis, including filtration in the time domain, shows that the pronounced LAM trench arises from the interference of the energy-domain analogues of the time-direct and time-delayed scattering. Our theory and results provide the first successful demonstration of reaction mechanism filtering carried out directly in the (energy, angle) domain. The calculations and results in this paper extend and complement earlier research reported by Monks, Connor, and Althorpe (Monks, P. D. D.; Connor, J. N. L.; Althorpe, S. C. J. Phys. Chem. A 2006, 110, 741; J. Phys. Chem. A 2007, 111, 10302).

  20. Changing patient safety culture in China: a case study of an experimental Chinese hospital from a comparative perspective

    Xu XP; Deng DN; Gu YH; Ng CS; Cai X; Xu J; Zhang XS; Ke DG; Yu QH; Chan CK

    2018-01-01

    Xiao Ping Xu,* Dong Ning Deng,* Yong Hong Gu, Chui Shan Ng, Xiao Cai, Jun Xu, Xin Shi Zhang, Dong Ge Ke, Qian Hui Yu, Chi Kuen Chan Clinical Service Department, The University of Hong Kong - Shenzhen Hospital, Shenzhen, Guangdong, People’s Republic of China *These authors contributed equally to this work Background: The World Health Organization highlights that patient safety interventions are not lacking but that the local context affects their successful implementation. Increasing att...

  1. Retraction RETRACTION of "Methylation of the RASSFIA promoter in breast cancer" by Y. Ji, H.H. Jin, M.D. Wang, W.X. Cao, J.L. Bao - Genet. Mol. Res. 15 (2): gmr.15028261 (2016) - DOI: 10.4238/gmr.15028261.

    Ji, Y; Jin, H H; Wang, M D; Cao, W X; Bao, J L

    2016-10-07

    The retracted article is: Ji Y, Jin HH, Wang MD, Cao WX, et al. (2016). Methylation of the RASSFIA promoter in breast cancer. Genet. Mol. Res. 15: gmr.15028261. There are significant parts of this article (particularly, in the discussion section) that are copied from "Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancer is associated with clinical characteristics, but only RASSF1A methylation is associated with outcome", by Jia Xu, Priya B Shetty, Weiwei Feng, Carol Chenault, Robert C Bast Jr, Jean-Pierre J Issa, Susan G Hilsenbeck and Yinhua Yu, published in BMC Cancer 2012; 12: 243. DOI: 10.1186/1471-2407-12-243. The first paragraphs of both discussions are identical. This is concerning. The abstract and introduction sections have much of their text plagiarized. Overall, there is high plagiarism detected. The GMR editorial staff was alerted and after a thorough investigation, we have strong reason to believe that the peer review process was failure and, after review and contacting the authors, the editors of Genetics and Molecular Research decided to retract the article in accordance with the recommendations of the Committee on Publication Ethics (COPE). The authors and their institutions were advised of this serious breach of ethics.

  2. Didaktisko spēļu izmantošana apkārtnes mācību stundās skolēniem ar vidēji smagiem garīgās attīstības traucējumiem

    Zarecka, Tatjana

    2007-01-01

    Diplomarba tēma ir „Didaktisko spēļu izmantošana apkārtnes mācību stundās skolēniem ar vidēji smagiem un smagiem garīgās attīstības traucējumiem”. Pētījuma mērķis: Diplomdarbā teoretiskajā daļā tiek apskatītās pedagoģiskās atziņas par didaktiskajām spēlēm: pedagogus F.Frēbeļa, M.Montesori, K.Ušinska, J.Tihejevas, A.Sorokinas, A.Bondarenko, O.Svenne, I.Kapostas darbu apskats; tiek analizēts terminu „spēle” un „rotaļa” salidzinājums; tiek apskatīta didaktisko spēļu klasifikācija; tiek a...

  3. Semiconductor laser with fresh aloe shi fu and nursing therapy curative effect observation of indwelling needle phlebitis in patients with cerebral apoplexy%半导体激光联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效观察

    王爱丽; 卢琦; 梅现红; 官莉

    2015-01-01

    Objective:To investigate the semiconductor laser combined fresh aloe shi fu and nursing treatment the curative effect of needle phlebitis in patients with cerebral apoplexy. Methods: 66 cases of patients with cerebral stroke with phlebitis, randomly divided into experimental group and the control group, 33 cases each. The control group was treated with fresh aloe shi fu; On the basis of the experimental group in the control group treatment using semiconduc﹣tor laser irradiation in vitro and nursing intervention in the treatment of phlebitis. On two groups before and after the treatment of phlebitis treatment efficient and subjective pain level. Results: The patients with phlebitis treatment effec﹣tive rate of 93. 94% , compared with control group effective rate was 81. 82% (P < 0. 05), the difference was statisti﹣cally significant. The experimental group patients with venous pain level compared with control group (P < 0. 05), the difference was statistically significant. Conclusion: The application of semiconductor laser with fresh aloe shi fu and nursing therapy in patients with cerebral apoplexy phlebitis, can alleviate the pain of the patients with cerebral apo﹣plexy.%探讨半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效。方法:将脑卒中并发静脉炎患者66例,随机分为实验组和对照组,各33例。对照组采用鲜芦荟湿敷方法治疗;实验组在对照组治疗的基础上采用半导体激光体外照射及护理干预治疗静脉炎。对两组治疗前后静脉炎治疗有效率及主观疼痛级别进行比较。结果:实验组患者静脉炎治疗有效率为93.94%,和对照组有效率81.82%相比(P<0.05),差别有统计学意义;实验组患者静脉疼痛级别和对照组相比(P<0.05),差别有统计学意义。结论:应用半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者静脉炎,能减轻脑卒中患者的痛苦。

  4. Diskriminace - jak ji změřit?

    Gembiczká, Adriana

    2010-01-01

    Work describes methods of measuring discrimination in the labour market. All examples are apply to the problem of the gender discrimination. I describe the neoclassical model of discrimination and the statistical discrimination and the work explains how this models try to express the rate of discrimination. In the main part of work I consider Oaxaca model- this model is nowadays in innovated form uses for measuring discrimination most frequently. The work describes the derivation of the model...

  5. Renwushi wenti xuexifa ji guoji hanyu jiaoshi kuawenhua shengrenli fazhan

    Du, Xiangyun; Kirkebæk, Mads Jakob

    2014-01-01

    knowledge of the language, but also, and more importantly, a complex process of creating critical cultural consciousness and developing interculturality through continual self-reflection and constant negotiation with the context in which the students are situated. In the latter part of this paper, we also...

  6. Pemetrexed plus dendritic cells as third-line therapy for metastatic esophageal squamous cell carcinoma

    Zhang B

    2016-06-01

    Full Text Available Bin Zhang,1,* Rui Li,2,3,* Chun-Xiao Chang,2,3 Yong Han,2,3 Sheng-Bin Shi,2,3 Jing Tian2,3 1Department of Medical Oncology, Shandong Ji Ning First People’s Hospital, 2Department of Medical Oncology, Shandong Cancer Hospital, Shandong University, Shandong 3Department of Medical Oncology, Shandong Cancer Hospital and Institute, Shandong Academy of Medical Sciences, Jinan, People’s Republic of China*These authors contributed equally to this workAbstract: This study was conducted to evaluate the toxicity and efficacy of pemetrexed plus dendritic cells (DCs when administered as third-line treatment for metastatic esophageal squamous cell carcinoma (ESCC. All patients in the study group had previously failed first-line treatment with 5-fluorouracil and cisplatin-based regimens, as well as second-line treatment with taxane-based regimens. A total of 31 patients were treated with pemetrexed (500 mg/m2 plus DCs on day 1, every 3 weeks. DCs were given for one cycle of 21 days. Thirty patients were evaluated for their response. No patient had a complete response, three patients (10.0% had a partial response, ten patients (33.3% had stable disease, and 17 patients (56.7% had progressive disease. The overall response rate was 10.0%. The median progression-free survival (PFS time was 2.9 months (95% CI, 2.7–3.2, and the median overall survival (OS time was 7.1 months (95% CI, 6.4–7.9. The median PFS and OS times among patients with high and low levels of miR-143 expression in their blood serum were significantly different: median PFS times =3.2 months (95% CI, 2.9–3.4 and 2.7 months (95% CI, 2.4–3.0, respectively (P=0.017, and median OS times =7.8 months (95% CI, 6.8–8.9 and 6.3 months (95% CI, 5.3–7.3, respectively (P=0.036. No patient experienced Grade 4 toxicity. Combined third-line treatment with pemetrexed and DCs was marginally effective and well tolerated in patients with advanced ESCC. Serum miR-143 levels are a potential

  7. Shifts in the pelagic ammonia-oxidizing microbial communities along the eutrophic estuary of Yong River in Ningbo City, China

    Zhang, Qiufang; Tang, Fang-Yuan; Zhou, Yang-Jing; Xu, Jirong; Chen, Heping; Wang, Ming-Juang; Laanbroek, H.J.

    2015-01-01

    BACKGROUND: Aerobic ammonia oxidation plays a key role in the nitrogen cycle, and the diversity of the responsible microorganisms is regulated by environmental factors. Abundance and composition of ammonia-oxidizing archaea (AOA) and ammonia-oxidizing bacteria (AOB) were investigated in the surface

  8. Regional Implications of Shi’a Revival in Iraq

    2004-01-01

    From the marshes of southern Iraq to the ghettoes of Karachi, the Shi‘a have been the underdogs —oppressed and marginalized by Sunni ruling regimes and...former with “true” Is- lam—and their governments as its defenders—and branding the latter as obscurantist extremism. They dismissed Khomeini as Shi‘a... branding his vitriol against the House of Saud in the 1980s as fitna (illegitimate rebellion and sowing of disunity) against the Muslim community.7

  9. Search for heavy sterile neutrinos with SHiP

    Jacobsson, Richard

    Invited contribution to the White Paper on keV sterile neutrino Dark Matter as proceedings of the v-Dark 2015 international workshop which was held at the Institute for Advanced Study of the Technical University of Munich, Garching, Germany, 7 - 9 December 2015. White Paper will be submitted to JCAP.

  10. Iranian Influence in Iraqi Shi’a Groups

    2012-06-01

    Movement in Iraq, 254. 60 Jabar, The Shīʻite Movement in Iraq, 254. 61 Robert Fisk, The Great War For Civilisation : the Conquest of the Middle East...by Iran in 62 Fisk, The Great War For Civilisation : the Conquest of the Middle East, 647. 63 John...U.S. soldier missing in Iraq. AAH sources indicated that the group was not behind the killing but rather just mediators in the process of returning

  11. Sunni and Shi’a Terrorism: Differences that Matter

    2008-12-29

    Upon the United States (Washington, DC: St. Martin’s Press, 2004), 88‐89.  The  report’s  language  was curiously qualified when discussing the Iranian...such a tactic cannot be ruled out in the future.  84 Poland, the Czech Republic, the  Slovak  Republic...Democratic Front for the Liberation of Palestine (DFLP)*    Hamas*    Iranian Extremists/Militants – Kuwait ( label  applied by Sunni Kuwait  government

  12. Dicty_cDB: SHI783 [Dicty_cDB

    Full Text Available 34, mRNA sequence. 42 5.0 1 DV288069 |DV288069.1 NAAHW80TF Aedes aegypti - Fat Bodie...583TR Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0... 1 DV284076 |DV284076.1 NAAG583TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) ...Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0 1 DV276964 |DV276964.1 NAAFQ66TR Aedes aegypti - Fat Bodie...AAFQ66TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAFQ66, mRNA sequence. 42

  13. Dicty_cDB: SHI292 [Dicty_cDB

    Full Text Available nt alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 106 4e-22 BC1384...82_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 104 2e-21 (Q9JLC8) RecName: Full=Sacsi

  14. Multiple System Atrophy with Orthostatic Hypotension (Shy-Drager Syndrome)

    ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. x ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. View ...

  15. Dicty_cDB: SHI734 [Dicty_cDB

    Full Text Available ESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHALTNSIQDAVV RYHRMKG*slfmgtryrscrycnts...KQEAEEKIVREHIEKILKTPKGEKKDVSSLLSSYHPTAV ESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHALTNSIQDAVV RYHRMKG*slfmgtryrscrycnts

  16. Once hurt, twice shy: Social pain contributes to social anxiety.

    Fung, Klint; Alden, Lynn E

    2017-03-01

    Social rejection has been consistently linked to the development of social anxiety. However, mechanisms underlying the relation have been largely unexplored, which presents an obstacle to fully understanding the origins of social anxiety and to the development of effective prevention and treatment strategies. Two studies were conducted to test the hypothesis that the emotion of social pain following rejection promotes the development of social anxiety in subsequent situations. In Study 1, undergraduate participants were exposed to 2 social situations (Cyberball) 2 days apart. Participants who were rejected in the first situation reported higher social anxiety before and during the second situation relative to those who were included. This effect was fully mediated by initial social pain intensity. In Study 2, all participants were initially rejected. Using double-blinded drug administration, participants were randomly assigned to ingest acetaminophen to alleviate the social pain from rejection, or a sugar placebo. As predicted, the acetaminophen group reported lower social anxiety before and during the second situation. Approximately half of the effect was mediated by reduction in social pain. Notably, the immediate effect of acetaminophen was specific to social pain rather than social anxiety. Results were discussed in the context of literature on the etiology of social anxiety and social pain. Future directions were suggested. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  17. Dicty_cDB: SHI133 [Dicty_cDB

    Full Text Available 044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering ...Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50... 0.068 1 CR034434 |CR034434.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPP142o16. 50 0.068 1 BX990136 |B...X990136.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHP

  18. Dicty_cDB: SHI542 [Dicty_cDB

    Full Text Available . 42 8.2 1 CR129751 |CR129751.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPN147m24. 42 8.2 1 CR010531 |CR010531.1 Reverse strand read... from insert in 5'HPRT insertion targeting and chromosome engineering clone MHPN2...17j13. 42 8.2 1 CR103480 |CR103480.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering

  19. SHI induced damage in electrical properties of silicon NPN BJTs

    Kumar, M. Vinay, E-mail: vkm288@gmail.com; Krishnaveni, S. [Department of studies in Physics, University of Mysore, Mysore (India); Kumar, Santhosh [Department of Physics, Regional Institute of Education, Mysore (India); Yashoda, T. [Department of Physics, AVK College for Women, Hassan (India)

    2016-05-23

    The investigation of radiation damage in Si microelectronic circuitry and devices are being carried out by various research groups globally. In particular the Si Bipolar junction transistors are very sensitive to high energetic radiation. In the present study, radiation response of NPN Bipolar junction transistor (2N3773) has been examined for 60 MeV B{sup 4+} ion. Key electrical properties like Gummel, dc current gain and capacitance – voltage (C-V) characteristics of 60 MeV B{sup 4+} ion irradiated transistor were studied before and after irradiation. Ion irradiation and subsequent electrical characterizations were performed at room temperature. Current voltage (I-V) measurements showed the increase in collector current for V{sub BE} ≤ 0.4 V as a function of fluence, which is due to B{sup 4+} ion induced surface leakage currents. Base current is observed to be more sensitive than collector current and gain appears to be degraded with ion fluence. Also, C-V measurements shows that both built in potential and doping concentration increased significantly after irradiation.

  20. Investigating AAK1-and GAK-Regulated Virus-Host Interactions Uncovers Broad-Spectrum Antivirals

    2017-02-16

    AP1) and AP2M1 (AP2) were 527 selected from the Human ORFeome library of cDNA clones (65) (Open Biosystems) and 528 recombined into either pCherry...TSV01 Renilla reporter plasmid was a gift from Pei-Yong Shi (68). 534 Lentiviral constructs used for AP2 overexpression were cloned into the pRRLSIN...681 total of 10 days and observed daily for 28 days for lethality or clinical signs of disease. 682 683 Animal study approval/ Ethics Statement

  1. Enhanced immunization via dissolving microneedle array-based delivery system incorporating subunit vaccine and saponin adjuvant

    Zhao,JiHui; Zhang,Qi-Bo; Liu,Bao; Piao,Xiang-Hua; Yan,Yu-Lu; Hu,Xiao-Ge; Zhou,Kuan; Zhang,Yong-Tai; Feng,Nian-Ping

    2017-01-01

    Ji-Hui Zhao,1,* Qi-Bo Zhang,1,* Bao Liu,2 Xiang-Hua Piao,1 Yu-Lu Yan,1 Xiao-Ge Hu,1 Kuan Zhou,1 Yong-Tai Zhang,1 Nian-Ping Feng1 1School of Pharmacy, Shanghai University of Traditional Chinese Medicine, Shanghai, People’s Republic of China; 2Anethesiology Department, Augusta University, Augusta, GA, USA *These authors contributed equally to this work Purpose: To enhance the immunogenicity of the model subunit vaccine, ovalbumin (OVA) was combined with platycodin (PD), a ...

  2. Modulation of epithelial sodium channel in human alveolar epithelial ...

    Modulation of epithelial sodium channel in human alveolar epithelial cells by lipoxin A4 through AhR-cAMP-dependent pathway. Bi-Huan Cheng1,2, Li-Wei Pan2, Sheng-Rong Zhang3, Bin-Yu Ying2, Ben-Ji. Wang2, Guo-Liang Lin2 and Shi-Fang Ding1*. 1Department of Critical Care Medicine, Qilu Hospital of Shandong ...

  3. The satisfaction level of indigenous people towards planned housing development. Case study: Orang Asli Kg. Sejagong, Sri Medan, Yong Peng Johor

    Kamaruddin, S. M.; Zaini, N. S.; Misni, A.; Ahmad, P.

    2018-02-01

    Orang Asli possesses a unique relationship with their traditional land. Indigenous people have their thoughts on development, life values, visions, needs, and priorities. The government through Department of Orang Asli Development or Jabatan Kebajikan Orang Asli (JAKOA) implemented various development programs such as structured settlement program, physical improvements such as Regrouping Plan (RPS), Village Restructuring project (PSK), New Village Plan (RKB) and Orang Asli settlement customary Land Survey (village) / Land Acquisition. Orang Asli Community. However, their sense of satisfaction towards the development implemented is rarely evaluated. This paper aims to highlight Orang Asli’s thoughts and level of satisfaction towards the planned housing development of their settlement. A mixed methodology was employed using survey and interview to record their thoughts. The findings suggest that the Orang Asli Community’s sense of satisfaction towards housing development has improved. However, their needs to adhere to their social traditions and norms such as living adjacent to relatives, surrounded by nature within a low-density environment must be respected.

  4. Regional new energy vision formulated for Murakami City; 2001 nendo Murakami shi chiiki shin energy vision sakutei tou jigyo. Murakami shi shin energy puran

    NONE

    2002-03-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Murakami City, Niigata Prefecture, surveys and studies were conducted involving energy consumption in the town, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The annual energy consumption of the city is estimated at 78,000 kL in terms of oil. The residential/commercial sector consumes 24,000 kL, the industrial sector 28,000 kL, and the transportation sector 26,000 kL, with the three sectors demanding similar amounts. The carbon dioxide emitted by the sectors is estimated at 223,000 t-CO2/year. New energy introduction projects were discussed, which included hot water supply, heating, road heating, and power generation, all these utilizing heat from the Senami hot spa; biogas fueled power generation and BDF (bio-diesel) bus operation in the Senami hot spa district; the introduction of a hybrid wind power/photovoltaic power generation system into Ogata Seaside Park; the introduction of a mini-scale hydroelectric power generation system into the Kamikaifu district; a large-scale wind power generation business at the Iwafune district; the introduction of wind power and photovoltaic power generation facilities into primary and junior high schools; the use of clean energy vehicles for official use; and so forth. (NEDO)

  5. San luo xuan mo xing ji qi liang hua fen zhi fang fa yan tao

    Ye, Y.; Leydesdorff, L.; Wu, Y.

    2014-01-01

    A discussed study on the Triple Helix with its quantitative analysis method. With brief introduction to background and progress of Triple-Helix(TH) researches, it is clarified that TH quantitative methodology focuses on the indicator of synergy (T) as reduction of uncertainty that can be shaped

  6. Climate change and JI options for India - a carbon-sink approach

    Kadekodi, G.K.

    1995-01-01

    Three approaches to producing carbon dioxide arising from the Framework Convention on Climate Change are discussed. These are emission cap approach, fiscal or carbon tax and joint implementation. These are examined from an Indian perspective. More work on the economic, sociological and political aspects is recommended. (UK)

  7. VizieR Online Data Catalog: Ji light curves of WTS-2 (Birkby+, 2014)

    Birkby, J. L.; Cappetta, M.; Cruz, P.; Koppenhoefer, J.; Ivanyuk, O.; Mustill, A. J.; Hodgkin, S. T.; Pinfield, D. J.; Sipocz, B.; Kovacs, G.; Saglia, R.; Pavlenko, Y.; Barrado, D.; Bayo, A.; Campbell, D.; Catalan, S.; Fossati, L.; Galvez-Ortiz, M.-C.; Kenworthy, M.; Lillo-Box, J.; Martin, E. L.; Mislis, D.; de Mooij, E. J. W.; Nefs, S. V.; Snellen, I. A. G.; Stoev, H.; Zendejas, J.; Del Burgo, C.; Barnes, J.; Goulding, N.; Haswell, C. A.; Kuznetsov, M.; Lodieu, N.; Murgas, F.; Palle, E.; Solano, E.; Steele, P.; Tata, R.

    2015-07-01

    The infrared light curves of the WTS were generated from time series photometry taken with the WFCAM imager mounted at the prime focus of UKIRT. In order to confirm the transit of WTS-2 b and to help constrain the transit model, on 2010 July 18 we obtained further time series photometry in the Sloan i band using the Wide Field Camera (WFC) on the 2.5m Isaac Newton Telescope (INT) at Roque de Los Muchachos, La Palma. (2 data files).

  8. ISEll'$?,l'iifilfi WAtJiE~G®NTR*OiLit.,IED

    transistor TRI (2N3773), which controls the electronic switch unit. The capacitor C3. (470pF) is placed at the output of the rectifier to smoothen the rectified signal and maintain an effective trigger voltage for the transistor. TR1. Electronic Switch. The electronic switch is basically controlled by the transistor TR1 and the electro-.

  9. Ji Zhaojin, A History of Modern Shanghai Banking. The Rise and Decline of China Finance Capitalism

    Bergère, Marie-Claire

    2006-01-01

    To attempt a 260-page summary of the history of the Chinese and foreign banks in Shanghai over a whole century (1842-1952) is an extremely ambitious project. This was a historical epoch dominated by complex financial and monetary structures, and agitated by political developments—civil and foreign wars, imperialist penetration, nationalist reactions and revolutionary crises—, an epoch which appears as both a phase in China’s modernisation and an episode in the expansion of international capit...

  10. Jižní Sachalin: Rusko, Japonsko, SSSR/Rusko

    Kolejka, Jaromír

    2013-01-01

    Roč. 127, č. 3 (2013), s. 1-5 ISSN 1214-083X Institutional support: RVO:68145535 Keywords : Karafuto * history * economy * population * present state Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://zemces.sweb.cz/cislo127.htm

  11. Lik Božji u romanu Derviš i smrt

    Birviš, Aleksandar

    1989-01-01

    This article analyzes the novel Dervish and Death, the best-known work by the Bosnian-Hercegovian author Meša Selimović, which draws heavily upon Islamic religion and traditions. In this analysis, the similarities and differences between the Islamic and Christian perceptions of God and God's persona are noted.

  12. Korespondence T. G. Masaryka s jižními Slovany

    Hladký, Ladislav

    2016-01-01

    Roč. 20, č. 1 (2016), s. 659-663 ISSN 1450-5061 Institutional support: RVO:67985963 Keywords : T. G. Masaryk * south Slavs * correspondence * Czechoslovak-Yugoslav relations * Czechoslovak-Bulgarian relations Subject RIV: AB - History OBOR OECD: History (history of science and technology to be 6.3, history of specific sciences to be under the respective headings)

  13. O jazyku a stylu korespondence Jiřího Voskovce a Jana Wericha

    Hoffmannová, Jana; Štícha, František

    2012-01-01

    Roč. 3, č. 5 (2012), s. 3-33 ISSN 1804-137X R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : correspondence * dialogue stylistics * intertextuality * linguistic playfulness Subject RIV: AI - Linguistics

  14. Jiří Bičák oslavil sedmdesátiny

    Balek, V.; Dvořák, L.; Hadrava, Petr; Heyrovský, D.; Karas, Vladimír; Krtouš, P.; Ledvinka, T.; Pravda, Vojtěch; Pravdová, Alena; Podolský, J.; Semerák, O.; Stuchlík, Z.; Vokrouhlický, D.; Žofka, M.

    2012-01-01

    Roč. 62, č. 1 (2012), s. 64-65 ISSN 0009-0700 Institutional research plan: CEZ:AV0Z10030501 Keywords : black holes * general relativity Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  15. Dějin Ruska se již bát nemusíme

    Nykl, Hanuš

    2017-01-01

    Roč. 30, 26.08.2017 (2017), IX/25 ISSN 0862-5921 Institutional support: RVO:68378017 Keywords : historiography * Russia * history Subject RIV: AB - History OBOR OECD: Philosophy, History and Philosophy of science and technology

  16. On-call x-rays made easy AN Au-Yong On-call x-rays made easy , Amy Au-Yong and Nigel Broderick Churchill Livingstone Elsevier £21.99 304pp 9780702034459 0702034452 [Formula: see text].

    2011-02-10

    DesigneD for clinicians involved in the management of acutely ill patients, this book enables them to recognise quickly the appearance of life-threatening conditions. It also concentrates on the interpretation of plain chest and abdominal images.

  17. ACCORDING TO HWC ON TURKISH WORDS ADOPTED FROM CHINE LANGUAGE / HANYU WAILAICI CIDIAN’a (HWC GÖRE ÇİNCEYE GEÇEN TÜRKÇE KELİMELER ÜZERİNE

    Prof. Dr. Alimcan İNAYET

    2008-02-01

    Full Text Available Today, there exist thousands of loan words in Chinese language. Chinese linguists -Liu Zheng-yan, Gao Ming-kai, Mai Yong-qian and Shi You-wei- have determined ten thousand loan-words (with the different versions of the same word adopted by Chinese from various languages and published them in “A Dictionary of Loan Words and Hybrid Words in Chinese” in 1984. Among the considered words of this dictionary, there are also hundreds of words which were directly and indirectly adopted from Turkish language and Turkic dialects in various eras. Additionally, some of them are still be in use in Chinese language today. In this article, we have listed those Turkish words determined in this dictionary with the necessary explanations attached.

  18. Analysis of the Chinese martial periodicals edited during the Republican Era

    William Acevedo

    2012-07-01

    Full Text Available The present article studies the periodicals and magazines published during the Chinese Republican period (1912-1949. The main sources for this work are the index and thirty volumes of the Republican Era Collection of National Arts Periodicals (Mingguo Guoshu Qi Kan Wenxian Jicheng, edited by Shi Yong Xing in 2008. Besides basic data about the 45 publications included in the collection such as title, editor, publication information and period of existence; this article emphasises the historical context in which these publications appeared as well as their efforts to help China becoming a nation recognized at the world stage. As an example of the wealth of information contained in these periodicals regarding Chinese martial arts, we have analyzed the terminology that was used to define them, the publications’ contribution to exalt nationalism up to their influence in strengthening of China’s citizens and military.

  19. Nanobiomaterials development and applications

    Papaefthymiou-Davis, Georgia C

    2013-01-01

    Nanomaterials in Nanobiotechnologies: Preparation, Characterization, and ApplicationsBio-Inspired Magnetic NanoparticlesGeorgia C. Papaefthymiou and Eamonn DevlinNanoparticles for BioimagingHye Sun Park and Yong Taik LimBiomedical Applications of Dendrimer Porphyrin or PhthalocyanineWoo-Dong Jang and Won-Gun KohPolymeric Nanoparticles in Cancer TherapyHeebeom Koo, Ji Young Yhee, Ick Chan Kwon, Kwangmeyung Kim, and Ramesh SubbiahCarbon Nanotube BioconjugatesMonica Samal, Dong Kee Yi, and Shashadhar SamalBiocatalytic NanosystemsJaehong Lim and Su Seong LeeMagnetically Induced Hyperthermia for Biomedical ApplicationsMichael Fardis, Ioannis Rabias, Georgios Diamantopoulos, Eleni Karakosta, Danai Tsitrouli, Vassilios Tzitzios, and Georgios PapavassiliouSoft Block Nanobuilding: New Preparation Routes of Soft Nanomaterials Using BiomoleculesEngineered Biomolecules as NanomaterialsYun Jung Lee and Ki Tae NamNanomaterials and Bio-MEMS: Nano- and Microscale Hybridization of Materials and ApplicationsMicrofluidic-Based ...

  20. Status and physics of the SHiP experiment at CERN

    Buonaura, Annarita

    2017-01-01

    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...

  1. New energy vision of the Gotsu city area; 2001 nendo Gotsu shi chiiki shin energy vision

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Gotsu City, Shimane Prefecture, an investigational study was conducted of the energy consumption amount of the city, existence amount of new energy, project for new energy introduction, etc., and a new energy vision was worked out. The energy consumption amount of the city was estimated at 1,558,022 Gcal. By sector, the energy consumption amount consisted of 80.0% in the industrial sector, 11.2% of in the transportation sector, 5.8% in the residential sector and 3.0% in the business sector. In the industrial sector, the main energy consumption industries were the paper manufacturing industry and tile industry. As the project for new energy introduction, the following were studied: project for the wind farm where a lot of wind power generators are installed; park as a symbol having 1 or 2 wind power generators; introduction of solar energy use water warmer/photovoltaic power generation to public facilities; system for promotion of the introduction of solar energy use water warmer/photovoltaic power generation to households; project on CO2 reduction by installation of LNG station; refuse/waste power generation project; project on utilization of the waste heat from tile makers. (NEDO)

  2. Do Women Shy Away From Competition? Do Men Compete Too Much?

    Muriel Niederle; Lise Vesterlund

    2005-01-01

    Competitive high ranking positions are largely occupied by men, and women remain scarce in engineering and sciences. Explanations for these occupational differences focus on discrimination and preferences for work hours and field of study. We examine if absent these factors gender differences in occupations may still occur. Specifically we explore whether women and men, on a leveled playing field, differ in their selection into competitive environments. Men and women in a laboratory experimen...

  3. Learning from the Stones: A Go Approach to Mastering China's Strategic Concept, Shi

    Lai, David

    2004-01-01

    .... It is through learning the Chinese board game called go. This game is a living reflection of Chinese philosophy, culture, strategic thinking, warfare, military tactics, and diplomatic bargaining...

  4. The beam test of muon detector parameters for the SHiP experiment at CERN

    Likhacheva, V. L.; Kudenko, Yu. G.; Mefodiev, A. V.; Mineev, O. V.; Khotyantsev, A. N.

    2018-01-01

    Scintillation detectors based on extruded plastics have been tested in a 10 GeV/c beam at CERN. The scintillation signal readout was provided using optical wavelength shifting fibers Y11 Kuraray and Hamamatsu MPPC micropixel avalanche photodiodes. The light yield was scanned along and across the detectors. Time resolution was found by fitting the MPPC digitized pulse rise and other methods.

  5. A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    Anelli, M.; Arduini, G.; Back, J.J.; Bagulya, A.; Baldini, W.; Baranov, A.; Barker, G.J.; Barsuk, S.; Battistin, M.; Bauche, J.; Bay, A.; Bayliss, V.; Bellagamba, L.; Bencivenni, G.; Bertani, M.; Bezshyyko, O.; Bick, D.; Bingefors, N.; Blondel, A.; Bogomilov, M.; Boyarsky, A.; Bonacorsi, D.; Bondarenko, D.; Bonivento, W.; Borburgh, J.; Bradshaw, T.; Brenner, R.; Breton, D.; Brook, N.; Bruschi, M.; Buonaura, A.; Buontempo, S.; Cadeddu, S.; Calcaterra, A.; Calviani, M.; Campanelli, M.; Capoccia, C.; Cecchetti, A.; Chatterjee, A.; Chauveau, J.; Chepurnov, A.; Chernyavskiy, M.; Ciambrone, P.; Cicalo, C.; Conti, G.; Cornelis, K.; Courthold, M.; Dallavalle, M.G.; D'Ambrosio, N.; De Lellis, G.; De Serio, M.; Dedenko, L.; Di Crescenzo, A.; Di Marco, N.; Dib, C.; Dietrich, J.; Dijkstra, H.; Domenici, D.; Donskov, S.; Druzhkin, D.; Ebert, J.; Egede, U.; Egorov, A.; Egorychev, V.; Alaoui, M. A. El; Enik, T.; Etenko, A.; Fabbri, F.; Fabbri, L.; Fedorova, G.; Felici, G.; Ferro-Luzzi, M.; Fini, R.A.; Franke, M.; Fraser, M.; Galati, G.; Giacobbe, B.; Goddard, B.; Golinka-Bezshyyko, L.; Golubkov, D.; Golutvin, A.; Gorbunov, D.; Graverini, E.; Grenard, J-L; Guler, A.M.; Hagner, C.; Hakobyan, H.; Helo, J.C.; van Herwijnen, E.; Horvath, D.; Iacovacci, M.; Iaselli, G.; Jacobsson, R.; Kadenko, I.; Kamiscioglu, M.; Kamiscioglu, C.; Khaustov, G.; Khotjansev, A.; Kilminster, B.; Kim, V.; Kitagawa, N.; Kodama, K.; Kolesnikov, A.; Kolev, D.; Komatsu, M.; Konovalova, N.; Koretskiy, S.; Korolko, I.; Korzenev, A.; Kovalenko, S.; Kudenko, Y.; Kuznetsova, E.; Lacker, H.; Lai, A.; Lanfranchi, G.; Lauria, A.; Lebbolo, H.; Levy, J. -M.; Lista, L.; Loverre, P.; Lukiashin, A.; Lyubovitskij, V.E.; Malinin, A.; Manfredi, M.; Perillo-Marcone, A.; Marrone, A.; Matev, R.; Messomo, E.N.; Mermod, P.; Mikado, S.; Mikhaylov, Yu.; Miller, J.; Milstead, D.; Mineev, O.; Mingazheva, R.; Mitselmakher, G.; Miyanishi, M.; Monacelli, P.; Montanari, A.; Montesi, M.C.; Morello, G.; Morishima, K.; Movtchan, S.; Murzin, V.; Naganawa, N.; Naka, T.; Nakamura, M.; Nakano, T.; Nurakhov, N.; Obinyakov, B.; Ocalan, K.; Ogawa, S.; Oreshkin, V.; Orlov, A.; Osborne, J.; Pacholek, P.; Panman, J.; Paoloni, A.; Paparella, L.; Pastore, A.; Patel, M.; Petridis, K.; Petrushin, M.; Poli-Lener, M.; Polukhina, N.; Polyakov, V.; Prokudin, M.; Puddu, G.; Pupilli, F.; Rademakers, F.; Rakai, A.; Rawlings, T.; Redi, F.; Ricciardi, S.; Rinaldesi, R.; Roganova, T.; Rogozhnikov, A.; Rokujo, H.; Romaniouk, A.; Rosa, G.; Rostovtseva, I.; Rovelli, T.; Ruchayskiy, O.; Ruf, T.; Saitta, G.; Samoylenko, V.; Samsonov, V.; Ull, A. Sanz; Saputi, A.; Sato, O.; Schmidt-Parzefall, W.; Serra, N.; Sgobba, S.; Shaposhnikov, M.; Shatalov, P.; Shaykhiev, A.; Shchutska, L.; Shevchenko, V.; Shibuya, H.; Shitov, Y.; Silverstein, S.; Simone, S.; Skorokhvatov, M.; Smirnov, S.; Solodko, E.; Sosnovtsev, V.; Spighi, R.; Spinetti, M.; Starkov, N.; Storaci, B.; Strabel, C.; Strolin, P.; Takahashi, S.; Teterin, P.; Tioukov, V.; Tommasini, D.; Treille, D.; Tsenov, R.; Tshchedrina, T.; Ustyuzhanin, A.; Vannucci, F.; Venturi, V.; Villa, M.; Vincke, Heinz; Vincke, Helmut; Vladymyrov, M.; Xella, S.; Yalvac, M.; Yershov, N.; Yilmaz, D.; Yilmazer, A.U.; Vankova-Kirilova, G.; Zaitsev, Y.; Zoccoli, A.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2015-01-01

    A new general purpose fixed target facility is proposed at the CERN SPS accelerator which is aimed at exploring the domain of hidden particles and make measurements with tau neutrinos. Hidden particles are predicted by a large number of models beyond the Standard Model. The high intensity of the SPS 400~GeV beam allows probing a wide variety of models containing light long-lived exotic particles with masses below ${\\cal O}$(10)~GeV/c$^2$, including very weakly interacting low-energy SUSY states. The experimental programme of the proposed facility is capable of being extended in the future, e.g. to include direct searches for Dark Matter and Lepton Flavour Violation. The facility will be serviced by a new dedicated beam line branched off the splitter section on the North Area. It is followed by a new target station and a magnetic shield to suppress beam induced background. The proposed orientation of the beam line and the underground complex allows reserving more than 100~m of space beyond the experiment...

  6. Development of a Summarized Health Index (SHI) for Use in Predicting Survival in Sea Turtles

    Li, Tsung-Hsien; Chang, Chao-Chin; Cheng, I-Jiunn; Lin, Suen-Chuain

    2015-01-01

    Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD) and sea turtle surviving (p turtles had significantly higher levels of aspartate aminotranspherase (AST), creatinine kinase (CK), creatinine and uric acid (UA) than surviving sea turtles (all p turtles and to improve veterinary care at rehabilitation facilities. PMID:25803431

  7. Shy Children Are Less Sensitive to Some Cues to Facial Recognition

    Brunet, Paul M.; Mondloch, Catherine J.; Schmidt, Louis A.

    2010-01-01

    Temperamental shyness in children is characterized by avoidance of faces and eye contact, beginning in infancy. We conducted two studies to determine whether temperamental shyness was associated with deficits in sensitivity to some cues to facial identity. In Study 1, 40 typically developing 10-year-old children made same/different judgments about…

  8. SI-SHY: Dysregulated Fear in Toddlerhood Predicts Kindergarten Social Withdrawal through Protective Parenting.

    Kiel, Elizabeth J; Buss, Kristin A

    2014-05-01

    Two recent advances in the study of fearful temperament (behavioral inhibition) include the validation of dysregulated fear as a temperamental construct that more specifically predicts later social withdrawal and anxiety, and the use of conceptual and statistical models that place parenting as a mechanism of development from temperament to these outcomes. The current study further advances these areas by examining whether protective parenting mediated the relation between dysregulated fear in toddlerhood and social withdrawal in kindergarten. Participants included 93 toddlers and their mothers, who engaged in laboratory tasks assessing traditional fearful temperament, dysregulated fear, and protective parenting. When children reached kindergarten, they returned to the laboratory for a multimethod assessment of social withdrawal. Results confirmed the hypothesis that dysregulated fear predicted social withdrawal through protective parenting, and this occurred above and beyond the effect of traditional fearful temperament. These findings bolster support for the use of dysregulated fear as a temperamental construct related to, but perhaps more discerning of risk than traditionally measured fearful temperament/behavioral inhibition and highlight the importance of transactional influences between the individual and the caregiving environment in the development of social withdrawal.

  9. Internet communication: an activity that appeals to shy and socially phobic people?

    Madell, Dominic; Muncer, Steven

    2006-10-01

    Shyness (or social anxiety) and social phobia can be viewed as two distinct conditions, and this study investigates whether they are related to use of the Internet generally, and for communication purposes. 362 participants from two schools, a college and a university in the Teesside area in England were asked to complete Mattick and Clarke's (1998) Social Phobia (SPS) and Social Interaction Anxiety (SIAS) scales and also answer a questionnaire which asked them about their use of the Internet generally and for communication purposes. The findings from these suggested that social anxiety and social phobia are not highly associated with use of the Internet either in general, or for communication purposes, although minor associations with certain aspects of Internet use are discussed.

  10. Institucional'naja podgotovka Pol'shi k vstupleniju v Evropejskij sojuz

    Tomaszewski W.

    2015-05-01

    Full Text Available In May 2014 it was aready ten years since Poland’s accession to the European Union. The accession was preceded by a long period of political action and negotiations between the Polish and the EU institutions. The process of integration was extremely complex. It covered almost all areas of economic, legal and civil aspects of the aspiring country’s economy, in which all necessary requirements had to be met. The aim of the article was to present the institutional framework created for efficient implementation of the process of accession. The considerations involved especially an institutional method. The research resulted in poining out both the actually efficient and less efficient bodies participating in the process of integration.

  11. Status and physics of the SHiP experiment at CERN

    Buonaura, Annarita

    2018-01-01

    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...

  12. Shi et al., Afr J Tradit Complement Altern Med. (2015) 12(6):169-179 ...

    Proff.Adewunmi

    ... indicating that ethyl acetate extracts of TA leaves are efficacious in attenuating oxidative stress in the liver of ... Antioxidant and antibacterial activities of polyphenolic compounds from bitter cumin (Cuminum .... functions and human disease.

  13. On dendrocincla tyrannina: Morphology, behavior and conservation of a shy lek-type insectivore

    Willis Edwin O.

    1995-11-01

    Full Text Available El trepatroncos tiranino o "churulo" (Dendrocincla tyrannina, Dendrocolaptidae de los bosques de neblina del norte de los Andes es solitario, como las otras especies del género. Se desplaza en el sotobosque lleno de epífitas, dependiendo parcialmente de los insectos que huyen de los escasos ejércitos de hormigas. Es un ave silenciosa y arisca, que se esconde después de volar cortas distancias en busca de presas, o procurándolas en musgos o troncos. La pérdida de los bosques húmedos andinos de laderas abruptas para dar lugar a la ganadería de baja productividad amenaza a la especie y aumenta el peligro de derrumbes en áreas sujetos a temblores; el uso más apropiado para tales áreas es para estudios científicos y actividades turísticas, y no para asentamientos permanentesThe Tyrannine Woodcreeper (Dendrocincla tyrannina, Dendrocolaptidae of northern Andean cloud forests is solitary, like the rest of the genus, and wanders in the epiphyte-laden forest understory, depending partly on hard-to-find swarms of army ants and on understory flocks to flush insects. It is wary and silent, hiding after flying short distan ces for prey or gleaning it from moss or trunks. As los s of sleep Andean wet forests where the woodcreepers live resulls in gretaer danger from earthquakes, study and tourism are preferable to settlements.

  14. The SHiP experiment and its detector for neutrino physics

    Buonaura, Annarita

    2016-01-01

    SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400GeV proton beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A detector downstream of the target will allow to search long-lived exotic particles with masses below O(10) GeV/c2 forseen in extension of the Standard Model. Another dedicated detector, that will be the focus of this talk, will allow to study active neutrino cross- sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electr...

  15. SHI induced defects in chemically synthesized graphene oxide for hydrogen storage applications

    Sharma, Preetam K., E-mail: preetam.nano@gmail.com; Sharma, Vinay; Rajaura, Rajveer Singh; Singh, M. [Department of Physics, University of Rajasthan, Jaipur-302004, India. (India); Srivastava, Subodh; Vijay, Y. K. [Department of Physics, University of Rajasthan, Jaipur-302004, India. (India); Department of Physics, Vivekananda Global University, Jaipur-303012, India. (India); Sharma, S. S. [Department of Physics, Govt. Women Engineering College, Ajmer-305002, India. (India)

    2016-05-06

    Graphene, due to its unique properties arising from the single carbon layer, is a potential candidate for applications in a variety of fields including sensors, photovoltaics and energy storage. The atomic structure and morphology of the carbon nanomaterials especially graphene can be tailored by energetic ionic irradiation. As graphene sheet is very stable, the surface have less reactivity as compared to the edges of the sheets. By surface modification with energetic ion-beams additional dangling bonds can be formed to enhance the surface activity of the graphene film which could be exploited in a variety of applications. In the present work, graphene oxide was synthesized by improved Hummers’ Method. The irradiation was done with Ag{sup +} ions carrying energy 100 MeV with the fluence of 3×10{sup 13}. Raman spectrum of graphene irradiated by Ag{sup +} beam shows additional disordered peaks of D´ and D+G bands. There is also a decrease in the intensity of D band. AFM images depict the increase in the surface roughness of the films. This can be attributed to the increase in the defects in the flakes and intermixing of adjacent layers by irradiation.

  16. Women do not play their aces: the consequences of shying away

    Claussen, J.; Czibor, E.; van Praag, M.

    2015-01-01

    The underrepresentation of women at the top of hierarchies is often explained by gender differences in preferences. We find support for this claim by analyzing a large dataset from an online card game community, a stylized yet natural setting characterized by self-selection into an uncertain,

  17. New energy vision of the Noogata city area; 2001 nendo Noogata shi chiiki shin energy vision

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Noogata City, Fukuoka Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy, project for new energy introduction, etc., and a vision was worked out. The energy consumption amount of the city was estimated at 4,825.4 x 10{sup 6} MJ/y. It consisted of 47.1% in the industrial sector, 26.1% in the commercial/residential sector and 24.9% in the transportation sector. The rate of energy source was 65.7% of petroleum-base energy and 25.1% of electric power. As the project for new energy introduction, the following were studied: introduction of wind power generation/photovoltaic power generation to the flower park at the foot of Mt. Fukuchi and Nakanoshima park on the sandbank of the Onga river; introduction of photovoltaic power generation to library. Moreover, as future models of the introduction, the potential study was made on the following: installation of the stockbreeding waste biogas plant at the compost center; installation of fuel cell system using digestion gas from night soil treatment facilities; installation of the natural gas cogeneration system in the project on redevelopment of the urban area, etc. (NEDO)

  18. Regional new energy vision for Hita City; 2001 nendo Hita shi chiiki shin energy vision

    NONE

    2002-02-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Hita City, Oita Prefecture, surveys and studies were conducted concerning the energy supply/demand trend in the city, the amount of new energy resources in existence, and new energy introduction plans, and a vision was formulated. The city's energy consumption is estimated at 16,216,376 GJ, with the industrial sector responsible for 78.23%, the transportation sector for 11.35%, and the residential and commercial sector for 9.73%. It is in the public sector, general households, forestry, and hog raising that new energy will be utilized. Key projects for new energy introduction were discussed, which covered a residence incorporating a combination of new energies such as solar heat for water heating and photovoltaic power; lumber drying facilities utilizing forestry generated biomass; cogeneration fueled by methane gas from livestock excrements and garbage; photovoltaic power for schools, the city office, etc.; use of photovoltaic power, temperature difference energy, and methane gas at purification centers, etc.; use of clean energy vehicles for official use; etc. (NEDO)

  19. SHI induced enhancement in green emission from nanocrystalline CdS thin films for photonic applications

    Kumar, Pragati; Saxena, Nupur; Chandra, Ramesh; Gao, Kun; Zhou, Shengqiang; Agarwal, Avinash; Singh, Fouran; Gupta, Vinay; Kanjilal, D.

    2014-01-01

    Intense green emission is reported from nanocrystalline CdS thin films grown by pulsed laser deposition. The effect of ion beam induced dense electronic excitation on luminescence property of CdS films is explored under irradiation using 70 MeV 58 Ni 6+ ions. It is found that swift heavy ion beam irradiation enhances the emission intensity by an order of 1 and broadens the emission range. This feature is extremely useful to enhance the performance of different photonic devices like light emitting diodes and lasers, as well as luminescence based sensors. To examine the role of energy relaxation process of swift heavy ions in creation/annihilation of different defect levels, multi-peaks are fitted in photoluminescence spectra using a Gaussian function. The variation of contribution of different emissions in green emission with ion fluence is studied. Origin of enhancement in green emission is supported by various characterization techniques like UV–visible absorption spectroscopy, glancing angle X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. A possible mechanism of enhanced GE due to ion beam irradiation is proposed on the basis of existing models. -- Highlights: • Room temperature green luminescence nanocrystalline CdS thin films grown by pulsed laser deposition. • Enhanced green emission by means of swift heavy ion irradiation. • Multipeak fitting of photoluminescence spectra using a Gaussian function. • Variation of area contributed by different emissions in green emission is studied with respect to ion fluence. • Mechanism of enhanced green emission is discussed based on creation/annihilation of defects due to ion beam irradiation

  20. SHI induced enhancement in green emission from nanocrystalline CdS thin films for photonic applications

    Kumar, Pragati, E-mail: pkumar.phy@gmail.com [Department of Physics, Bareilly College, Shahmat Ganj Road, Bareilly 243005, Uttar Pradesh (India); Saxena, Nupur [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India); Chandra, Ramesh [Institute Instrumentation Centre, Indian Institute of Technology, Roorkee 247667 (India); Gao, Kun; Zhou, Shengqiang [Institute of Ion Beam Physics and Materials Research, Helmholtz-Zentrum Dresden-Rossendorf (HZDR), P.O. Box 510119, 01314 Dresden (Germany); Agarwal, Avinash [Department of Physics, Bareilly College, Shahmat Ganj Road, Bareilly 243005, Uttar Pradesh (India); Singh, Fouran [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India); Gupta, Vinay [Department of Physics and Astrophysics, Delhi University, Delhi 110007 (India); Kanjilal, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-03-15

    Intense green emission is reported from nanocrystalline CdS thin films grown by pulsed laser deposition. The effect of ion beam induced dense electronic excitation on luminescence property of CdS films is explored under irradiation using 70 MeV {sup 58}Ni{sup 6+} ions. It is found that swift heavy ion beam irradiation enhances the emission intensity by an order of 1 and broadens the emission range. This feature is extremely useful to enhance the performance of different photonic devices like light emitting diodes and lasers, as well as luminescence based sensors. To examine the role of energy relaxation process of swift heavy ions in creation/annihilation of different defect levels, multi-peaks are fitted in photoluminescence spectra using a Gaussian function. The variation of contribution of different emissions in green emission with ion fluence is studied. Origin of enhancement in green emission is supported by various characterization techniques like UV–visible absorption spectroscopy, glancing angle X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. A possible mechanism of enhanced GE due to ion beam irradiation is proposed on the basis of existing models. -- Highlights: • Room temperature green luminescence nanocrystalline CdS thin films grown by pulsed laser deposition. • Enhanced green emission by means of swift heavy ion irradiation. • Multipeak fitting of photoluminescence spectra using a Gaussian function. • Variation of area contributed by different emissions in green emission is studied with respect to ion fluence. • Mechanism of enhanced green emission is discussed based on creation/annihilation of defects due to ion beam irradiation.

  1. Do gays shy away from competition? Do lesbians compete too much?

    Buser, T.; Geijtenbeek, L.; Plug, E.

    It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible

  2. Do Gays Shy Away from Competition? Do Lesbians Compete Too Much?

    Buser, Thomas; Geijtenbeek, Lydia; Plug, Erik

    2015-01-01

    It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible explanation. We conduct an experiment on a Dutch online survey panel to measure the competitiveness of gay, lesbian and straight panel members. For differences in competitiveness to partially expla...

  3. New energy vision of Kanazawa City; 2001 nendo Kanazawa shi shin energy vision

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Kanazawa City, Ishikawa Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy and project for new energy introduction, and a vision was worked out. The energy demand amount of the city was approximately 42 million GJ. The amount of CO2 emitted from this was estimated at approximately 880,000 t-C. The rate of energy source was 65.3% of petroleum-base energy, 24.7% of electric power and 10.0% of gas. As viewed by sector, the energy demand amount consisted of 38.1% in the commercial/residential sector, 32.2% in the transportation sector and 29.7% in the industrial sector. As the project for new energy introduction, the following were studied: introduction of wind power generation to the sport recreation zone of the mountain area; introduction of natural gas cogeneration to the city hospital; introduction of hydroelectric power generation using the idle head of filtration plant; utilization of the sewage heat and sewage digestion gas at the water quality control center, introduction of clean energy vehicle to official vehicle; introduction of photovoltaic power generation to park light/school, etc. (NEDO)

  4. Shy and Ticklish Truths as Species of Scientific and Artistic Perception

    ... recognize a 'gay science' (Nietzsche) not as an eccentric construction of merely poetic insights and expressions, but as a necessary part of the fundamentals of knowledge. It is a truth of the human condition that its truths are grounded in a personal embodiment of individuality, ontogeny, momentariness and situationality.

  5. New energy vision of the Akita city area; 2001 nendo Akita shi chiiki shin energy vision

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Akita City, an investigational study was conducted of the energy demand of the town, existence amount of new energy, project on new energy introduction, etc., and a new energy vision was worked out. The population of Akita City was 317,868 as of December 31, 2000, which is continuously on the increase. The amount of energy demand of the whole city was 990,000 kL/y. The energy demand consists of fossil fuels such as petroleum, coal and propane gas (77.7%) and electric power (22.3%). The CO2 emissions from these are 2,908,000 t-CO2. As the project on the new energy introduction, study was made on the installation of the photovoltaic power system and wind power system at base centers and introduction of the waste power system at the Goshono Works. As the model project, study was made on the introduction of the photovoltaic power generation and wind power generation to street light and public facilities, road snow melting/space heating and cooling using soil heat, introduction of clean energy vehicles, BDF introduction using waste cooking oil and rate blossoms, etc. (NEDO)

  6. Search for Hidden Particles (SHiP): a new experiment proposal

    De Lellis, G.

    2015-06-01

    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. We propose a new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been observed so far. We therefore propose an experiment to search for hidden particles and study tau neutrino physics at the same time.

  7. Current status of X-ray system at SHI Tsukuba facility

    Washio, Masakazu; Kato, Hiroo; Yamase, Yutaka; Odera, Masatoshi; Thompson, C.C.; Cleland, M.R.

    1992-01-01

    Many studies have been carried out on X-ray converter system, characteristics of the X-rays and its applications. In this paper, following items will be described. 1. Characteristics of electron beam obtained from 5 MeV Dynamitron, 2. Design and status of the X-ray converter, 3. Characteristics of converted X-ray, 4. Preliminary results of sterilization of certain microbiological reference standard. (J.P.N.)

  8. SI-SHY: Dysregulated Fear in Toddlerhood Predicts Kindergarten Social Withdrawal through Protective Parenting

    Kiel, Elizabeth J.; Buss, Kristin A.

    2014-01-01

    Two recent advances in the study of fearful temperament (behavioral inhibition) include the validation of dysregulated fear as a temperamental construct that more specifically predicts later social withdrawal and anxiety, and the use of conceptual and statistical models that place parenting as a mechanism of development from temperament to these outcomes. The current study further advances these areas by examining whether protective parenting mediated the relation between dysregulated fear in toddlerhood and social withdrawal in kindergarten. Participants included 93 toddlers and their mothers, who engaged in laboratory tasks assessing traditional fearful temperament, dysregulated fear, and protective parenting. When children reached kindergarten, they returned to the laboratory for a multimethod assessment of social withdrawal. Results confirmed the hypothesis that dysregulated fear predicted social withdrawal through protective parenting, and this occurred above and beyond the effect of traditional fearful temperament. These findings bolster support for the use of dysregulated fear as a temperamental construct related to, but perhaps more discerning of risk than traditionally measured fearful temperament/behavioral inhibition and highlight the importance of transactional influences between the individual and the caregiving environment in the development of social withdrawal. PMID:25242893

  9. Effect of Language Context on Ratings of Shy and Unsociable Behaviors in English Language Learner Children

    Ash, Andrea C.; Rice, Mabel L.; Redmond, Sean M.

    2014-01-01

    Purpose: The primary goal of this study was to explore the effect of language context on the socially withdrawn behaviors of school-age-children who are English language learners (ELLs) from middle- to high-socioeconomic status (SES) backgrounds. This is one of the 1st studies to address the frequently confused concepts of shyness and…

  10. SHiP: a new facility with a dedicated detector for studying $\

    Buonaura, Annarita

    2016-01-01

    SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In five years, $2\\times 10^{20}$ protons of 400 GeV/c momentum will be dumped on a Molybdenum target. A detector downstream of the target will allow a search to made for long-lived particles with masses below O(10) GeV/c$^2$ foreseen in several extensions of the Standard Model. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion Spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electronic detectors for the time stamp of the events and the m...

  11. Regional new energy vision for Joetsu City; 2001 nendo Joetsu shi chiiki shin energy vision

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Joetsu City, Niigata Prefecture, surveys and studies were conducted involving energy consumption of the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumes 3,593 times 10{sup 9} kcal in energy, with the industrial sector responsible for 47.5%, the transportation sector 28.1%, and the residential/commercial sector 24.3%. As for the energy type, oil based fuel accounts for 58.3%, electric power 26.8%, and town gas 8.6%. The amount of carbon dioxide emissions due to energy consumption is estimated at 1,160 kt-CO2. Studies conducted for new energy introduction covered the supply of photovoltaic power to a project on municipal housing construction and a project on promoting the buildup of environment preservation facilities; the installation of a photovoltaic power generation system for a Citizens' Forest buildup project; the installation of a wind power generation system at the Minowadai Square of Recreation and Relaxation for the citizens; the installation of eco-stations to deal with gasoline, propane gas, and natural gas; the extension of financial support for the purchase of low-pollution vehicles; and so forth. (NEDO)

  12. Jiří Strejc a Jan Opsimathes - apoštolové českého kalvinismu

    Kostlán, Antonín

    -, č. 1 (2009), s. 35-55 ISSN 1804-1132 R&D Projects: GA AV ČR IAA800630802 Institutional research plan: CEZ:AV0Z80630520 Keywords : early modern Czech history * intellectual history * calvinism Subject RIV: AB - History

  13. Hradsko u Mšena – nejzápadněji položená lokalita bohunicienu

    Škrdla, Petr; Adamovič, Jiří; Rychtaříková, T.

    2013-01-01

    Roč. 65, č. 4 (2013), s. 895-905 ISSN 0323-1267 R&D Projects: GA AV ČR IAA800010801 Institutional support: RVO:68081758 ; RVO:67985831 Keywords : Early Upper Paleolithic * Bohunician * Levallois technology * tephrite * erratic flint * radiolarite Subject RIV: AC - Archeology, Anthropology, Ethnology; DB - Geology ; Mineralogy (GLU-S)

  14. Jaká je ochota spolupracovat s policií a co ji ovlivňuje?

    Moravcová, Eva

    2013-01-01

    Roč. 11, č. 1 (2013), s. 47-56 ISSN 1214-438X R&D Projects: GA MŠk LM2010012 Institutional support: RVO:68378025 Keywords : willingness to cooperate with the police * legitimacy of the police * trust in police Subject RIV: AD - Politology ; Political Sciences

  15. Kozinec žlábkatý (Astragalus sulcatus) na jižní Moravě

    Danihelka, Jiří; Sedláček, V.

    2017-01-01

    Roč. 52, č. 1 (2017), s. 9-17 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : distribution * Fabaceae * introduced species Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

  16. Estimation of spawning area of Pisodonophis sangjuensis Ji and Kim, 2011 (Pisces: Ophichthidae) based on leptocephali size and distribution

    Ji, Hwan-Sung; Hwang, Kangseok; Choi, Jung Hwa; Cha, Hyung-Kee; Kim, Jin-Koo

    2017-06-01

    Pre-metamorphic leptocephali of Pisodonophis sangjuensis ( n = 91, 10.4-90.2 mm in total length, TL) were collected in the East China Sea for the first time. Pre-metamorphic leptocephali of P. sangjuensis, which were identified using mitochondrial DNA cytochrome c oxidase subunit I gene (mtDNA COI), are characterized by various combinations of morphological characters: 8 moderate to pronounced gut loops with the kidney terminating on the 6-7th loops; and 8 subcutaneous pigment patches on the tail just ventral to the notochord. Pisodonophis sangjuensis leptocephali were more numerously collected offshore than inshore around Jeju Island. The smallest leptocephali ( 100.0 mm TL) were collected from around Jeju Island and the southern coast of Korea. Our findings indicate that P. sangjuensis spawns offshore south of Jeju Island that is an area associated with high water temperature, and then the hatched leptocephali are transported to Jeju Island or the southern coast of Korea by the Tsushima Warm Current.

  17. New calibration of Ji - Di clinopyroxene barometer for Eclogites, pyroxenites and peridotites and eclogite - pyroxenite mantle geotherms.

    Ashchepkov, Igor; Vishnyakova, Elena

    2010-05-01

    Checking the universe clinopyroxene JD-Di barometer on the experimental system showed that it better to use the separate schemes for the eclogite and peridotite systems. The clinopyroxene barometer based on the internal exchange of Jd-Di components for the Al. It allow using the temperature calculated with the (Krogh, 1988) method for the The barometer was calibrated on the 200 experimental runs for the eclogitic system (Yaxley,Brey,2004; Spandler ea, 2008; Konzett ea, 2008; Hanrahan ea, 2009 and references there in). It reproduces the pressure range to 120 kbar with the r= 0.91 (S=8) for 180 experimental runs. P(Ash2010 Ecl)=0.32 (1-0.215*Na/Al+0.012*Fe/Na)*Kd^3/4*ToK/(1+Fe)*(1+5*Fe)- 35*ln(1273/ToK)*(Al+Ti+2.5Na+1.5Fe3+)+(0.9-xx(2,8))*10+xx(2,9)/xx(2,3)* ToK /200-1.5 P1=(0.00004*P^3-0.0091*P^2+1.3936*P)*1.05 Where KD = Na*Mg/xAlCr*/Ca; XAlCr= Al+Cr+4*Ti-K-(Fe-0.21)*0.75 The tests on the natural associations form the eclogitic xenoliths with and without the diamonds and omphacite diamond inclusions (Taylor ea, 2006; Shatsky ea, 2008; Jacob ea, 2009) have shown very good agreement with the position of the Graphite -Diamond (Kennedy, Kennedy, 1977) boundary and to the conductive geotherms which are close to 34-36mvm-2 geotherms while for the South Africa they are more close to 40mvm-2 geotherms. For the zonal omphacites it produces the range of the nearly equal pressures or more rarely advective paths. The levels of the maximum enrichments in eclogites which are close to 50-60 kabr beneath 360ma Siberian kimberlites coincides with the levels of heating according to the monomineral and polymineral thermobarometry. South Africa eclogite geotherms often split into 2-3 branches: subductional (35) conductive (40) for Paleozoic-Mesozoic mantle lithosphere and the hottest advective close o 45 mv/m-2. For the pyroxenite compositions the barometer was rearranged to by the adding the temperature influence on Al , Ta, Fe exactly in KD as following: P(Ash2010 Per-Pxt)=0.275*(1-0.17*Na/Al+0.0115*Fe/Na)*Kd^3/4*ToK/(1+Fe)* (1+5*Fe*(ToK-600)/50)-35*ln(1273/ToK)*(Al+Ti+2.5Na+1.5Fe3+)+(0.9-xx(2,8))*10+xx(2,9)/xx(2,3)* ToK /300-4*(Fe*33.2-4) -(Al-5.5)*( ToK -1300)/70-( ToK -1200)*0.015 with the second correction P=P*0.65+10+Mg*Al*( ToK -1400)/500 Where KD = Na*Mg/xAlCr*/Ca; XAlCr= Al*((T0-800)/800)**0.25+Cr-K+(4*Ti-0.0125)/(T0-600)*400+(Fe-0.21)*(T0-600)/14000 This equations reproduces the experimental pressures for 300 experimental runs with the R=0.84 and for the best set of the experimental data (Walter, 1999; Taylor ea 1998; Brey Kohler, 1990; 2009) with the E=0.95 (s=7) within the 100 kbar interval. They allow to work with the wide range of the pyroxenite compositions giving the practically coinciding PT parameters with the pressures determined for ilmenites and chromites as well as the (Brey, Kohler, 1900) pressure estimates. The PT parameters reconstructed for the mantle lithosphere beneath > 120 pipes from Yakutia , Baltica, Africa , North America and other world wide kimberlites have shown very good coincidence with the estimates from the other methods of monomineral (Nimis, Taylor, 2000; McGregor, 1974; Ashchepkov ea. 2009 ) and Gar-Opx barometers (Brey, Kohler, 1900; Nickel, Green, 1975). For the garnet and spinel xenoliths of the alkali basalts representing fertile or regenerated peridotites with high Al content of the clinopyroxenes the modified equation allows to determine the pressures together for megacrysts, pyroxeniets and peridotites using the following equation P=0.035*Kd*ToK)/(1+3.5*Fe)- 50*ln(1273/(ToK-100)*(Al+5*Na-Ti+2*Cr) -(Na-0.050)*(ToK-1200)*(Ca-0.85)/7000+5 Where KD = Na*Mg/xAlCr*/Ca; xAlCr= (Al+Si-2)*((ToK-700)/900)^0.35+Cr+Fe3-K +(4*Ti-0.0125)/(ToK-600)*700 +(Fe-0.21)*(ToK-400)/17000 This equations also very good reproduce the experimental runs in the pressure interval from 10 to 80 kbar but better to 50 kbars (R=0.92) (S=5) for 170 experimental runs (Putirka ea, 1996; Fallon ea, 1999; Taylor ea, 1998; Drapper Green, 1997; Lambart ea 2009) in this pressure range.

  18. Manicômio em circuito: os percursos dos jovens e a internação psiquiátrica The psychiatric hospital circuit: the trajectories of yong people prior to psychiatric hospitalization

    Andrea Cristina Coelho Scisleski

    2008-02-01

    Full Text Available Este artigo analisa a internação psiquiátrica de jovens, tomando-a não a partir de uma perspectiva psicopatológica individual, mas de uma dimensão subjetivo-social com base nos percursos desses jovens até a internação. O estudo foi realizado no Centro Integrado de Atenção Psicossocial para crianças e adolescentes do Hospital Psiquiátrico São Pedro, na cidade de Porto Alegre, Rio Grande do Sul, Brasil, por meio de oficinas com os jovens que estavam em atendimento na internação deste serviço. Percebeu-se uma recorrência que marca o percurso desses jovens e expressa um determinado modo de funcionamento da rede de atenção até a internação, acarretando na produção de um certo perfil desses jovens: pobreza sócio-econômica, baixa escolaridade e uso de drogas. Outro aspecto importante é o papel da ordem judicial nos encaminhamentos à internação, que obedece tanto a uma lógica de punição aos jovens e aos serviços, como também, paradoxalmente, constitui-se numa estratégia de acesso aos serviços de saúde.This article analyzes psychiatric hospitalization of young patients from a contemporary social-subjective (rather than a psychopathological perspective, following the trajectory of these youth prior to their admission. The study was conducted at the Center for Comprehensive Psychosocial Care for Children and Adolescents, São Pedro Psychiatric Hospital, in the city of Porto Alegre, Rio Grande do Sul State, Brazil. Recurrent traits in the trajectory of these youth expressed how the health care network functioned with them prior to their hospitalization, with a consistent pattern of socioeconomic deprivation, low schooling, and drug use. Another key aspect was the role of the court system in referring them for hospitalization, adhering to a kind of logic that punished both the youth and the services and paradoxically formed a strategy for access to health services.

  19. JiaZhang Dui ErTong FaZhan TongBan GuanXi De ZuoYong (The Role of Parents in the Development of Peer Group Competence). ERIC Digest.

    Moore, Shirley G.

    Among studies that have examined the relationship between parenting styles and children's development of social skills, the research of Diana Baumrind is noteworthy. In several studies, she has identified authoritarian, permissive, and authoritative parenting styles, which differ on the dimensions of nurturance and parental control. Authoritarian…

  20. AIR PRESSURE and Other Data from SHI YAN 3 From Antarctic and Others from 19921109 to 19930224 (NODC Accession 9600025)

    National Oceanic and Atmospheric Administration, Department of Commerce — The accession contains Surface Wave data and Sea Surface Temperature (SST) data collected as part of Tropical Ocean Global Atmosphere (TOGA) and Coupled...

  1. "But at school … I became a bit shy": Korean immigrant adolescents' discursive participation in science classrooms

    Ryu, Minjung

    2013-09-01

    In reform-based science curricula, students' discursive participation is highly encouraged as a means of science learning as well as a goal of science education. However, Asian immigrant students are perceived to be quiet and passive in classroom discursive situations, and this reticence implies that they may face challenges in discourse-rich science classroom learning environments. Given this potentially conflicting situation, the present study aims to understand how and why Asian immigrant students participate in science classroom discourse. Findings from interviews with seven Korean immigrant adolescents illustrate that they are indeed hesitant to speak up in classrooms. Drawing upon cultural historical perspectives on identity and agency, this study shows how immigrant experiences shaped the participants' othered identity and influenced their science classroom participation, as well as how they negotiated their identities and situations to participate in science classroom and peer communities. I will discuss implications of this study for science education research and science teacher education to support classroom participation of immigrant students.

  2. The Shi'ites, the West and the Future of Democracy: Reframing Political Change in a Religio-secular World

    John A Rees

    2006-02-01

    Full Text Available The present article critically reviews Paul McGeough’s important analysis of the most recent Iraq war within a broader consideration of secular-religious relations in international affairs. The thesis of Mission Impossible: The Sheikhs, the US and the Future of Iraq (2004 can be summarised around two ideas: that the US strategy in Iraq was flawed because it wilfully bypassed the traditional power structures of Iraqi society; and that these structures, formed around the tribe and the mosque, are anti-democratic thus rendering attempts at democratisation impossible. The article affirms McGeough’s argument concerning the inadequacy of the US strategy, but critically examines the author’s fatalism toward the democratic capacity of Iraqi structures, notably the structure of the mosque. By broadening the notion of democracy to include religious actors and agendas, and by an introductory interpretation of the Shi’ite community as vital players in an emerging Iraqi democracy, the article attempts to deconstruct the author’s secularist view that the world of the mosque exists in a ‘parallel universe’ to the liberal democratic West. Reframing the Shi’ites as essential actors in the democratic project thus situates political discourse in a ‘religio-secular world’ and brings the ‘other worlds’ of religion and secularism together in a sphere of interdependence. Such an approach emphasises the importance of post-secular structures in the discourses on democratic change.

  3. SHiP: a new facility with a dedicated detector to search for new long-lived neutral particles

    AUTHOR|(SzGeCERN)711794

    2015-01-01

    SHIP is a new fixed target experiment whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector, based on a long empty decay volume followed by a spectrometer and particle identi- fication detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the D meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could also be performed in an un...

  4. Once bitten, twice shy? Medically-attended injuries can sensitise parents to children's risk of injuries on playgrounds.

    Morrongiello, B A; Howard, A W; Rothman, L; Sandomierski, M

    2009-02-01

    To compare risk perceptions of parents whose child sustained a medically attended playground injury (cases) with those of parents whose child had not (controls) to address two questions. Does having a child experience a medically attended injury: (1) sensitise parents to children's injury vulnerability and severity; (2) influence parents' appraisal of the injury mechanism (child's behaviour), attributions for injuries or beliefs about strategies for prevention? Each case-control parent dyad was assigned to one of two conditions: (1) being presented with 10 common injury-risk playground behaviours specific to the equipment on which their child had been hurt, and asked to appraise injury vulnerability and severity; or (2) being presented with scenarios about playground injuries that varied in severity but were all based on the same child behaviour, and asked questions about this behaviour, attributions for injury and strategies for prevention. The results support the occurrence of a sensitisation process. Compared with control parents, case parents showed higher ratings of injury severity and children's vulnerability to injury, made fewer attributions for injuries to bad luck, and endorsed a greater diversity of prevention strategies, including parent (closer supervision), child (teaching rules about safe play on playgrounds) and environmental (modifications to playgrounds). A child's medically attended injury can create a "teachable moment" for the parent. Linking injury-prevention programming to this teachable moment may increase the likelihood of evoking changes in parental supervisory behaviour and their setting of rules limiting their child's risk behaviours to reduce the occurrence of childhood injury.

  5. Shy and bold great tits (Parus major): body temperature and breath rate in response to handling stress

    Carere, C.; Van Oers, K.

    2004-01-01

    A standard handling protocol was used to test the hypothesis that boldness predicts stress responsiveness in body temperature and breath rate. Great tit (Parus major) nestlings were taken from the field, hand reared until independence, and their response to a novel object was assessed. At the age of

  6. Shy and bold great tits (Parus major) : body temperature and breath rate in response to handling stress

    Carere, C; van Oers, K

    2004-01-01

    A standard handling protocol was used to test the hypothesis that boldness predicts stress responsiveness in body temperature and breath rate. Great tit (Parus major) nestlings were taken from the field, hand reared until independence, and their response to a novel object was assessed. At the age of

  7. Turning shy on a winter's day : Effects of season on personality and stress response in Microtus arvalis

    Gracceva, Giulia; Herde, Antje; Groothuis, Ton G. G.; Koolhaas, Jaap M.; Palme, Rupert; Eccard, Jana A.

    Animal personalities are by definition stable over time, but to what extent they may change during development and in adulthood to adjust to environmental change is unclear. Animals of temperate environments have evolved physiological and behavioural adaptations to cope with the cyclic seasonal

  8. Direct determination of absolute configuration: a vibrational circular dichroism study on dimethyl-substituted phenyloxiranes synthesized by Shi epoxidation

    Fristrup, Peter; Lassen, Peter Rygaard; Tanner, David Ackland

    2008-01-01

    obtained using DFT/B3LYP calculations, and the differences between experiment and theory are discussed. The absolute configuration at the benzylic position was established as being (R), (S) and (R) for the cis, trans and geminal dimethylsubstituted phenyloxiranes, respectively. In all three cases...

  9. Regional new energy vision formulation for Nichinan City. Fiscal 2001 report; 2001 nendo Nichinan shi chiiki shin energy vision sakuteisho

    NONE

    2002-03-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Nichinan City, Miyazaki Prefecture, surveys and studies were conducted concerning the energy demand of the city, the amount of new energy resources in existence, and new energy introduction plans, and then a vision was formulated. The city's energy demand is estimated to be approximately 4,028-million MJ/year, which includes 46% for the transportation sector, 30% for the people's livelihood-related business sector, 17% for the residential sector, and 7% for the industrial sector. The energy demand is covered 62% by oil-based fuels and 30% by electric power. Projects discussed for new energy introduction included the introduction of photovoltaic power into a lifelong learning center, a comprehensive center for health and welfare, and primary schools; introduction of solar hot water supply systems into school meal providing facilities; introduction of medium-size wind power systems (five systems); medium- or small-scale hydroelectric power generation on the Sakatani river; use of street light lighted by photovoltaic/wind hybrid power systems; introduction of clean energy vehicles; power generation utilizing livestock excrement; introduction of photovoltaic, hydroelectric, and methane gas power generation into a sewage treatment plant; and the use of RPF (refuse paper and plastic fuel) at the Nichinan plant of Oji Paper Co., Ltd. (NEDO)

  10. Temperament, disordered attachment and parental sensitivity in foster care: Differential findings on attachment security for shy children

    de Schipper, J.C.; Oosterman, M.; Schuengel, C.

    2012-01-01

    In a foster care sample, the moderating effect of temperamental shyness on the association between parental sensitivity and attachment quality was tested. The foster parents of 59 foster children (age M=57 months, SD=16.4) filled out the Child Behavior Questionnaire. To control for confounds,

  11. [The beginning of western medical education].

    Kee, C D

    1992-01-01

    Our country had quite an advanced system of medical education during the era of the Koryo Kingdom, and during the Choson Dynasty, the Kyong Guk Dae Jon, in which a systematized medical education was clearly described, was compiled in the era of King Sejong. However, the educational system was not for Western medicine. Western medicine was first introduced to our country in the 9th year of King Injo (1631) when Chong Du Won, Yi Yong Jun, etc. returned from Yon Gyong (Beiuin) with Chik Bang Oe Gi. Knowledge of Western medicine was disseminated by Shil Hak (practical learning) scholars who read a translation in Chinese characters, of Chik Bang Oe Gi. Yi Ik (Song Ho), Yi Gyu Gyong (O ju), Choe Han Gi (Hye Gang), Chong Yak Yong (Ta San), etc., read books of Western medicine and introduced in writing the excellent theory of Western medicine. In addition, Yu Hyong Won (Pan Gye), Pak Ji Won (Yon Am), Pak Je Ga (Cho Jong), etc., showed much interest in Western medicine, but no writings by them about western medicine can be found. With the establishment of a treaty of amity with Japan in the 13th year of King Kojong (1876), followed by the succession of amity treaties with Western powers, foreigners including medical doctors were permitted to flow into this country. At that time, doctors Horace N. Allen, W. B. Scranton, John W. Heron, Rosetta Sherwood (Rosetta S. Hall), etc., came to Korea and inaugurated hospitals, where they taught Western medicine to Korean students. Dr. Horace N. Allen, with the permission of king Kojong, established Che Jung Won in April 1885, and in March 1886, he began at the hospital to provide education of Western medicine to Korean students who were recrutied by the Korean Government. However, the education was not conduted on a regular basis, only training them for work as assistants. This is considered to be the pioneer case of Western medical education in this country. Before that time, Japanese medical doctors came to Korea, but there are no

  12. PIXE analysis of chinese chicken-blood stone

    Lin, E.K.; Wang, C.W.; Yu, Y.C.; Liu, T.Y.; Cheng, H.S.; Zhu, H.X.; Yang, H.J.

    1999-01-01

    This paper reports the chemical compositions of chicken-blood stone Ji Xue Shi measured by Proton Induced X-ray Emission (PIXE). The experimental result show that for the red portion of chicken-blood stone, the concentration of Hg is as high as 20 wt%, and the concentration of S can be above 10 wt%. For the non-red portion the main chemical compositions are Al 2 O 3 and SiO 2 . The obtained chemical compositions are close to those of kaolinite for Balin chicken-blood stone, and of pyrophyllite for Changhua chicken-blood stone, respectively. So far many Changhua chicken-blood stones and Balin chicken-blood stones were found in China, the PIXE method can be used to explore the provenance of available chicken-blood stones. (author)

  13. QING LIN

    QING LIN. Articles written in Journal of Genetics. Volume 96 Issue 4 September 2017 pp 535-544 RESEARCH ARTICLE. Effects of genetic variants of the bovine WNT8A gene on nine important growth traits in beef cattle · YONG-ZHEN HUANG YONG ZOU QING LIN HUA HE LI ZHENG ZI-JING ZHANG YONG-LONG DANG ...

  14. Ropný průmysl Jižního Súdánu jako faktor ovlivňující současné dění v Jižním Súdánu a vztahy mezi Súdánem a Jižním Súdánem

    Hanzalová, Kateřina

    2014-01-01

    Petroleum is one of the most important commodities traded on the international markets. World oil reserves are limited and therefore becoming increasingly important. Sudan and South Sudan control the sixth highest African oil reserves. However, both states have to face a number of problems which the petroleum industry brings. The bachelor project primarily focuses on South Sudan and its petroleum industry. The aim of the project is to describe how the petroleum industry of South Sudan influen...

  15. Analýza vinařské turistiky a agroturistiky v regionu Jižní Morava

    Harmáčková, Alena

    2010-01-01

    The bachelor thesis analyses a supply of wine tourism and agro tourism in the South Moravian region. The main goal of the paper is an evaluation of present-day condition of these types of tourism in the region and a comparison with the Weinviertel region.

  16. Stopy působení římských architektů na jižní Moravě

    Šedo, Ondrej; Knápek, Radka

    2016-01-01

    Roč. 18, prosinec (2016), s. 43-48 ISSN 1213-1628 Institutional support: RVO:68081758 Keywords : South Moravia * Roman architecture * Roman architects * Roman period * Roman archaeology * Mušov Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  17. Jiří George Kukla a velká klimatologie globálních změn

    Cílek, Václav

    2003-01-01

    Roč. 58, č. 9 (2003), s. 257-258 ISSN 1210-258X Institutional research plan: CEZ:AV0Z3013912 Keywords : J. G. Kukla * climatology * ice age Subject RIV: DB - Geology ; Mineralogy http://www.casopis.ochranaprirody.cz/res/ data /004/000514.pdf

  18. Malakostratigrafie vchodového valu Medvědí jeskyně ve Slovenském ráji

    Ložek, Vojen

    2012-01-01

    Roč. 2011, podzim (2012), s. 219-222 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Keywords : Slovenský raj * Medvedia Cave * entrance rampart * Holocene * Mollusca * foam sinter Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2011/zpravy_2011-49.pdf

  19. K problematice alkoholismu na jižní Moravě v kronice Rok na vsi bratří Mrštíků

    Altman, Karel

    2008-01-01

    Roč. 44, č. 47 (2008), s. 69-89 ISSN 0449-0436 Institutional research plan: CEZ:AV0Z90580513 Keywords : alcoholism * South Moravia * pubs * history of ethnology Subject RIV: AC - Archeology, Anthropology, Ethnology

  20. State-to-state quantum dynamics of the F + HCl (vi = 0, ji = 0) → HF(vf, jf) + Cl reaction on the ground state potential energy surface.

    Li, Anyang; Guo, Hua; Sun, Zhigang; Kłos, Jacek; Alexander, Millard H

    2013-10-07

    The state-to-state reaction dynamics of the title reaction is investigated on the ground electronic state potential energy surface using two quantum dynamical methods. The results obtained using the Chebyshev real wave packet method are in excellent agreement with those obtained using the time-independent method, except at low translational energies. It is shown that this exothermic hydrogen abstraction reaction is direct, resulting in a strong back-scattered bias in the product angular distribution. The HF product is highly excited internally. Agreement with available experimental data is only qualitative. We discuss several possible causes of disagreement with experiment.

  1. Nové nálezy keramických fragmentů a otisků v gravettienu jižní Moravy

    Králík, M.; Svoboda, Jiří; Škrdla, Petr; Nývltová Fišáková, Miriam

    2008-01-01

    Roč. 49, 1-2 (2008), s. 3-22 ISSN 1211-7250 R&D Projects: GA ČR GA404/08/0045; GA AV ČR KJB800010701 Institutional research plan: CEZ:AV0Z80010507 Keywords : Moravia * Pavlovian * ceramics * textile * fingerprints * animal hair Subject RIV: AC - Archeology, Anthropology, Ethnology

  2. Kostel sv. Jiří v Lubojatech ve světle novějších průzkumů

    Kolář, F.; Kožuszniková, A.; Prix, Dalibor; Rosová, R.

    2013-01-01

    Roč. 62, 2/3 (2013), s. 135-170 ISSN 1211-3131 Institutional support: RVO:68378033 Keywords : Silesia * Lubojaty * sacral architecture * 14th to 20th century Subject RIV: AL - Art, Architecture, Cultural Heritage

  3. Pancířníci (Acari: Oribatida) NPR Brouskův mlýn, Jižní Čechy

    Starý, Josef

    2005-01-01

    Roč. 45, - (2005), s. 113-123 ISSN 0139-8172 R&D Projects: GA MŽP(CZ) SE/620/2/03 Institutional research plan: CEZ:AV0Z60660521 Keywords : oribatid mites * Nature Reserve Brouskův mlýn Subject RIV: EH - Ecology, Behaviour

  4. Knihovna Jiřího Ribaye a možnosti dalšího výzkumu

    Pišna, Jan

    2017-01-01

    Roč. 62, 3/4 (2017), s. 37-41 ISSN 2570-6861 Institutional support: RVO:68378068 Keywords : early printed books * manuscripts * book collecting * book culture * Age of Enlightenment * provenances * book catalogues Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  5. Change in surface SP caused by pressure buildup observed at the Nigorikawa geothermal area; Nigorikawa chiiki ni okeru atsuryoku buildup ji no shizen den`i henka

    Yasukawa, K; Yano, Y; Matsushima, N; Ishido, T [Geological Survey of Japan, Tsukuba (Japan); Takahashi, M; Suzuki, I; Aoyama, K; Kuwano, T

    1996-10-01

    To examine the effect of change of subsurface flow system on the surface SP (self potential), SP measurements were carried out before and after the pressure buildup and drawdown during the periodic inspection at Nigorikawa area. Relation between the SP distribution and the observed data was also examined by 2-D numerical simulation. Tendency was found that the SP increased gradually with the production near the production well, decreased during the pressure buildup, and increased again during the drawdown. There were some points having the reverse tendency in the surrounding area. Behavior during the pressure buildup and drawdown was not clear. The resistivity near the ground surface was low ranging between 2 and 5 ohm/m within the Nigorikawa basin. The variation of SP was not so large when compared with the measuring error. The SP profiles on the secondary section passing in the center of caldera at the production stop and at one week after the production start were well corresponded with the profiles under natural conditions which were reproduces using the 2-D model. It was considered that the SP profile before the production stop was affected by the production. 12 refs., 6 figs., 1 tab.

  6. Rozhovor s Jiřím Poláchem a Michaelou Záluskou z Knihovny ÚOCHB

    Burešová, Iva

    2-3 (2016) E-ISSN 1805-2800 Keywords : interview * Institute of Organic Chemistry and Biochemistry of the CAS * library tramformation * chemLib https://www.lib.cas.cz/casopis-informace/knihovna-uochb/

  7. Labyrinthus - Emendatio - Paradisus. Několik poznámek o ráji v didaktických spisech Komenského

    Steiner, Martin

    2002-01-01

    Roč. 32, 67-68 (2002), s. 85-88 ISSN 0323-2220. [J.A. Komenský - milenarismus a eschatologie 17. století /23./. Uherský Brod, 17.10.2001-18.10.2001] Institutional research plan: CEZ:AV0Z9009908 Keywords : J.A. Comenius * paradisus Subject RIV: AA - Philosophy ; Religion

  8. "Miř přesněji". Korejská válka jako černý bod socialistického realismu

    Schmarc, Vít

    2014-01-01

    Roč. 21, 1-2 (2014), s. 44-78 ISSN 1210-7050 R&D Projects: GA ČR(CZ) GP14-32325P Institutional support: RVO:68378068 Keywords : socialist realism * Korean War * ideology Subject RIV: AJ - Letters, Mass- media , Audiovision

  9. Rusko - gruzinské vztahy a válka o Abcházii a Jižní Osetii

    Matulová, Lucie

    2009-01-01

    The thesis deals with the causes and process of the war in Abkhazia and South Ossetia. It examine whether the war was affected by relations with Russia and Georgia and whether Russia were used to it to maintain its influence in the Caucasus. The thesis is divided into three parts. The first part is devoted to relations between Russia and Georgia and their historical contingency. The second part deals with ethnic conflicts in Georgia, their emergence, progress and solutions. The third part ana...

  10. Výzkum komárů na jižní Moravě a jejich zdravotní význam

    Šebesta, Oldřich; Rettich, F.; Peško, Juraj

    2012-01-01

    Roč. 57, č. 1 (2012), s. 4-9 ISSN 1210-7840 Institutional research plan: CEZ:AV0Z60930519 Keywords : West Nile virus * Ťahyňa virus * infectious diseases * vectors * mosquitoes * southern Moravia Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology

  11. Effects of 4WD and ABS of safe driving on slippery roads; Tei {mu} ji ni okeru 4WD to ABS no koka to unten sosa hoho

    Kojima, Y [National Research Inst. of Police Science, Tokyo (Japan); Takigami, K; Asano, K [Japan Safe Driving Center, Tokyo (Japan); Nagai, M [Tokyo University of Agriculture and Technology, Tokyo (Japan)

    1997-10-01

    Effects of 4WD and ABS on safe driving were examined by brake, obstacle avoidance, acceleration, cornering and lane-changing tests on slippery road. The braking operations, used in these tests, are full, intermitted and modulated brakings. As the results of discussion, the major findings are (1) ABS is effective to shorten the stopping distance and to increase the ability of obstacle avoidance in many cases, (2) `Modulated Braking (without wheel locks)` has the same function as ABS, and (3) 4WD is effective to increase the stability while accelerating, cornering and lane-changing. 5 refs., 6 figs.

  12. Study of transient in-cylinder air motion under motoring condition with diesel engine; Diesel engine no motoring ji no tonai ryudo kaiseki

    Kitasei, T; Nakagawa, T [Mitsubishi Motors Co., Tokyo (Japan); Yamazumi, N [Ryoyu Keisan Co., Tokyo (Japan)

    1997-10-01

    The transient in-cylinder air motion have been investigated for reducing exhaust emissions and improving engine performance. A commercial CFD code was used for this purpose. For analyzing under engine motoring condition, the numerical model has a moving piston, intake and exhaust ports with moving valves. As result, exhaust port performance may be analyzed under steady condition, but intake port performance have to be analyzed under unsteady condition. Because transient in-cylinder air motion during intake process is different from steady in-cylinder air motion under influence of piston surface and air viscosity. 4 refs., 11 figs.

  13. Effects of prenatal multiple micronutrient supplementation on growth and cognition through 2 y of age in rural Bangladesh: the JiVitA-3 Trial.

    Christian, Parul; Kim, Jeongyong; Mehra, Sucheta; Shaikh, Saijuddin; Ali, Hasmot; Shamim, Abu Ahmed; Wu, Lee; Klemm, Rolf; Labrique, Alain B; West, Keith P

    2016-10-01

    Childhood undernutrition may have prenatal origins, and the impact of prenatal interventions on postnatal growth is not well known. We assessed the effects of prenatal multiple micronutrient (MM) supplementation on child growth and cognitive development. In a cluster-randomized controlled trial in rural Bangladesh, prenatal MM supplementation compared with iron-folic acid (IFA) supplementation was examined for its impact on growth assessed longitudinally from birth up to 24 mo of age (n = 8529) and, in a subsample (n = 734), on cognitive function at 24 mo of age by use of the Bayley scales of infant and toddler development-third edition test. Prevalence of stunting at birth [length for age z score (LAZ): growth. Ponderal and linear growth velocities were somewhat slower from 3 to 12 mo of age in the MM group than in the IFA group, but not from 12 to 24 mo of age. There was no difference between groups on composite scores of cognition, language, and motor performance at 24 mo of age. In this Bangladeshi trial, maternal pre- and postnatal MM supplementation resulted in improvements in LAZ and reduction in stunting through 3 mo of age, but not thereafter and had no impact on cognitive and motor function at 2 y. This trial was registered at clinicaltrials.gov as NCT000860470. © 2016 American Society for Nutrition.

  14. Zmeškané setkání. Několik poznámek k recenzi Jiřího Pechara

    Urban, Petr

    2017-01-01

    Roč. 65, č. 4 (2017), s. 633-636 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : social cognition * intersubjectivity * anthropological difference Subject RIV: AA - Philosophy ; Religion OBOR OECD: Philosophy, History and Philosophy of science and technology http://filcasop.flu.cas.cz/uploaded/2017_4/Zmeskane%20setkani.pdf

  15. Fiscal 1995 survey report. Study of new energy vision formulation for Kawasaki City, Kanagawa Prefecture; 1995 nendo Kawasaki shi shin energy vision sakutei kentou chosa hokokusho

    NONE

    1996-03-01

    A survey was conducted of the current status of energy supply/demand, future problems, goals of the energy policy, basic plan, and so forth, for the formulation of a new energy vision for the city. Concerning energy supply/demand, studies were made of each sector, area, and energy source. In the study of energy demand, it was discovered that, although the industrial sector in the coastal region remained important, the residential/commercial sector was gathering weight and that the city was serving as an energy supply base for the neighboring areas. In the study of new energy, it was found that the available amount of solar energy resources was enormous, that the Tama river fresh water and the Keihin canal seawater constituted a promising source of temperature difference energy, and that sewage energy, transformation station exhaust heat, LNG (liquefied natural gas) cold heat, and so forth, were also available as energy sources. Taken up for discussion as possible new energy introduction models were gas engine cogeneration, photovoltaic power generation, district heat supply utilizing temperature difference energy, and so forth. (NEDO)

  16. Regional new energy vision formulation survey for Makurazaki City. Fiscal 2001 report; 2001 nendo Makurazaki shi chiiki shin energy vision sakutei tou chosa hokokusho

    NONE

    2002-02-01

    For promoting the introduction of new energy and for elevating people's consciousness of such in Makurazaki City, Kagoshima Prefecture, surveys and studies were conducted concerning the energy demand of the city, the amount of new energy resources in existence, and new energy introduction plans, and then a vision was formulated. The city's energy demand in fiscal 1999 is estimated at approximately 3,206 TJ, with the industrial sector demanding 1,820 TJ, the residential and commercial sector demanding 701 TJ, and the transportation sector demanding 684 TJ. Energy consuming industries in this prefecture are fisheries industry and food industry. Pilot projects for new energy introduction were discussed, which included the introduction of photovoltaic power into the city hall, primary and junior high schools, a school meal providing center, and a city-managed hospital; installation of hybrid power-lighted light at the city hall, along the Kedo river, and in the Hinokami park; introduction of a solar heat utilization system into a nursing home for elderly people; introduction of wind power into education facilities; conversion of waste of cooking oil into diesel fuel; introduction of clean energy vehicles into public service; and new energy projects to be contracted to the private sector. (NEDO)

  17. Report on the project on working out the new energy vision of Hisai City; 2001 nendo Hisai shi chiiki shin energy vision sakutei tou jigyo hokokusho

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Hisai City, Mie Prefecture, an investigational study was conducted of the energy demand structure, existence amount of new energy and project for new energy introduction, and a vision was worked out. The energy consumption amount of the city was 21,500 lorries in the industrial sector, 11,200 lorries in the transportation sector, 2,700 lorries in the business sector and 2,400 lorries in the residential sector in terms of tank-lorry loaded oil. As features, the following were cited: growth in the transportation sector, mostly in automobiles, was great; growth in the electric power consumption in the residential sector was great. As the project for new energy introduction, the following were supposed and studied in terms of the economical efficiency and environmental acceptability: introduction of cogeneration to hospital; introduction of ligneous biomass power generation to hospital; substitution of wood burning boiler for A heavy oil boiler for hot water supply use; introduction of photovoltaic power generation for home use and business use; introduction of solar heat use hot water supply device. (NEDO)

  18. Vneshnjaja politika Pol'shi i Kaliningradskaja oblast' v 1989—2012 godah [The foreign policy of Poland and the Kaliningrad region in 1989—2012

    Chełminiak Marcin

    2012-01-01

    Full Text Available This article sets out to analyse the role of the Kaliningrad region in the Polish foreign policy after 1989. The analysis focuses on the political and regional determinants, which had the greatest impact on the Poland-Kaliningrad region relations. The methodology used in the article is not unusual for political science and is based on analysing original (documents and secondary (scholarly publications, press articles sources. The authors also use the system and decision analysis methods. The analysis covers the period after 1989, when the geopolitical changes brought about by the collapse of the Yalta-Potsdam order resulted in Poland redefine the priorities of its foreign policy. One of the most important challenges for the Polish diplomacy after 1989 was the development of economic and political relations with the Russian Federation. Cross-border cooperation between Poland and the Kaliningrad Region is conducted, inter alia, through euroregional structures functioning in the border areas. The analysis of this issue is vital for further cooperation in the Polish-Russian borderland, especially after the conclusion of the local border traffic agreement in 2012. The authors come to a conclusion that the implementation of the local border traffic agreement can improve cross-border relations but it will not significantly change the role of the Kaliningrad region in the Polish foreign policy.

  19. AYAT-AYAT WAH}DAT AL-WUJUd dalam Kitab Tanbi>h al-Ma>shi Karya ‘Abdurrauf al-Sinkili

    Asep Nahrul Musadad

    2015-08-01

    Full Text Available Abstract: One of the key moments in discussing the history of Indonesian Islam is a polemic related to the negotiation on the doctrine of wahdat al-wujud that occured in Aceh in 17th century between the followers of Hamzah al-Fansuri and Nuruddin al-Raniri. This article focuses on analyzing several Qur’anic verses used by ‘Abdurrauf as the confirmation of his argument. In the polemical context, Abdurrauf al-Sinkili appeared to be an actor of reconciliation between two opposite sides. He tried to respond to the disputed issues through his book called “Tanbi>h al-Mashi”. As an exponent of the so-called moderate sufism (mysticism, he built the argument concerning wah}dat al-wujud based on the Quranic text. After making a thematic classification chronologically, his interpretation on these verses is analyzed by using Hussain al-Dhahaby’s theory of sufistic exegesis. In conclusion, it shows that ‘Abdurrauf’s commentary is “sufi-nazari type”, featured by his exegeses pattern. This, of course, represents his attitude as a reconciler who then needs to seek confirmation to the Qur’anic verses in evaluating wah}dat al-wujud doctrine, through which such a polemical issues occurred at that time. الملخص: إن من المرحلة الأساسية التي مرّ بها تاريخ الإسلام في اندونيسيا الجدل و النزاع حول عقيدة وحدة الوجود فى أتشيه (Aceh حول قرن السابع عشر بين أتباع حمزة الفنسوري و نور الدين الرانيري. ففي ذلك الخطاب النزاعي جاء عبد الرؤوف السنكيلي مصلحا بين الجانبين المعاكسين. وعلى مقتضى الظروف، كتب كتاب " تنبيه الماشي" الذي تطرّق فيه طريق التوسّط، ممثّلا للتصوّف المعتدل. اعتمد عبد الرؤوف على النصوص القرآنية فى تحقيق آراءه حول تناقضات وحدة الوجود. فهذه المقالة تطرح نفسها في تحليل الأيات القرآنية التي استخدمها عبد الرؤوف تأكيدا لحجته. بعد إجراء تصنيف موضوعي لتفسيره، سيتم التحليل باستخدام نظرية حسين الذهبي عن التفسير الصوفي. فيمكن القول بأن مادة تفسيره تدخل تحت لون "الصوفى النظري" التي ظهرت من قبل eisegesis (من النظرية الى النص. فهذا بالطبع يمثل على موقفه في الاعتدالية و باعتباره مصلحا، حتى يحتاج الى القرآن في التأكيد و التقييم للمسائل حول وحدة الوجود التي حدث من خلالها مثل هذا الجدل في ذلك الوقت. Abstrak: Salah satu momen kunci dalam perbincangan sejarah Islam Indonesia adalah polemik terkait negosiasi doktrin wah}dat al-wuju>d yang terjadi di Aceh pada abad ke-17 antara pengikut H{amzah al-Fansu>ri> dan Nu>r al-Di>n al-Ra>ni>ri>. Dalam konteks polemikal tersebut, Abdurrauf al-Sinkili muncul sebagai sosok rekonsiliator. Ia mencoba merespon pertikaian tersebut lewat kitabnya yang berjudul “Tanbi>h al-Ma>shi”. Sebagai eksponen tasawuf moderat, ia mendasarkan argumentasi terkait paham wah}dat al-wuju>d kepada al-Qur’an. Tulisan ini membincang ayat-ayat al-Qur’an yang digunakan sebagai konfirmasi dalam argumentasi Abdurrauf. Setelah dikelompokan secara tematik-kronologis, tafsiran Abdurrauf terhadap beberapa ayat al-Qur’an yang terkait wah}dat al-wuju>d dianalisis menggunakan teori tafsir sufistik Hussein al-Dhahaby. Secara konklusif dapat dikatakan bahwa uraian Abdurrauf tersebut merupakan sebuah tafsir sufistik versi “s}u>fi-naz}ari” yang menggunakan pola “eisegesis” (dari gagasan ke teks. Hal ini tentunya merepresentasikan sikapnya sebagai rekonsiliator yang kemudian merasa perlu untuk mencari konfirmasi terhadap ayat al-Qur’an dalam evaluasinya terhadap doktrin wah}dat al-wuju>d yang kontroversial ketika itu.  Keywords: Abdurrauf al-Sinkili, wah}dat al-wuju>d, rekonsiliasi, tafsir sufi

  20. Misunderstanding the Other and Shy Signs of Openness: Discourse on the 1992-1995 War in the Current Bosniak and Bosnian Serb Media

    Michal Janíčko

    2015-04-01

    Full Text Available The article deals with how the 1990s civil war in Bosnia and Herzegovina was represented in the media that currently remain influential among Bosniaks and Bosnian Serbs. Critical discourse analysis is used both as a theoretical approach to discourse and as a methodological tool for its study. In the analysis, the civil war discourse in Bosniak and Bosnian Serb media is represented by two daily newspapers on each side. The analysis reveals mutually incompatible representations of the causes and nature of the war, the prevailing absence of dialogue, and the unwillingness of each side to consider the other side’s war victims. Looking at more specific topics, a number of discourses are identified on both sides, among which some present the potential for dialogue with alternative representations. The discourses are interpreted through Bosniak and Bosnian Serb nationalist ideologies. The findings might support further research on the relation between the media and nationalism and on the ongoing Bosnian political dispute concerning the desired nature of the state.

  1. Regional new energy vision for Kakegawa City. Formulation survey report; 2001 nendo Kakegawa shi chiiki shin energy vision sakutei chosa hokokusho

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Kakegawa City, Shizuoka Prefecture, surveys and studies were conducted involving the energy demand of the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumes approximately 11,638 GJ/year, with the industrial sector consuming 4,896 GJ, the residential/commercial sector 3,608 GJ, and the transportation sector 3,134 GJ. Energy types are electric power, gas oil, heavy oil, gasoline, kerosene, LPG, and town gas, as listed in the descending order in terms of consumption rate. The amount of carbon dioxide resulting from the consumption is estimated at 673,214 t-CO2. Projects for new energy introduction were studied, which involved photovoltaic power generation for the general-purpose gymnasium, kindergartens, the school meal center, and meeting places; introduction of solar heat utilization systems into public facilities; financial support system for the purchase of solar heat utilization apparatuses; refuse-fueled power generation and heat utilization at a new cleaning center; utilization of biogas from garbage and stock raising waste; utilization of woody resources; clean-energy vehicles; and so on. (NEDO)

  2. Plans for promoting district energy-saving visions for City of Wakkanai; Wakkanai-shi chiiki sho energy vision suishin keikakusho

    NONE

    2001-02-01

    The district energy-saving visions and promotion plans therefor are drawn for City of Wakkanai, to promote energy saving and abatement of gas emissions which cause global warming. The conception of the energy-saving introduction project includes introduction of co-generation systems in the facilities of pivotal functions in the city center, and energy-saving systems in a municipal heated pool and public hot spring facilities. The facilities of pivotal functions in the city, e.g., the municipal office buildings, municipal hospital and all-around culture center of the city are supplied with heat in a centralized manner from the energy center, and the energy-saving effect is expected when co-generation systems are introduced in the energy center. The study results indicate that introduction of the co-generation systems in the energy center has a potential energy-saving effect of 2,400Gcal/y. The energy-saving effects are also analyzed for each of the municipal office buildings, municipal hospital, all-around culture center, municipal heated pool and public hot spring facilities, including those potentially realized by improving illumination and air supply/discharge facilities. (NEDO)

  3. Report on feasibility study of energy-saving visions for City of Mitaka; Mitaka-shi sho energy vision feasibility study hokokusho

    NONE

    2001-02-01

    The feasibility study is implemented to concretely promote the project for the (new energy/energy-saving visions for the City of Mitaka area) aimed at abatement of green effect gases which cause global warming, for which the public facilities are investigated to collect information related to the energy-saving project, and the implementation schemes are studied from the operational and fund aspects. A total of 60 public facilities in the city are studied for energy-saving potentials and their characteristics through the questionnaires and simulation, and placed in the order of priority. The project implementation simulation is conducted, to grasp the long-term energy-saving effect, energy cost reduction and CO2 abatement potentials, if the project is actually implemented. The studies on the 10 facilities indicate that power consumption can be possibly reduced by 1.45 million kWh in the initial year, and the accumulated introduction and abatement costs indicate that the project will produce the first profit of around 49 million yen in 2012. CO2 can be abated by 230 tons-C/year on the average during the 2008 to 2012 period. (NEDO)

  4. Site response variation due to the existence of near-field cracks based on strong motion records in the Shi-Wen river valley, southern Taiwan

    Wu, Chi-Shin; Yu, Teng-To; Peng, Wen-Fei; Yeh, Yeoin-Tein; Lin, Sih-Siao

    2014-10-01

    Site effect analysis has been applied to investigate soil classification, alluvium depth, and fracture detection, although the majority of previous studies have typically focused only on the response of large-scale single structures. In contrast, we investigated the site effect for small-scale cracks using a case study in southern Taiwan to provide a means of monitoring slope stability or foundation integrity in situ using only an accelerometer. We adopted both the reference site and horizontal-to-vertical spectral ratio methods. We obtained seismographs associated with the typhoon-related development of a crack set (52 m long, 5 m deep) in a steep slope and compared the resonance frequency between two conditions (with and without cracks). Moreover, we divided the seismic waves into P, S, and coda waves and examined the seismic source effect. Our results demonstrate that frequencies of 14.5-17.5 Hz are most sensitive to these cracks, particularly for the E-W component of the P-waves, which coincides with the crack’s strike. Peak ground acceleration, which is controlled by seismic moment and attenuated distance, is another important factor determining the resonance results. Our results demonstrate that the ratio of temporal seismic waves can be used to detect the existence of nearby subsurface cracks.

  5. Site response variation due to the existence of near-field cracks based on strong motion records in the Shi-Wen river valley, southern Taiwan

    Wu, Chi-Shin; Yu, Teng-To; Peng, Wen-Fei; Yeh, Yeoin-Tein; Lin, Sih-Siao

    2014-01-01

    Site effect analysis has been applied to investigate soil classification, alluvium depth, and fracture detection, although the majority of previous studies have typically focused only on the response of large-scale single structures. In contrast, we investigated the site effect for small-scale cracks using a case study in southern Taiwan to provide a means of monitoring slope stability or foundation integrity in situ using only an accelerometer. We adopted both the reference site and horizontal-to-vertical spectral ratio methods. We obtained seismographs associated with the typhoon-related development of a crack set (52 m long, 5 m deep) in a steep slope and compared the resonance frequency between two conditions (with and without cracks). Moreover, we divided the seismic waves into P, S, and coda waves and examined the seismic source effect. Our results demonstrate that frequencies of 14.5−17.5 Hz are most sensitive to these cracks, particularly for the E−W component of the P-waves, which coincides with the crack’s strike. Peak ground acceleration, which is controlled by seismic moment and attenuated distance, is another important factor determining the resonance results. Our results demonstrate that the ratio of temporal seismic waves can be used to detect the existence of nearby subsurface cracks. (paper)

  6. Response of bats to light with different spectra: light-shy and agile bat presence is affected by white and green, but not red light

    Spoelstra, K.; van Grunsven, Roy H. A.; Ramakers, J.J.C.; Ferguson, Kim B.; Raap, Thomas; Donners, Maurice; Veenendaal, Elmar M.; Visser, Marcel E.

    Artificial light at night has shown a remarkable increase over the past decades. Effects are reported for many species groups, and include changes in presence, behaviour, physiology and life-history traits. Among these, bats are strongly affected, and how bat species react to light is likely to vary

  7. New energy vision of the Sen'nan city area. Outline; 2001 nendo Sen'nan shi chiiki shin energy vision (Gaiyo ban)

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Sen'nan City, Osaka Prefecture, a new energy vision was worked out, and a version of the outline was made. The policy on new energy introduction was described as follows: to make a great use of solar energy; to promote the spread of low-emission car and other new energy; to construct a system for spread that is connected to cooperation with citizen and education/enlightenment. Concretely, the following were cited: introduction of photovoltaic power generation to the city office/elementary school/junior high school; study of preferential treatment for introduction of solar energy; introduction of low-emission car to official vehicle; study of preferential treatment for introduction of low-emission car; promotion of car sharing by low-emission car; introduction of natural gas cogeneration and fuel cell to the city office; installation of street light using small wind power generation; potential study of small- and medium-size power generation; support for class for new energy experience at elementary/junior high school; potential study of utilization of biomass energy such as bamboo charcoal; study of preferential treatment for new energy to be given to citizen and enterprises in the city; construction/support of energy utilization system using waste, etc. (NEDO)

  8. [History of population problems and their impact on daily lives: an interview with Ms. Haruko Hashimoto, an experienced midwife at Mitaka-shi. Interview by N. Yamashita].

    Hashimoto, H

    1981-03-01

    A Japanese midwife offered firsthand information and personal observations concerning population problems from 1935 to the present time. In prewar Japan except for some upper class women birth control was not exercised among the ordinary public. At the beginning of World War II a woman who produced 12 children received an award. Birth control was not included in the curriculum for midwives at that time. Postwar baby boom reached its peak around 1948, when the government recognized the need and launched the Eugenic Protection Law. The Eugenic Protection Law was amended a year later and it approved of financial reasons for abortion. By 1952 eugenic counseling became a part of public health clinic duties, and abortion was legalized. 1,170,000 cases of abortion were performed in Japan around 1955. Since abortion is harmful for mothers, the government installed the program called "birth control instructor" as a part of amended eugenic protection law. A birth control instructor license was given to the trained midwives, public health nurses, and nurses. Not only the central government but also local governments allocated funds for the family planning campaign. Around 1965 during the accelerated economic growth the government tried to change its position on family planning to encourage births to supply labor for the growing industries. Japanese people continued to limit their family size voluntarily for a better standard of living. Maternal/child Health Law was passed in 1965, and qualified midwives and public health nurses advocated and instructed family planning at the time of expectant mothers' and newborns' regular visits.

  9. New energy vision at Sabae City. Toward realization of 'environmental international city'; 2001 nendo Sabae shi chiiki shin energy vision. Kankyo kokusai toshi Sabae no jitsugen ni mukete

    NONE

    2002-03-01

    With an object of accelerating introduction of and uplifting consciousness on new energies at Sabae City in Fukui Prefecture, a new energy vision was put into order based on the result of the initial stage investigation having been performed in the previous fiscal year. Solar light and solar heat energies will be introduced positively into public facilities, and at the same time works will be implemented to accelerate the proliferation thereof into general households. The target of introduction by the year 2010y is set to 2,600 kW by photovoltaic power generation, and the introduction thereof is planned to schools, nursery schools, municipality operated houses, and unattended facilities. With regard to solar heat water warmer, the present proliferation rate of about 7.3% will be raised to 15%. Regarding wastes generated from industrial areas, efficient energy extraction by thermal recycling is intended on the assumption of suppression of wastes generation, their re-use, and recycling. Systems may include the bio-gas system, cogeneration, and recovery of energies from plastics wastes. For acceleration of proliferation of new energies in general, promotion of introduction will be achieved on mini-wind power generation, small hydroelectric power generation, and fuel cell automobiles. (NEDO)

  10. Report on feasibility study of district energy-saving and waste heat utilization for City of Iwai; Iwai-shi chiiki sho energy hainetsu riyo kanosei chosa hokokusho

    NONE

    2001-03-01

    As part of the (district energy-saving visions for City of Iwai), the feasibility study is implemented for citizen community facilities which utilize waste heat discharged from factories in the city. More concretely, those items studied include a heated pool, other community facilities and botanical garden of tropical plants which utilize waste heat of exhaust gas cooling water heated to around 70 degrees C by a desulfurization unit at a pulp factory. Case 1 includes the citizen community facilities (e.g., heated pool and bath facilities), and Case 2 includes a green house botanical garden, involving studies on facility scales, requirements of heat and recycling water, hot water supply, air conditioning, bath systems, and heating systems for green houses. It is estimated that the citizen community facilities have an energy saving effect of 640kL/y as fuel oil, which corresponds to saving of around 29 million yen/y, and CO2 abatement effect of 471t/y as carbon, and that the green house botanical garden has an energy saving effect of 669kL/y as fuel oil, which corresponds to saving of around 30 million yen/y, and CO2 abatement effect of 492t/y as carbon. (NEDO)

  11. Feng xian tai du yu jiao yu he zhi ye xuan ze xing wei: yi ge shi yan fang fa de yan jiu an li

    Ding, X.; Sun, Y.; Hartog, J.

    2009-01-01

    An experimental study on risk attitude and choice behavior of education and career This paper introduces a research on risk attitude and choice behavior of education and career. Using the experimental methods, this study focuses on testing the reliability and validity of risk attitude measurement.

  12. Effect of Land Use Change on Soil Carbon Storage over the Last 40 Years in the Shi Yang River Basin, China

    Shurong Yang

    2018-01-01

    Full Text Available Accounting for one quarter of China’s land area, the endorheic Shiyang River basin is a vast semi-arid to arid region in China’s northwest. Exploring the impact of changes in land use on this arid area’s carbon budget under global warming is a key component to global climate change research. Variation in the region’s soil carbon storage due to land use changes occurring between 1973 and 2012 was estimated. The results show that land use change has a significant impact on the soil carbon budget, with soil carbon storage having decreased by 3.89 Tg between 1973 and 2012. Grassland stored the greatest amount of soil carbon (114.34 Mg ha−1, whereas considerably lower carbon storage occurred in woodland (58.53 Mg ha−1, cropland (26.75 Mg ha−1 and unused land (13.47 Mg ha−1. Grasslands transformed into cropland, and woodlands degraded into grassland have substantially reduced soil carbon storage, suggesting that measures should be adopted to reverse this trend to improve soil productivity.

  13. Shy, but funny? Examining peer-valued characteristics as moderators of the associations between anxious-withdrawal and peer outcomes during early adolescence.

    Markovic, Andrea; Bowker, Julie C

    2015-04-01

    Research has revealed significant heterogeneity in the group-level peer outcomes associated with anxious-withdrawal, but little is known about possible sources of this heterogeneity during early adolescence. This study of 271 young adolescents (49 % female; M age = 11.54 years) examined whether the concurrent and short-term longitudinal (3 month period) associations between peer-nominated anxious-withdrawn behaviors and three group-level peer outcomes (overt victimization, peer acceptance, popularity) varied as a function of peer-valued characteristics (humor, prosocial behavior, physical attractiveness, athletic ability) and gender, after accounting for the effects of involvement in mutual friendships. Regression analyses revealed that the associations between anxious-withdrawal and peer outcomes were moderated by peer-valued characteristics and, in many cases, gender. For example, anxious-withdrawal was related positively to overt victimization for all adolescents who were high in prosocial behavior. But, anxious-withdrawal was related negatively to popularity for adolescent boys who were high in prosocial behavior and adolescent girls who were low in prosocial behavior. Anxious-withdrawal also predicted increases in acceptance for adolescent girls who were high in humor, but decreases in acceptance for adolescent boys who were high in humor. Several additional moderator effects were found for boys only. The findings highlight the importance of considering the unique constellation of characteristics displayed by anxious-withdrawn young adolescents in studies on peer experiences at the group-level of social complexity.

  14. Private I: The Protagonists in Lynne Rae Perkins' Newbery-Winning Novel Are Shy, Talented, and Extremely Thoughtful--Kind of Like the Author

    Barstow, Barb

    2006-01-01

    Lynne Rae Perkins is the author of "Criss Cross," which won the Newbery Medal, the nation's most prestigious prize for children's book. Perkins grew up in Cheswick, PA, near Pittsburgh, majored in printmaking at Penn State, and attended grad school at the University of Wisconsin-Milwaukee. She moved to Leelanau County, MI, in 1987 with her…

  15. FY 2000 Project report on survey for drawing district energy-saving visions for City of Ginowan; 2000 nendo Ginowan-shi sho energy vision sakutei chosa hokokusho

    NONE

    2001-02-01

    The Ginowan municipal energy-saving vision drawing committee is established. It is responsible for drawing the energy-saving visions for the city, to study the basic guidelines and promotion measures for energy saving and promote the energy-saving measures suitable for the local characteristics. The studied items include background of and basic guidelines for the plans, analysis of energy consumption, survey on energy-saving consciousness and actual situations, prediction of potentially saved energy, drawing of the basic plans for energy saving and plan implementation programs, and surveys on preceding examples. The action plans include green planning for and revamping of public facilities, green purchasing, energy-saving diagnosis, drawing the design guidelines for energy saving and environmental considerations in public facilities, introduction of low-pollution local transportation systems, drawing the environment-related technology lists, including energy saving, and promotion of clean energy vehicles. (NEDO)

  16. A systemic administration of liposomal curcumin inhibits radiation pneumonitis and sensitizes lung carcinoma to radiation

    Shi HS

    2012-05-01

    Full Text Available Hua-shan Shi1,* Xiang Gao,1,3,* Dan Li,1,* Qiong-wen Zhang,1 Yong-sheng Wang,2 Yu Zheng,1 Lu-Lu Cai,1 Ren-ming Zhong,2 Ao Rui,1 Zhi-yong Li,1 Hao Zheng,1 Xian-cheng Chen,1 Li-juan Chen,11State Key Laboratory of Biotherapy and Cancer Center, West China Hospital, West China Medicine School, Sichuan University, Chengdu, Sichuan, People's Republic of China; 2State Key Laboratory of Biotherapy and Department of Thoracic Oncology, West China Hospital, West China Medical School, Sichuan University, Chengdu, Sichuan, People's Republic of China; 3Deparment of Pathophysiology, College of Preclinical and Forensic Medical Sciences, Sichuan University, Chengdu, People's Republic of China*These authors contributed equally to this workAbstract: Radiation pneumonitis (RP is an important dose-limiting toxicity during thoracic radiotherapy. Previous investigations have shown that curcumin is used for the treatment of inflammatory conditions and cancer, suggesting that curcumin may prevent RP and sensitize cancer cells to irradiation. However, the clinical advancement of curcumin is limited by its poor water solubility and low bioavailability after oral administration. Here, a water-soluble liposomal curcumin system was developed to investigate its prevention and sensitizing effects by an intravenous administration manner in mice models. The results showed that liposomal curcumin inhibited nuclear factor-κB pathway and downregulated inflammatory factors including tumor necrosis factor-α, interleukin (IL-6, IL-8, and transforming growth factor-β induced by thoracic irradiation. Furthermore, the combined treatment with liposomal curcumin and radiotherapy increased intratumoral apoptosis and microvessel responses to irradiation in vivo. The significantly enhanced inhibition of tumor growth also was observed in a murine lung carcinoma (LL/2 model. There were no obvious toxicities observed in mice. The current results indicate that liposomal curcumin can effectively

  17. Codelivery of curcumin and doxorubicin by MPEG-PCL results in improved efficacy of systemically administered chemotherapy in mice with lung cancer

    Wang BL

    2013-09-01

    Full Text Available Bi-Lan Wang,1,* Yong-mei Shen,1,3,* Qiong-wen Zhang,1,* Yu-li Li,1 Min Luo,1 Ze Liu,1,2 Yan Li,1 Zhi-yong Qian,1 Xiang Gao,1 Hua-shan Shi1,2 1State Key Laboratory of Biotherapy and Cancer Center, West China Hospital, West China Medicine School, Sichuan University, Chengdu, Sichuan, 2State Key Laboratory of Biotherapy and Department of Head and Neck Oncology, West China Hospital, West China Medical School, Sichuan University, Chengdu, Sichuan, 3Sichuang Haoyisheng Pharmacy, Chengdu, People’s Republic of China *These authors contributed equally to this work Abstract: Systemic administration of chemotherapy for cancer often has toxic side effects, limiting the doses that can be used in its treatment. In this study, we developed methoxy poly(ethylene glycol-poly(caprolactone (MPEG-PCL micelles loaded with curcumin and doxorubicin (Cur-Dox/MPEG-PCL that were tolerated by recipient mice and had enhanced antitumor effects and fewer side effects. It was shown that these Cur-Dox/MPEG-PCL micelles could release curcumin and doxorubicin slowly in vitro. The long circulation time of MPEG-PCL micelles and the slow rate of release of curcumin and doxorubicin in vivo may help to maintain plasma concentrations of active drug. We also demonstrated that Cur-Dox/MPEG-PCL had improved antitumor effects both in vivo and in vitro. The mechanism by which Cur-Dox/MPEG-PCL micelles inhibit lung cancer might involve increased apoptosis of tumor cells and inhibition of tumor angiogenesis. We found advantages using Cur-Dox/MPEG-PCL micelles in the treatment of cancer, with Cur-Dox/MPEG-PCL achieving better inhibition of LL/2 lung cancer growth in vivo and in vitro. Our study indicates that Cur-Dox/MPEG-PCL micelles may be an effective treatment strategy for cancer in the future. Keywords: methoxy poly(ethylene glycol, poly(caprolactone, curcumin, doxorubicin, micelles, cancer, treatment

  18. Adubação verde e alterações nas características químicas de um Cambissolo na região de Ji-Paraná-RO Green manure and changes on chemical characteristics of a soil in the Ji-Paraná-RO region

    Elaine Almeida Delarmelinda

    2010-09-01

    Full Text Available A adubação verde promove benefícios nas características químicas, físicas e biológicas do solo. O trabalho avaliou o efeito da incorporação de diferentes adubos verdes nas características químicas de um Cambissolo háplico eutrófico. Foi utilizado o delineamento em blocos ao acaso, com oito tratamentos e três repetições. Os tratamentos consistiram das seguintes leguminosas: Calopogonium mucunoides, Crotalaria juncea, C. spectabilis, Cajanus cajan, Macrotyloma, Mucuna pruriens, Pueraria phaseoloides e a testemunha (sem leguminosa. As avaliações foram realizadas 60 dias após o corte e incorporação. A utilização de leguminosas como adubação verde proporcionou aumento nos teores de matéria orgânica, soma de bases e percentagem de saturação por bases, destacando-se a Pueraria phaseoloides, C. juncea e C. spectabilis.The green manure promotes benefits on the chemical, physical and biological properties of soil. The experiment evaluated the effect of incorporation of differents green manure on the chemistry characteristics of a soil. Experimental design used was a randomized block, with eight treatments and three replications. Treatments were: Calopogonium mucunoides, Crotalaria juncea, Crotalaria spectabilis, Cajanus cajan, Macrotyloma axillare, Mucuna pruriens and Pueraria phaseoloides and the treatment control (without leguminous. Evaluations of soil samplings were performed in 60 days after handling were performed. The results showed significant effects of the leguminous crop Pueraria phaseoloides, C. juncea and C. spectabilis on the fertility of the soil, with significant increments of organic matter, exchangeable bases and in the base saturation.

  19. FY 1999 report on the comprehensive analysis of the geothermal development promotion survey. Forth. No.C-3 Akinomiya area (Separate volume 1: Forth survey); 1999 nendo chinetsu kaihatsu sokushin chosa sogo kaiseki hokokusho. No. C-3 Akinomiya chiiki (Dai 4 ji) - Bessatsu 1 (Dai 4 ji chosa)

    NONE

    2001-01-01

    The paper reported the results of the long-term jetting test, etc. which were carried out as the forth survey of the geothermal development promotion survey in the Akinomiya area, Ogachi town, Akita prefecture. The jetting induction and the situation of production/reduction were described as follows. N9-AY-3 began to well spontaneously after being induced by sending air up to wellhead pressure of 4.8 MpaG. Damping was recognized for a month or so after the start of jetting. After that, however, no damping was recognized, nor was recognized the deterioration of the fluid enthalpy with age. The pH of geothermal water was definite, approximately 8, and the electric conductivity and Cl concentration were 8,500 {mu}S/cm and 2,600 mg/L, respectively. The maximum jetting capacity of N10-AY-8 was 10.4t/h in steam and 8.9t/h in geothermal water at wellhead pressure of 0.24 MPaG, and after that, it showed a tendency to lower. The flow rate of reduction of N8-AY-1 changed from 80-90t/h at the beginning to 60-70t/h. With the continued reduction, the lowering of reduction capacity was recognized. In the test, the following were carried out: temperature/pressure/spinner logging, test on pressure transition, survey of fluid properties, survey of jetting microseisms, etc. (NEDO)

  20. Projects of Earth Sciences Supported by National Natural Science Foundation of China

    2001-01-01

    and Chaotic Dynamics of Urban Systems\tCHEN Yan-guang 40071036\tDriving Force for Formation of Spatial Pattern of Natural Pinus Sylvestris var. Mongolica Forest in Eastern Inner Mongolia\tWANG Xiao-ke 40071037\tStudy on the Model of Two-core Structure in the Regional Development\tLU Yu-qi 40071038\tThe Agricultural Development and Its Effect on the Environment of the Xiliao River Valley during the Liao-Jin Period\tHAN Mao-li 40071039\tStudy on the Mechanism of Agricultural Sustainable Development and the Optimization of Industrial Structure in Bashang Plateau\tMA Li 40071040\tStudy of Forest Changes and Soil Erosion on the Upper Reaches of Yangtze River in Last 2000 Years\tLAN Yong 40071041\tThe Spatial Approach of Ecological Optimizing of City Landscape and Its Practice\tLI Gui-cai 40071042\tA Study on the Formation, Change and Sustainable Development of the Old Industrial Areas - A Case Study of Northeastern Region in China\tLI Guo-ping 40071043\tIntegration and Systematization of Mathematic Models for Soil and Water Resources Study in a Basin and Its Application\tZENG Zhi-yuan 40071044\tMonitoring and Modeling of the Eco-hydrological Processes in a Small Watershed in Yingtan, Jiangxi\tZHANG Bin 40071045\tSpatio-temporal Variation of Reconstructed Soil and Its Amelioration in Coal Mines\tHU Zhen-qi 40071046\tIn-situ Electrochemical Monitoring of Nutrients Leaching Loss in Red Soils after Input of Acid Deposition\tJIANG Xin 40071047\tThe Mechanisms of Nitrogen Loss Reduction by the Ammonia Inhibition Films in Paddy Soil\tYIN Bin 40071048\tComposition and Properties of Cutans in Several Soils and Forms and Transformation of Some Elements\tLIU Fan 40071049\tTwo-phase Reactions: A New Study on the Mechanisms of the Interactions of Humic Acids with Metal Ions\tWEI Shi-qiang 40071050\tStudies on Mechanisms of Bioremediation of Heavy Metal Contaminated Soil by Arbuacular Mycorrhiza\tLI Xiao-lin 40071051\tThe Reactions Between Multi-Nutrient Fertilizers and Soils and Their

  1. Discussion of "Carbon benefits of wolfberry plantation on secondary saline land in Jingtai oasis, Gansu - A case study on application of the CBP model" by Yaolin Wang, Chuanyan Zhao, Quanlin Ma, Yingke Li, Hujia Jing, Tao Sun, Eleanor Milne, Mark Easter, Keith Paustian, Hoi Wen Au Yong, John McDonagh (2015) [Journal of Environmental Management 157, 303-310].

    Azarnivand, Ali

    2015-12-01

    Wang et al. (2015) employed driving force-pressure-state-impact-response (DPSIR) framework to provide a robust decision-making structure for carbon emission reduction by use of wolfberry plantation in the Jingtai oasis, China. DPSIR appropriately identified the causes of problem along with adopting the responses to the barriers associated with wolfberry plantation. However, the discusser argues that, the paper could have prepared more viable outcomes, if the authors had used causal network rather than causal chains through the DPSIR framework. Furthermore, they could have quantified the mutual relationship among the relevant factors to provide a detailed economic assessment. With this knowledge in hand, the current discussion letter suggests eDPSIR and meDPSIR to address drawbacks regarding conventional DPSIR framework. Due to proper performance of eDPSIR and meDPSIR, they are recommended as practical tools in the future environmental studies. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Expert consensus on acute exacerbation of chronic obstructive pulmonary disease in the People's Republic of China

    Cai BQ

    2014-04-01

    Full Text Available Bai-qiang Cai,1 Shao-xi Cai,2 Rong-chang Chen,3 Li-ying Cui,4 Yu-lin Feng,5 Yu-tong Gu,6 Shao-guang Huang,7 Rong-yu Liu,8 Guang-nan Liu,9 Huan-zhong Shi,10 Yi Shi,11 Yuan-lin Song,6 Tie-ying Sun,12 Chang-zheng Wang,13 Jing-lan Wang,1 Fu-qiang Wen,5 Wei Xiao,14 Yong-jian Xu,15 Xi-xin Yan,16 Wan-zhen Yao,17 Qin Yu,18 Jing Zhang,6 Jin-ping Zheng,3 Jie Liu,6 Chun-xue Bai6 1Department of Pulmonary Medicine, Peking Union Medical College Hospital, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing, 2Southern Medical University South Hospital, Guangzhou, 3The First Affiliated Hospital of Guangzhou Medical College and Guangzhou Institute of Respiratory Diseases, Guangzhou, 4Affiliate Hospital of Inner Mongolia Medical University, Huhehaote, 5Huaxi Hospital of Sichuan University, Chendu, 6Zhongshan Hospital, Shanghai Medical College, Fudan University and Shanghai Respiratory Research Institute, Shanghai, 7Ruijing Hospital of Shanghai Jiaotong University, Shanghai, 8The First Affiliated University of Anhui Medical University, Hefei, 9The First Affiliated University of Guangxi Medical University, Nanning, 10Beijing Chao-Yang Hospital, Capital Medical University, Beijing, 11General Hospital of Nanjing Military Region, Nanjing, 12Beijing Hospital of the Ministry of Health, Beijing, 13Xinqiao Hospital, Third Military Medical University, Chongqing, 14Qilu Hospital of Shandong University, Jinan, 15Tongji Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan, 16The Second Affiliated Hospital of Hebei Medical University and Hebei Research Institute of Respiratory Medicine, Shijiazhuang, 17The Third Affiliated Hospital of Beijing University, Beijing, 18The First Affiliated University of Lanzhou University, Lanzhou, People's Republic of China Abstract: Chronic obstructive pulmonary disease (COPD is a common disease that severely threatens human health. Acute exacerbation of COPD (AECOPD is a major cause of

  3. The 2nd International Conference on Water Resource and Environment (WRE 2016

    Zhouli Liu

    2016-11-01

    Full Text Available Table of contents 01 The eco-toxicological effects of cadmium stress on five ornamental plants Zhouli Liu, Wei Chen, Xingyuan He, Shuai Yu, Weihang Ding 02 Study on the formation and release mechanisms of hydrogen sulfide in Longtan coal mine Jianjun Liu, Yuliang Wu, Kaixiang Fan 03 Coral bleaching in the North Reef of China’s Xisha Islands in 2014 Yuanchao Li, Xinqing Zheng, Shiquan Chen, Haiqun Xie 04 Soil chemical characteristics in a Cunninghamia lanceolata stand suffering from ice-snow damage Jie Li, Zhuomin Wang, Li Xue 05 Diversity of understory vegetation was under a Cunninghamia lanceolata stand suffering from ice-snow damage Zhiyang Lie, Weilong Huang, Tongtong Zhou, Li Xue 06 The effect of water, nitrogen and harvesting time on yield and biomass allocation of Helianthus tuberosus L. Kai Gao, Tiexia Zhu 07 The vertical variation of microbial communities in the sediment of sea cucumber pond Weiteng Mao, Pei Yu, Xinfang Lv, Yunchun Li 08 Indicating significances of alpine plant functional groups to environmental change Peixi Su, Rui Shi 09 Research on the daily CH4 fluxes of soil in summer mangrove community at Yingluogang of Guangxi, China Yong Jiang, Xingbin Chen, Shichu liang 10 Beach protection structures in middle and lower reaches of Yangtze River Junfeng Xu 11 Social responsibility management of large dam project with owner as core: an empirical case in China Jiwei Zhu, Zhao Zhai, Linan Zhou, Yun Le, Li Cao 12 The ecological function value assessment analysis of urban waterfront Jiwei Zhu, Ping Lu, Zhiqian Huang, Bei Zhou 13 Mechanism of diurnal osmotic potential changes and adjustment of three Caragana species in different habitats of the Inner Mongolia Plateau Zhirong Zheng, Shihai Lv, Chaoyang Feng 14 Biodiversity of phytoplankton and environmental influences analysis of Longfeng Wetland, China Nan Song, Yan Liu, Xinxin Lu, Yawen Fan 15 The effect of human activities on culturable soil microbes from Yaoquan Mountain in

  4. Biocompatibility of chitosan-coated iron oxide nanoparticles with osteoblast cells

    Shi S

    2012-10-01

    Full Text Available Si-Feng Shi,1 Jing-Fu Jia,2 Xiao-Kui Guo,3 Ya-Ping Zhao,2 De-Sheng Chen,1 Yong-Yuan Guo,1 Tao Cheng,1 Xian-Long Zhang11Department of Orthopedic Surgery, Shanghai Sixth People’s Hospital, School of Medicine, 2School of Chemistry and Chemical Technology, 3Department of Medical Microbiology and Parasitology, School of Medicine, Shanghai Jiao Tong University Shanghai, ChinaBackground: Bone disorders (including osteoporosis, loosening of a prosthesis, and bone infections are of great concern to the medical community and are difficult to cure. Therapies are available to treat such diseases, but all have drawbacks and are not specifically targeted to the site of disease. Chitosan is widely used in the biomedical community, including for orthopedic applications. The aim of the present study was to coat chitosan onto iron oxide nanoparticles and to determine its effect on the proliferation and differentiation of osteoblasts.Methods: Nanoparticles were characterized using transmission electron microscopy, dynamic light scattering, x-ray diffraction, zeta potential, and vibrating sample magnetometry. Uptake of nanoparticles by osteoblasts was studied by transmission electron microscopy and Prussian blue staining. Viability and proliferation of osteoblasts were measured in the presence of uncoated iron oxide magnetic nanoparticles or those coated with chitosan. Lactate dehydrogenase, alkaline phosphatase, total protein synthesis, and extracellular calcium deposition was studied in the presence of the nanoparticles.Results: Chitosan-coated iron oxide nanoparticles enhanced osteoblast proliferation, decreased cell membrane damage, and promoted cell differentiation, as indicated by an increase in alkaline phosphatase and extracellular calcium deposition. Chitosan-coated iron oxide nanoparticles showed good compatibility with osteoblasts.Conclusion: Further research is necessary to optimize magnetic nanoparticles for the treatment of bone disease

  5. Changing patient safety culture in China: a case study of an experimental Chinese hospital from a comparative perspective

    Xu XP

    2018-05-01

    Full Text Available Xiao Ping Xu,* Dong Ning Deng,* Yong Hong Gu, Chui Shan Ng, Xiao Cai, Jun Xu, Xin Shi Zhang, Dong Ge Ke, Qian Hui Yu, Chi Kuen Chan Clinical Service Department, The University of Hong Kong - Shenzhen Hospital, Shenzhen, Guangdong, People’s Republic of China *These authors contributed equally to this work Background: The World Health Organization highlights that patient safety interventions are not lacking but that the local context affects their successful implementation. Increasing attention is being paid to patient safety in Mainland China, yet few studies focus on patient safety in organizations with mixed cultures. This paper evaluates the current patient safety culture in an experimental Chinese hospital with a Hong Kong hospital management culture, and it aims to explore the application of Hong Kong’s patient safety strategies in the context of Mainland China. Methods: A quantitative survey of 307 hospital staff members was conducted using the Hospital Survey on Patient Safety Culture questionnaire. The findings were compared with a similar study on general Chinese hospitals and were appraised with reference to the Manchester Patient Safety Framework. Results: Lower scores were observed among participants with the following characteristics: males, doctors, those with more work experience, those with higher education, and those from the general practice and otolaryngology departments. However, the case study hospital achieved better scores in management expectations, actions and support for patient safety, incident reporting and communication, and teamwork within units. Its weaknesses were related to non-punitive responses to errors, teamwork across units, and staffing. Conclusions: The case study hospital contributes to a changing patient safety culture in Mainland China, yet its patient safety culture remains mostly bureaucratic. Further efforts could be made to deepen the staff’s patient safety culture mind-set, to realize a

  6. Sudden loss of the deep brain stimulation effect with high impedance without macroscopic fracture: a case report and review of the published literature

    Yang HJ

    2015-07-01

    Full Text Available Hui-Jun Yang,1 Ji Young Yun,2 Young Eun Kim,3 Yong Hoon Lim,4 Han-Joon Kim,5 Sun Ha Paek,4 Beom S Jeon5 1Department of Neurology, Ulsan University Hospital, Ulsan, 2Department of Neurology, Ewha Womans University Mokdong Hospital, Seoul, 3Department of Neurology, Hallym University Sacred Heart Hospital, Anyang, 4Department of Neurosurgery, Seoul National University Hospital, Seoul, 5Department of Neurology and Movement Disorder Center, Parkinson’s Disease Study Group and Neuroscience Research Institute, Seoul National University Hospital, Seoul, South Korea Abstract: The number of deep brain stimulation (DBS hardware complications has increased during the past decade. In cases of abnormally high lead impedance with no evidence of a macroscopic fracture, optimal treatment options have not yet been established. Here, we present the case of a 49-year-old woman with a 12-year history of Parkinson’s disease who received bilateral subthalamic nucleus DBS in March 2006. The patient showed good control of parkinsonism until December 24, 2010, when she awoke with abrupt worsening of parkinsonian symptoms. At telemetric testing, lead impedances were found at >2,000 Ω in all four leads on the left side. Fracture of a lead or an extension wire was suspected. However, radiological screening and palpation revealed no macroscopic fracture. In June 2011, the implantable pulse generator (IPG was changed under local anesthesia without any complications. Postoperatively, her parkinsonism immediately improved to the previous level, and the lead impedance readings by telemetry were also normalized. The disconnection of the neurostimulator connector block and the hybrid circuit board of the IPG was confirmed by destructive analysis. The present report illustrates that a staged approach that starts with simple IPG replacement can be an option for some cases of acute DBS effect loss with high impedance, when radiological findings are normal, thereby sparing the

  7. Review of the genus Pentacentrus Saussure (Orthoptera: Gryllidae: Pentacentrinae) from China .

    Liu, Hao-Yu; Mao, Shao-Li; Shi, Fu-Ming

    2014-07-22

    Four new species of Pentacentrus Gorochov from China are described and illustrated, P. acutiparamerus Liu & Shi sp. nov., P. biflexuous Liu & Shi sp. nov., P. emarginatus Liu & Shi sp. nov. and P. parvulus Liu & Shi sp. nov. A key and a distribution map of the Chinese species of this genus are provided.

  8. Differentiating Social Phobia from Shyness

    Heiser, Nancy A.; Turner, Samuel M.; Beidel, Deborah C.; Roberson-Nay, Roxann

    2008-01-01

    To clarify the relationship between social phobia and shyness, this study examined the characteristics of highly shy persons with social phobia, highly shy persons without social phobia, and non-shy persons. Those with social phobia reported more symptomatology, more functional impairment, and a lower quality of life than those without social phobia. About one-third of the highly shy without social phobia reported no social fears, highlighting heterogeneity of the shy. The social phobia group...

  9. Several Common Grounds of Liu Zhi-ji and Zhang Xue-cheng in Their Historical Criticism%刘知幾与章学诚史学批评理论中的几个共通面向

    张泓林; 毕兵

    2014-01-01

    Liu Zhiji’ s General History and Zhang Xuecheng ’ s General Principles of Literature and History born several common grounds in historical philosophy such as the relationship between history and literature , the principles and the methods of historical criticism and the self-cultivation of historians .They were particularly complementary and rever-berant in terms of recording the truth without fear or favor , viewing history dialectically and having an insight into the society and human being , thus pioneering a wide range of topics on the research of history and historical philosophy . Meanwhile , by putting forward concepts from the “three accomplishments of historians” to“historians ’ morality” and the “duty” of historians themselves , they not only provided the standard for the historians themselves , but also provid-ed a reference standard for later historians to continue to reflect and improve their self -cultivation .%章学诚的《文史通义》与刘知幾的《史通》在史文关系、史学批评原则与方法、史家自身修养上的总结达到了史学理论的共通面向,尤其是双方在秉笔直书、辨证史义、论世知人等方面的史学批评理论的互补与融合,为后世史学、史学理论的发展开辟了广阔的研究领域。同时,二人关于“史学三长”到“史德”概念的发展衍变及对史家自身“天职”问题的探讨,不仅为史家自身批评素养理论提供了准绳,更是为后世史家不断反思和提高自身修养提供了参考标准。

  10. Krovy z pomezí jižních Čech a Moravy inspirované úspornými návrhy Michaela Ranka

    Bláha, Jiří

    2010-01-01

    Roč. 17, č. 1 (2010), s. 67-82 ISSN 1212-1487 Institutional research plan: CEZ:AV0Z20710524 Keywords : timber roofs * carpenter * dendrochronology Subject RIV: AL - Art, Architecture, Cultural Heritage www.pruzkumypamatek.cz

  11. General evaluation survey report on fiscal 1998 investigation of geothermal development and promotion. No.C-3 Akinomiya area (Third); 1998 nendo chinetsu kaihatsu sokushin chosa sogo hyoka chosa hokokusho. No.C-3. Akinomiya chiiki (dai 3 ji)

    NONE

    2000-01-01

    With Akinomiya area (11.4 km{sup 2}) selected in Akita prefecture as the survey C area in fiscal 1996, the first survey was conducted. This paper is a summary of memorandum from an advisory standpoint on the evaluation survey concerning the fiscal 1998 investigation results. The contents of the survey are geological investigation, precision gravity exploration, soil gas investigation, electromagnetic exploration, fluid chemical investigation, well drilling and short-term eruption test. An alteration zone was recognized around the place where clay minerals used to be mined, with the center of the zone situated 500-600 m east of a fault. The alteration condition of Akinomiya area seems to be different from that of Doroyu Wasabisawa area. The supplementary gravity survey was carried out at total 58 points in fiscal 1998. It is desirable to set supplementary measuring points over a wide surrounding area for a depth structure analysis. Also performed was a study of mercury concentration in the soil gas. While CSAMT and TDEM methods were employed for the electromagnetic exploration, a suitable method should be carefully selected for a wide area high-density exploration. Consistency with adjacent areas is essential in preparing investigation items particularly for a geothermal model. (NEDO)

  12. FY 1998 report on the comprehensive analysis in the geothermal development promotion survey. Tertiary. No.C-3 Akinomiya area; 1998 nendo chinetsu kaihatsu sokushin chosa sogo kaiseki hokokusho. No.C-3 Akinomiya chiiki (Dai 3 ji)

    NONE

    2000-01-01

    The geothermal development promotion survey was conducted in the Akinomiya area, Ogachi county, Akita prefecture, and the FY 1998 results were summed up. In the surface survey, geology/electromagnetism/precision gravity survey was made as supplementary survey, and re-analysis of 3D models was made. In the well survey, three wells of N10-AY-6 to N10-AY-8 were drilled to conduct the core examination, temperature/pressure logging, sampler logging, short-term jetting test, etc. Also conducted were the reservoir evaluation, environmental effect survey, etc. by pressure monitoring and water level observation. The results of the comprehensive analysis predict the following. In the Akinomiya area, there exists heat source in deep parts around Mt. Yamabushi-dake and Mt. Takamatsu-dake; Being given heat from this heat source, rocks, ground water and volcanic gas react on each other to form geothermal fluids. It is presumed that high temperature geothermal reservoirs exist in the east of the area. Moreover, the pressure distribution indicates that the Akinomiya reservoir and Wasabizawa reservoir can be a chain hydraulically. On the other hand, the west of the area is the low temperature and heat conductive area, and therefore, there seem to be no high temperature fluids there. (NEDO)

  13. FY 2000 report on the results of the data processing in the geothermal development promotion survey. Tertiary. No.B-7 Kuwanosawa area; 2000 nendo chinetsu kaihatsu sokushin chosa data shori hokokusho. No. B-7 Kuwanosawa chiiki (Dai 3 ji)

    NONE

    2002-01-01

    The comprehensive analysis was conducted of various data obtained in the geothermal development promotion survey conducted in the Kuwanosawa area, Yuzawa city, Akita prefecture, from FY 1998 to FY 2000. The geology of the Kuwanosawa area consists of the Pretertiary system and Quarternary system, through which intrusive rocks are recognized. Basement rocks are composed of the Paleozoic-origin crystalline schist and the Cretaceous-period granites which intruded into the schist. In the Kuwanosawa area, there were recognized no clear geothermal signs such as the discharge of geothermal fluids like hot spring, fumarolic gas, etc., places of high temperature and new geothermal alteration zones. The geothermal water of borehole N11-KN-1 is a low temperature/low CL concentration geothermal water which was stored in basement rocks, which is supposed to be the one conductively heated in the process of the meteoric water penetrating deep-underground. The geothermal system heat source in the Kuwanosawa area and the periphery is regarded as the relic magma which spewed out the volcanic rocks of Mt. Takamatsu-dake in the Quaternary period. However, the geothermal fluid included no components originating in high temperature volcanic emissions, and therefore, it is considered that the geothermal fluid was formed by the meteoric water conductively heated by volcanic heat source. (NEDO)

  14. Rostlinné zbytky ze zaniklé studny. Svědci historie Jiřského náměstí na Pražském hradu ve 13. století

    Čulíková, Věra

    2012-01-01

    Roč. 64, č. 3 (2012), s. 479-502 ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeobotany * Middle Ages * Prague Castle * carpological analysis * well Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Džin čtení : S Jiřím Trávníčkem o překračování hranic textu

    Trávníček, Jiří

    2007-01-01

    Roč. 3, č. 48 (2007), s. 15 ISSN 1801-4542 Institutional research plan: CEZ:AV0Z90560517 Keywords : Contemporary Theory of Literature * Czech Situation Subject RIV: AJ - Letters, Mass-media, Audiovision

  16. Lithný granit ve vrtu Lysina-V1 v jižní části Slavkovského lesa, západní Čechy

    Štědrá, V.; Jarchovský, T.; Krám, Pavel

    2016-01-01

    Roč. 49, aug (2016), s. 137-142 ISSN 0514-8057 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : geochemistry * Catchment * petrology * Slavkov Forest * core boreholes * Karlovy Vary Massif * Lysina granite * Li- and Rb-enriched granite Subject RIV: DD - Geochemistry

  17. Sídliště a pohřeb kultury s vypíchanou keramikou v Dětenicích, okr. Jičín

    Novák, R.; Šída, P.; Kubálek, P.; Nývltová Fišáková, Miriam

    2017-01-01

    Roč. 21, č. 2 (2017), s. 529-554 ISSN 1214-3553 Institutional support: RVO:68081758 Keywords : neolithic * stroked pottery culture * settlement area * burial Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology

  18. Vítejte v ráji simulantů. Systém nemocenské stále vybízí ke zneužívání

    Münich, Daniel

    2004-01-01

    Roč. 15, č. 11 (2004), s. 9-9 ISSN 0862-6545 R&D Projects: GA ČR GA403/03/0340; GA AV ČR KSK9058117 Institutional research plan: CEZ:AV0Z7085904 Keywords : sick pay system Subject RIV: AH - Economics

  19. FY 2000 report on the investigation of environmental effects in the geothermal development promotion survey. Tertiary. No.B-7 Kuwanosawa area; 2000 nendo chinetsu kaihatsu sokushin chosa. Kankyo eikyo chosa hokokusho - No. B-7 Kuwanosawa chiiki (Dai 3 ji)

    NONE

    2002-01-01

    In the Kuwanosawa area, Yuzawa city, Akita prefecture, survey was conducted to grasp effects of drilling for structural boring in the geothermal survey on the peripheral environment. In the survey of animals, there were 5 orders/10 families/19 species of mammals and 10 orders/25 families/73 species of birds. Three kinds of precious animals were confirmed. There were 132 families/6,670 species in the flora. Three kinds of precious plants and three kinds of precious floras were confirmed. During the survey, drilling for structural boring was conducted. At three spas for survey, there were recognized some survey items of which there were great fluctuations. However, those are seasonal valuations or valuations related to the situation of the inside of hot springs. It is not recognized that the fluctuations were caused by the drilling work and pumping-up of geothermal water. The noise made during the well drilling was reduced around the well as theoretical values indicated. At a spot 200m away from the well, the noise was reduced from the environmental standard, and accordingly, it seems that there are few effects on the peripheral environment. The vibration was reduced around the well more than theoretical values indicated. That was below the control level at a spot 25m away from the well, and it seems that there are few effects on the peripheral environment. (NEDO)

  20. První nález svrchněkarbonské fauny v jižní části žihelské pánve (Český masiv)

    Zajíc, Jaroslav

    2013-01-01

    Roč. 2012, Prosinec (2013), s. 206-207 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30130516 Institutional support: RVO:67985831 Keywords : Žihle Basin * Stephanian B * Mšec Member * palaeontology Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2012/Zpravy_2012-41.pdf

  1. FY 1999 report on the comprehensive analysis of the geothermal development promotion survey. Forth. No.C-3 Akinomiya area; 1999 nendo chinetsu kaihatsu sokushin chosa sogo kaiseki hokokusho. No. C-3 Akinomiya chiiki (Dai 4 ji)

    NONE

    2001-01-01

    As part of the geothermal development promotion survey, the comprehensive analysis was made on the survey of the existence amount of geothermal resource in the Akinomiya area, Ogachi town, Akita prefecture, which was conducted in FY 1999. In the evaluation of reservoirs, the following were carried out: comprehensive analysis of various data on the surface survey, well exploration, etc., which were stored in surveys from the primary to the forth, modification/construction of geothermal system models, numerical simulation using 3D models, etc. In the long-term jetting test, production/reduction tests were conducted using N9-AY-3 and N10-AY-8 as production wells and N8-AY-1 and N10-AY-6 as reduction wells. The results of the comprehensive analysis were outlined as follows. The distribution of high temperature zones promising as areas for geothermal development was grasped. The distribution of the main fracture structure underground was grasped. A total amount of 124t/h steam was confirmed by short/long term jetting tests. In the simulation of prediction of production, the result was obtained that there was potential power generation of 30MW in the Akinomiya area alone and 60MW both in the Akinomiya area and the Wasabizawa area. (NEDO)

  2. Systémově dynamický model pro podporu řízení destinace cestovního ruchu jižní Čechy

    Petr Štumpf

    2017-12-01

    Full Text Available The aim of this paper was to propose a system model that will lead to an efficient participation of a destination management organization (DMO on the management of a tourism destination and will help to reach a consensus among stakeholders. It means a high efficiency of the Hospitality & Tourism industry, as well as a high level of visitors̕ satisfaction, low level of residents̕ irritation and a preservation of a cultural and natural potential of a tourism destination. The computer simulation model, which enables policy testing and the scenario analyses of the future development based on various policies and decisions, are presented in this paper. The main methodological approach used in this paper was system dynamics. This method helped to reveal the complexity of a tourism system and to identify connections among a number of stakeholders in a tourism destination. This method, which is based on the computer simulations, enabled not only the economic impacts evaluation, but also to reveal the sociocultural and environmental relations in a complex organism such as tourism destination. The system dynamics model was developed for the Region of South Bohemia, which is one of the leading tourism destinations in the Czech Republic. The model has also allowed an application of conditions for tourism development from neighbour Region of Upper Austria for a comparison of various tourism policies.

  3. Chřest přeslenitý (Asparagus verticillatus) lokálně zdomácnělý na jižní Moravě

    Danihelka, Jiří; Chytrý, K.; Prokešová, H.; Sedláček, V.

    2017-01-01

    Roč. 52, č. 2 (2017), s. 155-162 ISSN 1211-5258 R&D Projects: GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : Asparagaceae * distribution * garden escape * introduced species * neophyte * phytogeography Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany

  4. Polemika vzbuzující naději na konsenzus. Reakce na polemiku Rudolfa Pomazala s publikací České vysoké školství na křižovatce

    Matějů, Petr

    2006-01-01

    Roč. 42, č. 4 (2006), s. 786-790 ISSN 0038-0288 R&D Projects: GA AV ČR IBS7028302; GA MPS 1J/005/04-DP2 Institutional research plan: CEZ:AV0Z70280505 Keywords : tertiary education * university * equity Subject RIV: AO - Sociology, Demography Impact factor: 0.128, year: 2006

  5. Vyšetření komárů na přítomnost arbovirů na jižní Moravě v letech 2006-2008

    Kazdová, Klára; Hubálek, Zdeněk

    2010-01-01

    Roč. 59, č. 3 (2010), s. 107-111 ISSN 1210-7913 EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z60930519 Keywords : mosquito -borne viruses * West Nile virus * Ťahyňa virus * cell cultures Subject RIV: EE - Microbiology, Virology

  6. FY 1999 report on the data processing of the geothermal development promotion survey. No. B-6 Tsujinodake area (Tertiary); 1999 nendo chinetsu kaihatsu sokushin chosa data shori hokokusho. No.B-6 Tsujinodake chiiki (dai 3 ji)

    NONE

    2001-01-01

    For the purpose of confirming the existence of geothermal reservoirs, this survey was conducted as Survey B in the range of 30km{sup 2} east of Lake Ikeda at the south east end of Satsuma Peninsula, Kagoshima pref. from FY 1997 to FY 1999. By the geology/alteration zone survey, fluid geochemical survey, electromagnetic survey and gravity survey which were conducted in FY 1997 as surface survey, the following three were extracted as the areas which have great potentiality of geothermal resource existence: 1) area along the Yamakawa-Matsugakubo structure line on which calderas and explosion craters lie (north part); 2) area along the Takeyama-Tsujinodake structure line on which Ata central dome volcanic rocks lie (central part); 3) area around Kozukahama where the south wall of the Ata caldera extends in east-west direction (south part). In the survey after that, in north part, it was considered that aquicludes in clayey alteration zone were widely distributed around levels of 100m above - 200m below sea level and there existed geothermal reservoirs under the aquicludes. It was presumed that the mixed water of sea water and surface water was thermally conducted by heat sources of 300-490 degrees C and geothermal reservoirs of 260-270 degrees C were formed. (NEDO)

  7. Prorocké gesto Holečkových Našich a jeho reflexe v kulturní paměti jižních Čech

    Hrdina, Martin

    2018-01-01

    Roč. 66, č. 1 (2018), s. 70-92 ISSN 0009-0468 R&D Projects: GA ČR(CZ) GA17-11309S Institutional support: RVO:68378068 Keywords : Josef Holeček * purpose novel * agrarian reform * Petr Chelčický * Jesus Christ * Kubata Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  8. 26. setkání Archeologické pracovní skupiny východní Bavorsko/západní a jižní Čechy/Horní Rakousko

    Chytráček, Miloslav

    2017-01-01

    Roč. 69, č. 4 (2017), s. 674-675 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : archaeology * East Bavaria * West and South Bohemia * Upper Austria Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. FY 2000 report on the geothermal development promotion survey - No.C-4 Shiro-mizukoshi area. Resource survey (Primary); 2000 nendo chinetsu kaihatsu sokushin chosa. No. C-4 Shiromizukoshi chiiki shigen chosa hokokusho (Dai 1 ji)

    NONE

    2002-01-01

    As a part of the FY 2000 geothermal development promotion survey, survey was conducted in the Shiro-mizukoshi area (about 10km{sup 2}), Kagoshima prefecture, the gradually-inclined area located at the southwest foot of Volcano Kirishima, and the results were summed up. In the survey, the following were carried out: surface survey such as geology/alteration zone/fracture system, high-density gravity exploration, electromagnetic exploration, geochemical fluid survey, core test by drilling three exploration boreholes, temperature log, temperature recovery test, water injection test, short-term jetting test, etc. N12-SZ-1 came across the reservoir associated with the ENE-WSW system fault at a depth of 1,085m. The result of the temperature log and the geochemical temperature indicated that the temperature of the reservoir was between 230 and 240 degrees C. However, the reservoir was regarded as the vapor heating reservoir heated by the high-temperature vapor which is thought to be the shallow ground water separated from the deep reservoir. N12-SZ-2 was a large lost circulation zone at a depth between 1,325 and 1,486m, which indicated that N12-SZ-2 came across the ENE-WSW system Shiro-mizukoshi fault. N12-SZ-3 seems to be the area into which ground water flows. (NEDO)

  10. Vápnité nanofosilie a stratigrafie nejmladších křídových sedimentů na území Jičína

    Svobodová, Andrea; Košťák, M.

    2016-01-01

    Roč. 49, č. 1 (2016), s. 13-18 ISSN 0514-8057 Institutional support: RVO:67985831 Keywords : Upper Turonian * calcareous nannofossils * Bohemian Cretaceous Basin Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/img/zpravyvyzkum/fulltext/01_Svobodova_160511.pdf

  11. Effect of maternal multiple micronutrient vs iron-folic acid supplementation on infant mortality and adverse birth outcomes in rural Bangladesh: the JiVitA-3 randomized trial.

    West, Keith P; Shamim, Abu Ahmed; Mehra, Sucheta; Labrique, Alain B; Ali, Hasmot; Shaikh, Saijuddin; Klemm, Rolf D W; Wu, Lee S-F; Mitra, Maithilee; Haque, Rezwanul; Hanif, Abu A M; Massie, Allan B; Merrill, Rebecca Day; Schulze, Kerry J; Christian, Parul

    Maternal micronutrient deficiencies may adversely affect fetal and infant health, yet there is insufficient evidence of effects on these outcomes to guide antenatal micronutrient supplementation in South Asia. To assess effects of antenatal multiple micronutrient vs iron-folic acid supplementation on 6-month infant mortality and adverse birth outcomes. Cluster randomized, double-masked trial in Bangladesh, with pregnancy surveillance starting December 4, 2007, and recruitment on January 11, 2008. Six-month infant follow-up ended August 30, 2012. Surveillance included 127,282 women; 44,567 became pregnant and were included in the analysis and delivered 28,516 live-born infants. Median gestation at enrollment was 9 weeks (interquartile range, 7-12). Women were provided supplements containing 15 micronutrients or iron-folic acid alone, taken daily from early pregnancy to 12 weeks postpartum. The primary outcome was all-cause infant mortality through 6 months (180 days). Prespecified secondary outcomes in this analysis included stillbirth, preterm birth (<37 weeks), and low birth weight (<2500 g). To maintain overall significance of α = .05, a Bonferroni-corrected α = .01 was calculated to evaluate statistical significance of primary and 4 secondary risk outcomes (.05/5). Among the 22,405 pregnancies in the multiple micronutrient group and the 22,162 pregnancies in the iron-folic acid group, there were 14,374 and 14,142 live-born infants, respectively, included in the analysis. At 6 months, multiple micronutrients did not significantly reduce infant mortality; there were 764 deaths (54.0 per 1000 live births) in the iron-folic acid group and 741 deaths (51.6 per 1000 live births) in the multiple micronutrient group (relative risk [RR], 0.95; 95% CI, 0.86-1.06). Multiple micronutrient supplementation resulted in a non-statistically significant reduction in stillbirths (43.1 vs 48.2 per 1000 births; RR, 0.89; 95% CI, 0.81-0.99; P = .02) and significant reductions in preterm births (18.6 vs 21.8 per 100 live births; RR, 0.85; 95% CI, 0.80-0.91; P < .001) and low birth weight (40.2 vs 45.7 per 100 live births; RR, 0.88; 95% CI, 0.85-0.91; P < .001). In Bangladesh, antenatal multiple micronutrient compared with iron-folic acid supplementation did not reduce all-cause infant mortality to age 6 months but resulted in a non-statistically significant reduction in stillbirths and significant reductions in preterm births and low birth weight. clinicaltrials.gov Identifier: NCT00860470.

  12. Společenstvo bakterií oxidujících metan v půdě zimoviště skotu (farma Borová, jižní Čechy)

    Nitkulincová, Andrea; Chroňáková, Alica; Kahounová, Ludmila; Šimek, Miloslav

    2010-01-01

    Roč. 9, č. 1 (2010), s. 42-49 ISSN 1336-1120 R&D Projects: GA MŠk LC06066; GA ČR GA206/09/1642; GA ČR GA526/09/1570 Institutional research plan: CEZ:AV0Z60660521 Keywords : methane oxidizing bacteria * upland pasture soil * CARD-FISH Subject RIV: EH - Ecology, Behaviour

  13. Geofyzikální výzkum tvaru vulkanických těles v oblasti mezi Jičínem a Turnovem (Český ráj)

    Rapprich, V.; Skácelová, Z.; Valenta, Jan

    2011-01-01

    Roč. 44, - (2011), s. 263-266 ISSN 0514-8057 Institutional research plan: CEZ:AV0Z30460519 Keywords : magnetic survey * gravity survey * basanite Subject RIV: DC - Siesmology, Volcanology, Earth Structure http://www.geology.cz/zpravy/obsah/2010/zpravy-2010-56.pdf

  14. Poruchy prostorové paměti u Alzheimerovy choroby jsou detekovatelné již u pacientů s Mírnou kognitivní poruchou

    Laczó, J.; Hort, J.; Vlček, Kamil; Vyhnálek, M.; Bojar, M.; Vajnerová, O.; Holmerová, I.; Hořínek, D.; Kalina, M.; Bureš, Jan

    69/102, č. 6 (2006), s. 431-437 ISSN 1210-7859 R&D Projects: GA ČR(CZ) GA309/05/0693; GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z50110509 Keywords : Alzheimer’s disease * Mild Cognitive impairment * spatial memory Subject RIV: FH - Neurology Impact factor: 0.045, year: 2006

  15. Fiscal 1998 report on data processing for geothermal energy development enhancement. No. A-4 Mount Kumbetsu area (primary data processing); 1998 nendo chinetsu kaihatsu sokushin chosa data shori hokokusho. No.A-4. Kunbetsu chiiki (dai 1 ji)

    NONE

    1999-09-01

    This is part of the state-operated 'geothermal energy development enhancement' project, under which a comprehensive analysis is conducted into the results of a survey of geothermal resources in existence in the Mount Kumbetsu area. The local geothermal structure is examined, and the Kumbetsu hot spring area, the Uebetsu river middle reach area, and the Unabetsu hot spring area are extracted as promising high-temperature supply areas. The Kumbetsu hot spring area and the Uebetsu river middle reach area lie on a heave positioned west of the Mount Musa/Mount Shitabanupuri fault. There is a distinguished bending in the zone of discontinuous resistivity, and, when geology is considered, it is inferred that there exists a geothermal fluid field formed by the Mount Musa/Mount Shitabanupuri fault running NNW-SSW and a fracture zone that runs across the fault. The two areas are located at spots where gravity gradient is sharp. It is concluded that, with the alteration zone, temperature distribution, etc., also taken into account, the Kumbetsu hot spring area is the more promising as a source of geothermal energy. The water of the Kumbetsu hot spring is of the Cl-SO{sub 4} type, 64.5 degrees C hot and neutral, and arises from the depth where water of meteoric origin is heated by heat conduction. The heat source is supposedly the magma reservoir whose eruption once formed Mount Unabetsu etc. (NEDO)

  16. Pyloanalytické výsledky ze zaniklé studny Jiřského náměstí Pražského hradu

    Jankovská, Vlasta

    2012-01-01

    Roč. 64, č. 3 (2012), s. 503-507 ISSN 0323-1267 Institutional support: RVO:67985939 Keywords : pollen analysis and non-pollen-palynomorphs analysis * Prague castle * Middle Ages Subject RIV: EF - Botanics

  17. Kilómetro por hora, ji cuadrado, días-hormiga: temas dimensionales, métricos y algebraicos en las tareas de redacción, edición y traducción

    José A. Tapia Granados

    2004-01-01

    Este trabajo comenta algunos aspectos básicos de teoría métrica, análisis dimensional y álgebra relativos a las magnitudes y cantidades de uso habitual en la vida cotidiana y en todos los campos de las ciencias naturales y sociales. Se trata de aspectos muy generales, cuyo conocimiento parece necesario para todos los implicados en la redacción de textos en castellano. El artículo presta especial atención a algunos problemas que surgen al traducir del inglés, explica las ambigüedades matemátic...

  18. Ctnostná jest, že ji nikdo nechtěl. Antropogenní reliéf a půda v lesích podbezdězských

    Sádlo, Jiří; Meduna, P.; Abraham, V.; Petřík, Petr; Novák, J.; Pokorný, P.; Svitavská-Svobodová, Helena

    2015-01-01

    Roč. 94, 7-8 (2015), s. 424-430 ISSN 0042-4544 R&D Projects: GA AV ČR IAAX00050801 Institutional support: RVO:67985939 Keywords : taiga * Dokesko-Bezdězsko region Subject RIV: EH - Ecology, Behaviour

  19. FY 1997 report on the data processing of the geothermal development promotion survey. Primary. No.B-5 Mt. Musadake area; 1997 nendo chinetsu kaihatsu sokushin chosa data shori hokokusho. No. B-5 Musadake chiiki (Dai 1 ji)

    NONE

    1998-06-01

    As part of the geothermal development promotion survey, the comprehensive analysis was made on the survey of the existence amount of geothermal resource in the Mt. Musadake area, Shibetsu county, Hokkaido, which was conducted in FY 1997. In the surface survey, the following were carried out: survey of geology/alteration zone, age determination of rocks, alteration age determination by thermoluminescence method, geochemical survey (hot spring gas, hot spring water), gravity exploration and electromagnetic exploration. In the survey of environmental effects, survey of flora/fauna and survey of hot spring variations were made. The results of the analysis were outlined as follows. The geothermal system in this area seems to be controlled by the Mt. Musadake - Mt. Shitabanupuri fault, folding zone along the fault and Graben-state structure extending southeast of the zone. At deep underground, the existence of the deep geothermal water forming geothermal reservoirs is presumed, and the deep geothermal water seems to be helped by the thermal conduction and volcanic effluences from the magma reservoir related to a series of volcanoes, centered on Mt. Musadake that is regarded as heat source. The geothermal water has a temperature of over 250 degrees C and a high Cl concentration. (NEDO)

  20. FY 1999 report on the data processing of the geothermal development promotion survey. No. A-4 Kunbetsudake area (Secondary); 1999 nendo chinetsu kaihatsu sokushin chosa data shori hokokusho. No.A-4 Kunbetsudake chiiki (dai 2 ji)

    NONE

    2000-10-01

    This survey studies possibilities of geothermal resource existence by checking the presence of high temperature anomaly by a wide-area survey with the aim of extracting the area for Survey B and Survey C to be conducted. The area for survey is an area of approximately 300km{sup 2} including Shibetsu town, Shibetsu county, and Rausu town, Menashi county, which are located east of Hokkaido. Conceptual models of the geothermal system in this area which are thought of from the results of the survey are as follows. It is assumed that heat source exists deeply in Unabetsudake (Mt. Unabetsu). From the fact that the K-Ar method age of the ejecta is 0.5Ma and the TL method age of the rate. (NEDO)ch the position of drilling of the well for survey of heeffective as heat source. It is thought that the water of hot spring/mineral spring came to indicate various spring qualities by mixture of meteoric water and fossil seawater at various ratios. The fossil seawater and old meteoric water are being heated by thermal conduction. The mixture with the original water of Kawakita hot spa is recognized in Shibetsu Kanayama hot spa. It is assumed that the high temperature area exists mostly in Unabetsudake, but the spread does not reach the position of drilling of the well for survey of heat flow rate. (NEDO)

  1. Fiscal 1999 geothermal development promotion survey report. Data processing (No. B-5 - Musadake region - Phase 3); 1999 nendo chinetsu kaihatsu sokushin chosa data shori hokokusho. No. B-5 Musadake chiiki (Dai 3 ji)

    NONE

    2001-01-01

    A comprehensive analysis was conducted into the results of a survey on the state of existence of geothermal energy resources in the Musadake region, Shibetsu-gun, Hokkaido. The region was volcanically active in the period from the Neogene period into the quaternary, with some volcanos still active even today. The geological structure on the whole is characterized by the Musadake/Mt. Shitabanupuri fault which is the major structure running NNE-SSW and having a folding structure. It is inferred that Musadake is the heat source responsible for the underground temperature distribution in this region. The maximum temperature of 274 degrees C is recorded at borehole N11-MD-3 in the northeastern part of Musadake, and the temperature falls rapidly as the distance from the borehole increases. Ejection of geothermal fluids is observed at boreholes N11-MD-3 and N11-MD-4. It is inferred that the deep-seated geothermal water is of the neutral Cl type with Cl concentration estimated at approximately 12,000 mg/liter. Steam composition is characterized by a gas concentration level that is as high as 3-4 vol.%. The gas is composedly mainly of CO2 and contains some hydrocarbons. Fluids in this region are classified into water mixing into deep-seated geothermal water and groundwater originating in meteoric water. (NEDO)

  2. FY 1998 report on the data processing of the geothermal development promotion survey. Secondary. No.B-5 Mt. Musadake area; 1998 nendo chinetsu kaihatsu sokushin chosa data shori hokokusho. No. B-5 Musadake chiiki (Dai 2 ji)

    NONE

    2000-01-01

    As part of the geothermal development promotion survey, the comprehensive analysis was made on the survey of the existence amount of geothermal resource in the Mt. Musadake area, Shibetsu county, Hokkaido, which was conducted in FY 1997 and FY 1998. In the surface survey, the following were carried out: survey of geology/alteration zone, geochemical survey, gravity exploration, wide-area gravity/magnetic structure analysis, seismic exploration, etc. In the well exploration, structural boreholes N10-MD-1 and N10-MD-2 were drilled, and the following were conducted: temperature logging/temperature recovery test, electric logging, water injection test and survey of core cuttings. For borehole N10-MD-2, the survey of geothermal water was made. In the survey of environmental effects, survey of flora/fauna and survey of hot spring variations were conducted. The results of the analysis were outlined as follows. At deep underground, the existence of the deep geothermal water forming geothermal reservoirs is presumed, and the deep geothermal water seems to be helped by the thermal conduction from the magma reservoir related to a series of volcanoes, centered on Mt. Musadake that is regarded as heat source. The geothermal water has a temperature of over 250 degrees C and a high Cl concentration. (NEDO)

  3. Pramana – Journal of Physics | Indian Academy of Sciences

    Home; Journals; Pramana – Journal of Physics; Volume 73; Issue 6. Magnons interaction of spinor Bose–Einstein condensates in an optical lattice. Yong-Qing Liu. Volume 73 Issue 6 ... Author Affiliations. Yong-Qing Liu1. Department of Physics and Electronics, XinZhou Teachers University, XinZhou, 034000, China ...

  4. North Korean Civil-Military Trends: Military-First Politics to a Point

    2006-09-01

    to the Great Leader. Yi Yong Mu. The NDC’s impact on the formal leadership lineup was made clear by 2001, when Yi Yong Mu, vice chairman of the NDC...to be restricted, as are career bonds that could come about between officers through sequential appointments to same commands. • First time

  5. Journal of Genetics | Indian Academy of Sciences

    Home; Journals; Journal of Genetics. ZI-JING ZHANG. Articles written in Journal of Genetics. Volume 96 Issue 4 September 2017 pp 535-544 RESEARCH ARTICLE. Effects of genetic variants of the bovine WNT8A gene on nine important growth traits in beef cattle · YONG-ZHEN HUANG YONG ZOU QING LIN HUA HE LI ...

  6. Bulletin of Materials Science | Indian Academy of Sciences

    Home; Journals; Bulletin of Materials Science. YONG J IANG. Articles written in Bulletin of Materials Science. Volume 40 Issue 6 October 2017 pp 1255-1261. Molecular dynamics study on the relaxation properties of bilayered graphene with defects · WEI ZHANG JIU-REN YIN PING ZHANG YAN-HUAI DING YONG J IANG.

  7. On the data between the ratio of new supply houses at four tenures in Japan. At 47 prefectures and 80 cities; 300,000 and more population on 1995; Shinsetsu chako jutaku no riyo kankeibetsu deta. 47 todofuken and 80 toshi (jinko 300,000 nin 'heisei 7 {center_dot} kokucho' ijo narabini kencho shozaishi)(1993 {approx} 1997)

    Iida, Toshihiko; Kojina, Kyoji

    1999-03-01

    On the owned tenure, the average construction-started ratio spreaded from 1.15 houses in Amagasaki-shi to 6.30 houses in Hamamatsu-shi during 1983 {approx} 1987, the same values spreaded from 1.42 houses in Amagasaki-shi to 5083 houses in Akita-shi during 1988 {approx} 1992 and the same values spreaded from 1.44 houses in Osaka-shi to 6.67 houses in Aomori-shi during 1993 {approx} 1997. 2nd on the rental tenure, the average construction-started ratio spreaded from 1.88 house in Sakai-shi to 14.32 houses in Ichikawa-shi during 1983 {approx} 1987, the same values spreaded from 3.72 houses in Sakai-shi to 13.93 houses in Kawasaki-shi during 1988 {approx} 1992 and from 2.82 houses in Yokosuka-shi to 9.88 houses in Sendai-shi during 1993 {approx} 1997, espicialy 13.17 houses in Nishinomiya-shi. 3rd on the issued tenure, the average construction-started ratio spreaded from 0.05 houses in Maebashi-shi 0.45 houses in Mito-shi during 1983 {approx} 1992 and from 0.02 houses in Naha-shi to 0.74 houses in Omiya-shi during 1993 {approx} 1997, espicialy 1.00 houses in Nishinomiya-shi. 4th on the for-sale tenure, the average construction-started ratio spraeded from 0.36 houses in Kurashiki-shi 5.65 houses in Kobe-shi during 1983 {approx} 1987, the same values spreaded from 0.89 houses in Iwaki-shi and Fukui-shi to 6.14 houses in Fukuoka-shi during 1988 {approx} 1992 and from 0.63 houses in Kurashiki-shi to 7.51 houses in Urawa-shi during 1993 {approx} 1997, especially 8.66 houses in Nishinomiya-shi. The construction-started hoses of the rental tenure were leading during this fifteen years, but the construction-started houses of the for-sale tenure were increasing recently in Japan, though the same values of the owned tenure were continuing during this periods. At 80 cities the construction-started ratio of the rental tenure spreaded from 2.61 houses in Kitakyushu-shi to 12.01 houses in Hachioji-shi on 1993, the same values spreaded from 2.41 houses in Toyota-shi to 9.98 houses in

  8. Report on achievements in fiscal 1999 on research and development of the Welfare Techno-system (Chuo Ward, Kobe); 1999 nendo Welfare Techno system kenkyu kaihatsu (Kobe-shi Chuo-ku) seika hokokusho

    NONE

    2000-03-01

    Research and development has been performed on a help and welfare system to transmit and accumulate monitoring data by utilizing a computer system. This paper summarizes the achievements in fiscal 1999. In the research of transmission and management of information on help requiring persons, a server and its peripheral devices were modified to structure a system to measure body temperatures, pulses, and blood pressures, and transmit them to a central server. In the research on support for the visiting helps, a mobile system was developed, which has map information and scheduling function that shows distribution of help requiring persons. In the research of a simulation to link hospitals, medical organizations and homes, the LAN at health facilities for elderly people was structured, and so was a network for linking hospitals, medical organizations and homes (simulated). Investigations and discussions were performed on interface between body information (vital data) measuring instruments and personal computers. Developmental research was executed on private certification office servers and the certification software that consider security in the help systems. (NEDO)

  9. "I don't feel shy because I will be among others who are just like me…": The role of support groups for children perinatally infected with HIV in Zimbabwe.

    Mupambireyi, Zivai; Bernays, Sarah; Bwakura-Dangarembizi, Mutsa; Cowan, Frances M

    2014-10-01

    As access to paediatric antiretroviral therapy (ART) continues to improve in sub-Saharan Africa, a new historically specific cohort of HIV-perinatally infected children surviving into adolescent has emerged. Although remarkable successes have been made clinically in keeping this cohort alive and in reasonable health, their social support experiences are still unknown. The research being reported here sought to explore peer social support experiences of HIV-perinatally infected children in Harare, Zimbabwe. In this article, we draw on 56 repeat in-depth interviews (IDIs) conducted in three phases and two focus group discussions (FGDs) with HIV-infected children (11-13 years). Additional interviews were held with 10 carers. Study findings suggested that both children and carers perceive support groups as a safe social space for learning and acquiring HIV information as well as gaining confidence. Additionally, findings highlighted the importance of consistency of participation. Structural and personal barriers to access and participation in support group were also identified. We conclude that support groups are a useful resource for HIV-infected children and therefore should be supported by stable funding.

  10. Report on the initial-stage survey of the new energy vision of the Izumi city area; 2001 nendo Izumi shi chiiki shin energy vision shoki dankai chosa hokokusho

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Izumi City, Osaka Prefecture, an investigational study was conducted of the structure of energy consumption, existence amount of new energy, subjects in utilization of new energy, etc. The energy consumption amount of the city is increasing mostly in electric power in the residential sector, but is decreasing in the business sector and industrial sector. It is leveling off in the transportation sector, but only the consumption amount of gasoline is markedly increasing. In the potential amount of new energy utilization in the city, the rate of solar energy/clean energy vehicles was high. As a result of the study, the following were made clear: It is effective to introduce new energy mostly used for citizen such as the household use photovoltaic power system/solar heat use hot water supplier/hybrid private car. Of waste energy, wind energy, biomass energy and temperature difference energy, it is effective for city to take the initiative in introducing them. It is effective for city/proprietor to introduce the natural gas cogeneration. (NEDO)

  11. Regional new energy vision for Kamaishi City. Energy to create community's future out of natural resources; 2001 nendo Kamaishi shi chiiki shin energy vision. Megumi kara machi no mirai wo tsukuru energy

    NONE

    2002-02-01

    For promoting the introduction of new energy and for enhancing people's consciousness of such at Kamaishi City, Iwate Prefecture, surveys and studies were conducted involving the amount of energy needed by the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumed 5,334 times 10{sup 12}J in fiscal 1999, which amount occupied 0.034% of the nation-wide consumption. Concerning the total consumed by the city, the manufacturing sector was responsible for 36% and the transportation sector for 24%. Oil provided 60% of the energy, and electric power 24%. These percentages were similar to those found across the nation. The amount of carbon dioxide emissions was estimated to be equivalent to 463-million kg-CO2. Projects for new energy introduction were studied, which included photovoltaic power generation for primary and junior high school buildings, the new city office, road signs along the municipal roads, and the harbor area; hybrid photovoltaic/wind power generation for a newly built fish market; solar heat utilization for heating frozen roads; wind power generation for the Wayama and Naranoki stock farms and for the harbor area; and a business for utilizing waste heat discharged by Kamaishi City's Eco-Town project. (NEDO)

  12. Survey report on project for drawing district energy-saving visions for Town of Aizu Wakamatsu. Preliminary survey; 2000 nendo Aizu Wakamatsu shi chiiki sho energy vision sakutei nado jigyo (shoki dankai chosa) chosa hokokusho

    NONE

    2001-07-01

    The feasibility study is conducted for introduction of the district energy-saving measures in City of Aizu Wakamatsu, for which the actual situations of energy consumption and promising energy-saving measures are surveyed. The city has a typical basinal weather, cold in winter and very hot and humid in summer, and tends to have a longer air-condition period in a year. It is considered that there are many wasteful energy consumption items to be studied for reduction. In the area of moving means, dependence on public transportation systems is considered to be relatively low, suggesting that there are much space of reducing transportation energy by the measures such as self-imposed control on use of private cars, promotion of utilizing public transportation systems and fuel-saving type driving throughout the city. The promising energy-saving measures studied to verify the effects include introduction of PVM analyzers for establishing better cost/effect relationship between power consumed by air-conditioners and pleasantness; introduction of garbage power generation, co-generation and high-efficiency illuminators; improvement of power-factor; and demand control for air conditioning, rationalization of power-receiving facilities, introduction of systems for saving flushing water and improvement of air conditioners' outdoor facilities. (NEDO)

  13. FY 2000 Project report on survey for drawing district energy-saving visions for City of Oguchi; 2000 nendo Oguchi-shi chiiki sho energy vision sakutei nado jigyo chosa hokokusho

    NONE

    2001-02-01

    The energy-saving visions are drawn for City of Oguchi to help spread the energy-saving practices through the citizens, based on the studies on more efficient and realizable energy-saving measures, including effective utilization of district energy. The energy-saving activities cover the following 6 areas: (1) energy demand trends and current status of energy-saving measures, (2) basic environmental conditions related to energy saving in the district, (3) prediction of energy demands, (4) basic conception of the district energy saving, and introduction methodology, (5) energy-saving implementation plans, and (6) promotion of and problems involved in introduction of the energy-saving measures. The energy-saving implementation plans cover the public facilities, household, schools and private enterprises, and the energy-saving measures studied for the public facilities include introduction of microhydroelectric power generation systems for service water and sewer systems, revolving doors for libraries, high-efficiency illumination systems, and various types of solar systems. Those for household include economic utilization of home electric appliances and automobiles, and those for cooperation by the administration and citizens include thorough separation of garbage. (NEDO)

  14. Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from XIANG YANG HONG 05 and SHI YAN 3 in the Philippine Sea, Indian Ocean and South Pacific Ocean from 1991-11-01 to 1993-11-30 (NODC Accession 9400186)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conductivity, Temperature and Depth (CTD) and other data were collected as part of the Coupled Ocean Atmosphere Response Experiment. Data were collected from Ships...

  15. Fiscal 1999 research report. Basic research for promotion of joint implementation programs (Energy efficiency survey at Noboil Refinery of Ufa City); 1999 nendo Ufa shi Noboil seiyusho ni kansuru sho energy chosa hokokusho

    NONE

    2000-03-01

    The aim is to explore projects that will lead to joint implementations for greenhouse gas emission reduction, and a survey was conducted at the Bashneftechim Refineries, Ufa City, Bashkir Republic, Russian Federation. A feasibility study was carried out involving energy efficiency improvement for oil refining related units such as atmospheric and vacuum distillators. In the energy efficiency survey, studies covered energy efficiency improvement in the existing equipment through the modification of the normal and vacuum distillators, visbreaker, vacuum desulfurizer for light oil, and the process heating furnace of the catalytic cracking equipment, for a reduction in fuel consumption by realizing combustion excess air ratio control; the installation of an air preheater or a waste heater boiler for the collection of heat from combustion exhaust gas; the addition of heat exchangers and the optimization of their arrangement for an increase in the amount of heat recoverable from hot oil; the replacement of obsolete instruments and controllers with state-of-the-art types for higher energy efficiency in the control of distillation tower operation, etc. It is desired that this energy saving project will be embodied for a reduction in CO2 emissions. (NEDO)

  16. FY 2000 report on the basic survey to promote Joint Implementation, etc. Survey of gas-fired cogeneration in Samarkand City; 2000 nendo kyodo jisshii nado suishin kiso chosa hokokusho. Samarkand shi gas daki cogeneration chosa

    NONE

    2001-03-01

    In the existing heat supply plant in Samarkand City in Uzbekistan, feasibility study was conducted of the project aimed at energy conservation and reduction in greenhouse effect gas emission by introducing the repair/cogeneration system of the regional pipes superannuated. In the project, the following were planned: introduction of two units of 6MW class gas turbine cogeneration, introduction of boiler which can realize 90% of the thermal efficiency, replacement of the existing regional pipes with pre-insulated pipes with less water leak/heat loss, etc. As a result of the study, the energy conservation amount was 21,006 toe, and the amount of greenhouse effect gas reduction was 64,998 t-CO2/y. As to the effects vs. expenses, the energy conservation was 2.80 toe/million yen, and the greenhouse effect gas reduction was 8.66 t-CO2-y/million yen. The initial investment amount was 7.51 billion yen, the business profit was 468 million yen/y, and the internal earning rate was 1.133%. It was judged that great profitability was not expected for the project, but the profit was returnable on investment. (NEDO)

  17. Report on the survey for working out the new energy vision of the Sen'nan city area; 2001 nendo Sen'nan shi chiiki shin energy vision sakutei chosa hokokusho

    NONE

    2002-02-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Sen'nan City, Osaka Prefecture, an investigational study was conducted of the structure of energy demand, existence amount of new energy, project for new energy introduction, etc. The energy consumption amount of the city in FY 1999 was estimated at 4,971TJ. It consisted of 40.6% in the industrial sector, 29.7% in the transportation sector and 29.6% in the commercial/residential sector. The rate of energy source was 48.8% of petroleum, 32.1% of electric power and 19.1% of gas. As the project for new energy introduction, the following were studied: introduction of photovoltaic power generation and solar heat utilization facilities to the city office/elementary school/junior high school/municipal dwelling houses; street light combinedly using photovoltaic power generation and wind power generation; introduction of clean energy vehicle to official vehicle; preferential treatment for introduction of low-emission car for citizen; introduction of natural gas cogeneration and fuel cell to the city office, etc.; introduction of small-size wind power generation/small- and medium-size hydraulic power generation to public facilities, park, etc.; construction of the waste energy utilization system. (NEDO)

  18. FY 2001 report on the initial-stage survey of the project for working out the new energy vision of the Okinawa City area; 2001 nendo Okinawa shi chiiki shin energy vision sakutei chosa. shoki dankai chosa hokokusho

    NONE

    2002-02-01

    For working out a new energy vision in Okinawa City, an investigational survey was conducted, as the initial-stage survey, of the state of energy demand of the city, estimated amount of existence of new energy, proposed project (draft) on new energy introduction, etc. The energy demand amount of Okinawa City was estimated at 6,865 x 10{sup 6} MJ/y. By sector, it consisted of 41.6% in the transportation sector, 35.6% in the commercial/residential sector and 22.8% in the industrial sector. The rate of energy source was 50.5% of petroleum-base fuel, 31.0% of electric power and 9.5% of LP gas. The expected minable amount of new energy was estimated at 318,513 x 10{sup 3} MJ/y, which is equivalent to 17 x the energy consumption amount/day of the city. As the proposed project (draft) for new energy introduction, study was made of the introduction of photovoltaic power system/solar heat utilization system to the children future zone park/elementary school/junior high school/kindergarten/public hall, introduction of clean energy vehicle to official vehicle of the city, refuse incineration power generation/utilization of incineration heat at Kurahama sanitary facilities, and others. (NEDO)

  19. New energy vision of the Tagawa city area. Aiming at a town for symbiosis of humans and the environment; 2001 nendo Tagawa shi chiiki shin energy vision. Hito to kankyo ga kyoseisuru machi wo mezashite

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Tagawa City, Fukuoka Prefecture, an investigational study was conducted of the energy supply/demand of the city, existence amount of new energy, project for new energy introduction, etc., and a vision was worked out. The energy consumption amount of the city was estimated at 6,678,932 GJ/y. It consisted of 42% in the industrial sector, 35% in the transportation sector and 23% in the commercial/residential sector. The rate of energy source was 75% of petroleum-base energy and 25% of electric power. As the project for new energy introduction, the following were studied: power generation/thermal exchange/composting by fermentation of methane from stockbreeding waste; environmental preservation type agriculture such as large-scale hothouse using exhaust heat from cement plant; utilization of ground mine water at coal goaf for space cooling and as water source; introduction of photovoltaic power generation/solar energy use hot water supply system to public facilities; introduction of clean energy car to vehicle in welfare/education fields; preparation of a program for energy environment education; preparation of bases for energy environment education. (NEDO)

  20. Fiscal 2000 report on results of R and D of welfare techno-system in West Ward, Kobe City; 2000 nendo walfare techno system kenkyu kaihatsu (Kobe-shi Nishi-ku) seika hokokusho

    NONE

    2001-03-01

    R and D was conducted on devices for promoting self-support, mitigating nursing care, and improving safety and comfort for the elderly and the disabled, with the fiscal 2000 results reported. In the development of a wheelchair system (small arm sling mountable on a wheelchair) capable of assisting self-support for eating and vocational activity at home, a mounting device of an arm sling was experimentally manufactured for five different types of wheelchairs. In the research on the welfare device support system at a disaster or emergency, the system was modified based on the result of the system operation in the preceding year. Consequently, it became possible to make use of a power from a solar battery, a storage battery and an utility line, and also to reduce instantaneous interruption caused by switching of the self-sustaining operation for example. Further, a load control adaptor linked with an inverter was developed, enabling the system to use electricity for a long period even at the time of power failure. In addition, a conventional simple charge/discharge control was found to cause a marked deterioration in storage cell properties; hence, an accurate charge controller was added. (NEDO)

  1. Fiscal 2000 report on results of R and D of welfare techno-system in Chuo Ward, Kobe City; 2000 nendo walfare techno system kenkyu kaihatsu (Kobe-shi Chuo-ku) seika hokokusho

    NONE

    2001-03-01

    'R and D on systems for supporting care and welfare through transmission and accumulation of monitored data' was conducted for the purpose of assisting the operation of service providers for the elderly in need of care and supporting nursing care at home and at facilities, for which the results in fiscal 2000 was reported. In the development of vital data measuring devices and inter-computer interfaces, a USB or IEEE1394 interface was developed which was for automatically inputting, into personal computers (PC), the information such as body temperature, heart rate and blood pressure of a person requiring care; and the interface was incorporated in the system. In the research on support for home visit care centers, a geographic information system (GIS) and data were selected, which were to be installed on server's side, with linkage with portable PC's carried out. However, it was pointed out that data transmission took time between the server in the center and the portable PC at a home to visit. Further, investigative research on care services at facilities under the care insurance system was conducted, as were studies on linkage between general practitioners and hospitals, and studies on prevention of illegal access and wiretapping, among others. (NEDO)

  2. Turbidity, SOLAR RADIATION - ATMOSPHERIC and other data from XIANG YANG HONG 05 and SHI YAN 3 from 1992-01-01 to 1993-03-30 (NODC Accession 9400187)

    National Oceanic and Atmospheric Administration, Department of Commerce — Conductivity, Temperature and Depth (CTD) and other data were collected as part of the Coupled Ocean Atmosphere Response Experiment. Data were collected from Ships...

  3. Report on achievements in fiscal 1999 on research and development of the Welfare Techno-system (Nishi Ward, Kobe); 1999 nendo Welfare Techno system kenkyu kaihatsu (Kobe-shi Nishi-ku) seika hokokusho

    NONE

    2000-03-01

    Research and development has been performed on devices to enhance autonomy, safety and comfort for elderly and handicapped people in houses and homes. This paper summarizes the achievements in fiscal 1999. In developing wheelchairs to allow autonomy in meal taking and working at homes, a small upper arm holding device that can be installed on a wheelchair was fabricated on the trial basis according to the experience obtained in making the first prototype in the previous fiscal year, and clinical evaluation was given. In the research and development on a safe walk assisting appliance for elderly and handicapped people, development, improvement and trial fabrication were carried out on a caster in which the brake will not work during walking, but it works automatically in a sudden movement such as falling down. In developing an environment information transmitting system for elderly and handicapped people, a first prototype fabrication was performed on a system to detect sound of an alarm or vibration caused by knocking a door, and convey information to elderly and handicapped people by utilizing the communication services including the commercially available cellular phones. In the research on a welfare device support system for use in disaster and emergency, design and structuring were carried out on a nighttime electric power utilizing system having solar cells combined with storage batteries. Related data were measured. (NEDO)

  4. Visualization of the human CD4+ T-cell response in humanized HLA-DR4-expressing NOD/Shi-scid/γcnull (NOG) mice by retrogenic expression of the human TCR gene

    Takahashi, Takeshi; Katano, Ikumi; Ito, Ryoji; Ito, Mamoru

    2015-01-01

    Highlights: • β-Lactoglobulin (BLG) specific TCR genes were introduced to human HSC by retrovirus. • Human HSC with BLG-specific TCR were transplanted into NOG-HLA-DR4 I-A −/− mice. • BLG-specific TCR induced positive selection of thymocytes. • BLG-specific TCR positive CD4 + T cells mediated immune responses in humanized mice. - Abstract: The development of severe immunodeficient mouse strains containing various human genes, including cytokines or HLA, has enabled the reconstitution of functional human immune systems after transplantation of human hematopoietic stem cells (HSC). Accumulating evidence has suggested that HLA-restricted antigen-specific human T-cell responses can be generated in these humanized mice. To directly monitor immune responses of human CD4 + T cells, we introduced β-lactoglobulin (BLG)-specific T cell receptor (TCR) genes derived from CD4 + T-cell clones of cow-milk allergy patients into HSCs, and subsequently transplanted them into NOG-HLA-DR4 transgenic/I-Aβ deficient mice (NOG-DR4/I-A o ). In the thymus, thymocytes with BLG-specific TCR preferentially differentiated into CD4 + CD8 − single-positive cells. Adoptive transfer of mature CD4 + T cells expressing the TCR into recipient NOG-DR4/I-A o mice demonstrated that human CD4 + T cells proliferated in response to antigenic stimulation and produced IFN-γ in vivo, suggesting that functional T-cell reactions (especially Th1-skewed responses) were induced in humanized mice

  5. Visualization of the human CD4{sup +} T-cell response in humanized HLA-DR4-expressing NOD/Shi-scid/γc{sup null} (NOG) mice by retrogenic expression of the human TCR gene

    Takahashi, Takeshi, E-mail: takeshi-takahashi@ciea.or.jp; Katano, Ikumi; Ito, Ryoji; Ito, Mamoru

    2015-01-02

    Highlights: • β-Lactoglobulin (BLG) specific TCR genes were introduced to human HSC by retrovirus. • Human HSC with BLG-specific TCR were transplanted into NOG-HLA-DR4 I-A{sup −/−} mice. • BLG-specific TCR induced positive selection of thymocytes. • BLG-specific TCR positive CD4{sup +} T cells mediated immune responses in humanized mice. - Abstract: The development of severe immunodeficient mouse strains containing various human genes, including cytokines or HLA, has enabled the reconstitution of functional human immune systems after transplantation of human hematopoietic stem cells (HSC). Accumulating evidence has suggested that HLA-restricted antigen-specific human T-cell responses can be generated in these humanized mice. To directly monitor immune responses of human CD4{sup +} T cells, we introduced β-lactoglobulin (BLG)-specific T cell receptor (TCR) genes derived from CD4{sup +} T-cell clones of cow-milk allergy patients into HSCs, and subsequently transplanted them into NOG-HLA-DR4 transgenic/I-Aβ deficient mice (NOG-DR4/I-A{sup o}). In the thymus, thymocytes with BLG-specific TCR preferentially differentiated into CD4{sup +}CD8{sup −} single-positive cells. Adoptive transfer of mature CD4{sup +} T cells expressing the TCR into recipient NOG-DR4/I-A{sup o} mice demonstrated that human CD4{sup +} T cells proliferated in response to antigenic stimulation and produced IFN-γ in vivo, suggesting that functional T-cell reactions (especially Th1-skewed responses) were induced in humanized mice.

  6. PHYTOPLANKTON - WET WEIGHT and Other Data from SHI YAN 3 and Other Platforms From TOGA Area - Pacific (30 N to 30 S) from 19921109 to 19930217 (NODC Accession 9600043)

    National Oceanic and Atmospheric Administration, Department of Commerce — The accession contains chlorophyll data collected in TOGA Area - Pacific (30 N to 30 S) as part of Tropical Ocean Global Atmosphere (TOGA) and Coupled...

  7. Fiscal 1999 report on basic research for promotion of joint implementation programs. Research on energy saving at Ilyich Iron and Steel Works, Mariupol City, the Ukraine; 1999 nendo Ukraine Mariupol shi Ilyich seitetsusho sho energy chosa hokokusho

    NONE

    2000-03-01

    This is to comply with the COP3 (Third Session of the Conference of the Parties to the United Nations Framework Convention on Climate Change) protocol. For the recovery of exhaust heat from the air blast furnace air heater, combustion control will be improved and an exhaust heat recovery facility will be installed. For the recovery of converter-generated gas, the casting process in the open hearth will be changed to a continuous casting process in the converter, and a generated gas recovery facility will be installed. The power plant facilities will be improved. It is expected that these three jobs will reduce greenhouse gases at 178, 583, and 602-thousand tons/year in terms of CO2, respectively, and energy consumption at 826, 8954, and 8152 TJ/year (13% level reduction), respectively. Time periods required for the recovery of the investments will be 31.2, 8.7, and 7.2 years, respectively, and this means that the investments will not be so profitable. As for cost performance, however, they will save energy at 262, 208, and 420 GJ/year/million yen, respectively, and reduce greenhouse gases at 56.4, 13.5, and 31.0 tons/year/million yen in terms of CO2, respectively, and this means that the three jobs will achieve high cost performance. Some more jobs are found to probably contribute to energy efficiency enhancement and cost performance improvement, which include a top pressure recovery turbine, pulverized coal injection, continuous casting in the steelmaking process, improvement in the yield of slabs in the rolling process, and a hot charger. (NEDO)

  8. New energy vision at Sabae City. Toward realization of 'environmental international city'; 2001 nendo Sabae shi chiiki shin energy vision. Kankyo kokusai toshi Sabae no jitsugen ni mukete

    NONE

    2002-03-01

    With an object of accelerating introduction of and uplifting consciousness on new energies at Sabae City in Fukui Prefecture, a new energy vision was put into order based on the result of the initial stage investigation having been performed in the previous fiscal year. Solar light and solar heat energies will be introduced positively into public facilities, and at the same time works will be implemented to accelerate the proliferation thereof into general households. The target of introduction by the year 2010y is set to 2,600 kW by photovoltaic power generation, and the introduction thereof is planned to schools, nursery schools, municipality operated houses, and unattended facilities. With regard to solar heat water warmer, the present proliferation rate of about 7.3% will be raised to 15%. Regarding wastes generated from industrial areas, efficient energy extraction by thermal recycling is intended on the assumption of suppression of wastes generation, their re-use, and recycling. Systems may include the bio-gas system, cogeneration, and recovery of energies from plastics wastes. For acceleration of proliferation of new energies in general, promotion of introduction will be achieved on mini-wind power generation, small hydroelectric power generation, and fuel cell automobiles. (NEDO)

  9. New energy vision of the Yokaichi city area. New energy society to be created by all citizen - Yokaichi City; 2001 nendo Youkaichi shi chiiki shin energy vision. Minna no chikara de tsukuru shin energy shakai Youkaichi

    NONE

    2002-03-01

    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Yokaichi City, Shiga Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy, project for new energy introduction, etc., and a new energy vision was worked out. The energy consumption amount of the city was estimated at approximately 1,004,638 drums in terms of oil drum (200L). By sector, the energy consumption amount was 66.1% in the industrial sector, 17.4% in the transportation sector and 16.5% in the commercial/residential sector. The rate of energy source was 62.2% of fossil fuel, etc., and 37.9% of electric power. As the project for new energy introduction, the following were studied: promotion of introduction of solar energy collector/photovoltaic power generation to general households; introduction of photovoltaic power generation/solar hot water supply space heating system to public facilities; road preparation by installation of street light using photovoltaic power generation; installation of micro wind power generator at the disaster-prevention base; introduction of biomass energy such as wood pellet stove to public facilities; project of rape blossoms (cultivation of rape/production and consumption of rape oil/recovery of waste cooking oil/BDF). (NEDO)

  10. 医疗移动应用程序评价%Evaluation on medical mobile applications

    李骁; 方振威; 林阳

    2015-01-01

    function performed better than those with integrated functions on the amount of data and information, the breadth of document literature, and the depth of contents and details.For those applications with integrated functions, YongYaoZhuShou possessed the comprehensive interpretations of drug information, YongYaoCanKao was capable to customize the local prescriptions, which individualized the prescription information and provided a rapid medicine examination, besides, JiBo, in respect of pharmaceutical directions, highlighted their legal status.Conclusion With comprehensive function and easy opera-tion, medical mobile applications provide reference to medical practitioners, however, the authority and veracity remains to be tested and verified, due to different sources of data and shortage of acknowledged standard.

  11. Transarterial chemoembolization combined with sorafenib for the treatment of hepatocellular carcinoma with hepatic vein tumor thrombus

    Zhang YF

    2016-07-01

    Full Text Available Yong-Fa Zhang,1–3,* Wei Wei,1–3,* Jia-Hong Wang,1–3,* Li Xu,1–3 Pei-En Jian,1–3 Cheng-Zuo Xiao,4 Xiao-Ping Zhong,1–3 Ming Shi,1–3 Rong-Ping Guo1–3 1Department of Hepatobiliary Oncology, Sun Yat-sen University Cancer Center, 2State Key Laboratory of Oncology in South China, 3Collaborative Innovation Center for Cancer Medicine, Guangzhou, 4Department of General Surgery, Shenzhen Shajing Affiliated Hospital of Guangzhou Medical University, Shenzhen, People’s Republic of China *These authors contributed equally to this work Objective: To compare the treatment outcomes of sorafenib plus transarterial chemoembolization (TACE vs TACE alone in patients with hepatocellular carcinoma (HCC and hepatic vein tumor thrombus (HVTT.Methods: Twenty patients who were initially diagnosed with HCC and HVTT and received TACE combined with sorafenib during February 2009 to October 2013 were included in the study. To minimize selection bias, these patients were compared with 60 case-matched controls selected from a pool of 81 patients (in a 1:3 ratio who received TACE alone during the same period. The primary end point was overall survival (OS. The secondary end points were time to progression, disease control rate, and adverse events.Results: After a median follow-up period of 12.5 months (range, 1.03–44.23 months, the OS of the combined group was found to be significantly higher compared with the monotherapy group (14.9 vs 6.1 months, P=0.010. The time to progression was found to be significantly longer in the combined group (4.9 vs 2.4 months, P=0.016. Univariate and multivariate analyses revealed that the treatment allocation was an independent predictor of OS.Conclusion: Sorafenib plus TACE was well tolerated and was more effective in treating patients with advanced HCC and HVTT. Future trials with prospective larger samples are required to validate these results. Keywords: hepatocellular carcinoma, hepatic vein tumor thrombus, prognosis

  12. Mesenchymal stem cell-based NK4 gene therapy in nude mice bearing gastric cancer xenografts

    Zhu Y

    2014-12-01

    Full Text Available Yin Zhu,1,* Ming Cheng,2,* Zhen Yang,3 Chun-Yan Zeng,3 Jiang Chen,3 Yong Xie,3 Shi-Wen Luo,3 Kun-He Zhang,3 Shu-Feng Zhou,4 Nong-Hua Lu1,31Department of Gastroenterology, 2Department of Orthopedics, 3Institute of Digestive Disease, The First Affiliated Hospital of Nanchang University, Jiangxi, People’s Republic of China; 4Department of Pharmaceutical Sciences, College of Pharmacy, University of South Florida, Tampa, FL, USA*These authors contributed equally to this workAbstract: Mesenchymal stem cells (MSCs have been recognized as promising delivery vehicles for gene therapy of tumors. Gastric cancer is the third leading cause of worldwide cancer mortality, and novel treatment modalities are urgently needed. NK4 is an antagonist of hepatocyte growth factor receptors (Met which are often aberrantly activated in gastric cancer and thus represent a useful candidate for targeted therapies. This study investigated MSC-delivered NK4 gene therapy in nude mice bearing gastric cancer xenografts. MSCs were transduced with lentiviral vectors carrying NK4 complementary DNA or enhanced green fluorescent protein (GFP. Such transduction did not change the phenotype of MSCs. Gastric cancer xenografts were established in BALB/C nude mice, and the mice were treated with phosphate-buffered saline (PBS, MSCs-GFP, Lenti-NK4, or MSCs-NK4. The tropism of MSCs toward gastric cancer cells was determined by an in vitro migration assay using MKN45 cells, GES-1 cells and human fibroblasts and their presence in tumor xenografts. Tumor growth, tumor cell apoptosis and intratumoral microvessel density of tumor tissue were measured in nude mice bearing gastric cancer xenografts treated with PBS, MSCs-GFP, Lenti-NK4, or MSCs-NK4 via tail vein injection. The results showed that MSCs migrated preferably to gastric cancer cells in vitro. Systemic MSCs-NK4 injection significantly suppressed the growth of gastric cancer xenografts. MSCs-NK4 migrated and accumulated in tumor

  13. Efficacy and safety of immunosuppressive therapy in the treatment of seronegative hepatitis associated aplastic anemia

    Chen HF

    2014-09-01

    Full Text Available Hai-Fei Chen,* Bin-Xian Xu, Hong-Shi Shen,* Zheng-Yang Li, Ling-Juan Jin, Jie-Qing Tang, Jing Wang, Jing-Jing Zhu, Long-Mei Qin, Qing-Ya Cui, Yong-Ya Ren, Tian-Qin Wu Department of hematology, 100th hospital of People’s Liberation Army, Suzhou, Jiangsu province, The People’s Republic of China *These authors have contributed equally to this paper Objective: To investigate the clinical characteristics of seronegative hepatitis-associated aplastic anemia (AA (SNHAA and hepatitis B virus (HBV infection complicating AA (HBVAA, and thereby compare the efficacy of immunosuppressive therapy (IST.Methods: An analysis was conducted on the clinical data of ten patients with SNHAA out of 332 cases of AA from our center at AA diagnosis, and on the efficacy of IST. This was compared to 22 cases of HBVAA at AA onset as well as the associated IST outcomes.Results: Nine patients with SNHAA developed severe aplastic anemia, with a median age of 18 years. After IST, six (60% of the SNHAA patients achieved complete remission and two achieved partial remission. The patients with HBVAA had a total response rate of 82.3%. The disease recurred in two HBVAA patients. No statistically significant differences were observed in response rate, mortality, and recurrence rate between both groups. As compared with HBVAA, patients with SNHAA had a shorter interval from the acute episode of hepatitis to AA onset (4 months versus 92 months, P=0.00, a quicker response to IST (2.5 months versus 4.5 months, P=0.018, a lower proportion of bone marrow hematopoietic tissues (20.6% versus 23.6%, P=0.03, and lower white blood cell and absolute neutrophil count (0.8×109/L versus 1.23×109/L and 0.26×109/L versus 0.58×109/L, P=0.026 and P=0.0009, respectively. No significant liver damage or hepatitis B fulminant infection was observed in either group during the follow-up. Conclusion: The prevalence of SNHAA is 3.01%. SNHAA often presents as severe AA and responds to IST quickly

  14. 20(S-ginsenoside Rg3 promotes senescence and apoptosis in gallbladder cancer cells via the p53 pathway

    Zhang F

    2015-08-01

    Full Text Available Fei Zhang,* Maolan Li,* Xiangsong Wu,* Yunping Hu, Yang Cao, Xu’an Wang, Shanshan Xiang, Huaifeng Li, Lin Jiang, Zhujun Tan, Wei Lu, Hao Weng, Yijun Shu, Wei Gong, Xuefeng Wang, Yong Zhang, Weibin Shi, Ping Dong,# Jun Gu,# Yingbin Liu#Department of General Surgery and Laboratory of General Surgery, Xinhua Hospital Affiliated to Shanghai Jiao Tong University, School of Medicine, Institute of Biliary Tract Disease, Shanghai Jiao Tong University School of Medicine, Shanghai, People’s Republic of China *These authors contributed equally to this work #These authors jointly directed this work Abstract: Gallbladder cancer (GBC, the most frequent malignancy of the biliary tract, is associated with high mortality and extremely poor prognosis. 20(S-ginsenoside Rg3 (20(S-Rg3 is a steroidal saponin with high pharmacological activity. However, the anticancer effect of 20(S-Rg3 in human GBC has not yet been determined. In this study, we primarily found that 20(S-Rg3 exposure suppressed the survival of both NOZ and GBC-SD cell lines in a concentration-dependent manner. Moreover, induction of cellular senescence and G0/G1 arrest by 20(S-Rg3 were accompanied by a large accumulation of p53 and p21 as a result of murine double minute 2 (MDM2 inhibition. 20(S-Rg3 also caused a remarkable increase in apoptosis via the activation of the mitochondrial-mediated intrinsic caspase pathway. Furthermore, intraperitoneal injection of 20(S-Rg3 (20 or 40 mg/kg for 3 weeks markedly inhibited the growth of xenografts in nude mice. Our results demonstrated that 20(S-Rg3 potently inhibited growth and survival of GBC cells both in vitro and in vivo. 20(S-Rg3 attenuated GBC growth probably via activation of the p53 pathway, and subsequent induction of cellular senescence and mitochondrial-dependent apoptosis. Therefore, 20(S-Rg3 may be a potential chemotherapeutic agent for GBC therapy.Keywords: gallbladder cancer, 20(S-ginsenoside Rg3, senescence, apoptosis, p53 pathway

  15. Cisplatin-resistant lung cancer cell–derived exosomes increase cisplatin resistance of recipient cells in exosomal miR-100–5p-dependent manner

    Qin X

    2017-05-01

    Full Text Available Xiaobing Qin,1,2,* Shaorong Yu,1,3,* Leilei Zhou,1,4 Meiqi Shi,3 Yong Hu,1 Xiaoyue Xu,1 Bo Shen,1 Siwen Liu,1 Dali Yan,1 Jifeng Feng1,3 1Research Center for Clinical Oncology, Affiliated Cancer Hospital of Nanjing Medical University, Jiangsu Cancer Hospital and Jiangsu Institute of Cancer Research, Nanjing, 2Department of Oncology, Xuzhou First People’s Hospital, Xuzhou, 3Department of Oncology, Affiliated Cancer Hospital of Nanjing Medical University, Jiangsu Cancer Hospital and Jiangsu Institute of Cancer Research, Nanjing, 4Department of Oncology, Affiliated Huai’an Hospital of Nanjing Medical University, Huai’an, Jiangsu, China *These authors have contributed equally to this work Abstract: Exosomes derived from lung cancer cells confer cisplatin (DDP resistance to other cancer cells. However, the underlying mechanism is still unknown. A549 resistance to DDP (A549/DDP was established. Microarray was used to analyze microRNA (miRNA expression profiles of A549 cells, A549/DDP cells, A549 exosomes, and A549/DDP exosomes. There was a strong correlation of miRNA profiles between exosomes and their maternal cells. A total of 11 miRNAs were significantly upregulated both in A549/DDP cells compared with A549 cells and in exosomes derived from A549/DDP cells in contrast to exosomes from A549 cells. A total of 31 downregulated miRNAs were also observed. miR-100–5p was the most prominent decreased miRNA in DDP-resistant exosomes compared with the corresponding sensitive ones. Downregulated miR-100–5p was proved to be involved in DDP resistance in A549 cells, and mammalian target of rapamycin (mTOR expression was reverse regulated by miR-100–5p. Exosomes confer recipient cells’ resistance to DDP in an exosomal miR-100–5p-dependent manner with mTOR as its potential target both in vitro and in vivo. Exosomes from DDP-resistant lung cancer cells A549 can alter other lung cancer cells’ sensitivity to DDP in exosomal miR-100–5p

  16. Genetics Home Reference: 3-beta-hydroxysteroid dehydrogenase deficiency

    ... for This Page Lutfallah C, Wang W, Mason JI, Chang YT, Haider A, Rich B, Castro-Magana ... A, Copeland KC, Chang YT, Lutfallah C, Mason JI. Carriers for type II 3beta-hydroxysteroid dehydrogenase (HSD3B2) ...

  17. Factor X assay

    ... Benz EJ Jr, Silberstein LE, Heslop HE, Weitz JI, Anastasi J, eds. Hematology: Basic Principles and Practice . ... Benz EJ Jr, Silberstein LE, Heslop HE, Weitz JI, Anastasi J, eds. Hematology: Basic Principles and Practice . ...

  18. Raudbetoonist vaade / Sveta Grigorjeva

    Grigorjeva, Sveta, 1988-

    2016-01-01

    Arvustus: Billeneeve. Sügis nagu lõppev suhe : [luuletused]. Saarde ; Pärnu : [Jumalikud Ilmutused], 2015. (Ji ; 75) ; Ühe aknaga maailm : [luuletused]. Saarde ; Pärnu : [Jumalikud Ilmutused], 2016. (Ji ; 80)

  19. Thrombocytopenia

    ... Benz EJ Jr, Silberstein LE, Heslop HE, Weitz JI, Anastasi J, eds. Hematology: Basic Principles and Practice . ... Benz EJ Jr, Silberstein LE, Heslop HE, Weitz JI, Anastasi J, eds. Hematology: Basic Principles and Practice . ...

  20. Genetics Home Reference: IRAK-4 deficiency

    ... Blanco JC, Salkowski C, Zhang S, Arditi M, Gallin JI, Vogel SN. Distinct mutations in IRAK-4 confer ... Ghonaium A, Day-Good NK, Holland SM, Gallin JI, Chapel H, Speert DP, Rodriguez-Gallego C, Colino ...

  1. Porous Se@SiO2 nanospheres treated paraquat-induced acute lung injury by resisting oxidative stress

    Zhu Y

    2017-09-01

    Full Text Available Yong Zhu,1,* Guoying Deng,2,* Anqi Ji,2 Jiayi Yao,1 Xiaoxiao Meng,1 Jinfeng Wang,1 Qian Wang,2 Qiugen Wang,2 Ruilan Wang1 1Department of Critical Care Medicine, Shanghai General Hospital, Shanghai Jiaotong University, School of Medicine, 2Trauma Center, Shanghai General Hospital, Shanghai Jiaotong University, School of Medicine, Shanghai, China *These authors contributed equally to this work Abstract: Acute paraquat (PQ poisoning is one of the most common forms of pesticide poisoning. Oxidative stress and inflammation are thought to be important mechanisms in PQ-induced acute lung injury (ALI. Selenium (Se can scavenge intracellular free radicals directly or indirectly. In this study, we investigated whether porous Se@SiO2 nanospheres could alleviate oxidative stress and inflammation in PQ-induced ALI. Male Sprague Dawley rats and RLE-6TN cells were used in this study. Rats were categorized into 3 groups: control (n=6, PQ (n=18, and PQ + Se@SiO2 (n=18. The PQ and PQ + Se@SiO2 groups were randomly and evenly divided into 3 sub-groups according to different time points (24, 48 and 72 h after PQ treatment. Porous Se@SiO2 nanospheres 1 mg/kg (in the PQ + Se@SiO2 group were administered via intraperitoneal injection every 24 h. Expression levels of reduced glutathione, malondialdehyde, superoxide dismutase, reactive oxygen species (ROS, nuclear factor-κB (NF-κB, phosphorylated NF-κB (p-NF-κB, tumor necrosis factor-α and interleukin-1β were detected, and a histological analysis of rat lung tissues was performed. The results showed that the levels of ROS, malondialdehyde, NF-κB, p-NF-κB, tumor necrosis factor-α and interleukin-1β were markedly increased after PQ treatment. Glutathione and superoxide dismutase levels were reduced. However, treatment with porous Se@SiO2 nanospheres markedly alleviated PQ-induced oxidative stress and inflammation. Additionally, the results from histological examinations and wet-to-dry weight ratios of rat lung

  2. Enhanced immunization via dissolving microneedle array-based delivery system incorporating subunit vaccine and saponin adjuvant

    Zhao JH

    2017-07-01

    Full Text Available Ji-Hui Zhao,1,* Qi-Bo Zhang,1,* Bao Liu,2 Xiang-Hua Piao,1 Yu-Lu Yan,1 Xiao-Ge Hu,1 Kuan Zhou,1 Yong-Tai Zhang,1 Nian-Ping Feng1 1School of Pharmacy, Shanghai University of Traditional Chinese Medicine, Shanghai, People’s Republic of China; 2Anethesiology Department, Augusta University, Augusta, GA, USA *These authors contributed equally to this work Purpose: To enhance the immunogenicity of the model subunit vaccine, ovalbumin (OVA was combined with platycodin (PD, a saponin adjuvant. To reduce the toxicity of PD, OVA, and adjuvant were loaded together into liposomes before being incorporated into a dissolving microneedle array.Methods: OVA- and PD-loaded liposomes (OVA-PD-Lipos were prepared using the film dispersion method. Their uptake behavior, toxicity to mouse bone marrow dendritic cells (BMDCs, and hemolytic activity to rabbit red blood cells (RBCs were evaluated. The OVA-PD-Lipos were incorporated into a dissolving microneedle array. The chemical stability of OVA and the physical stability of OVA-PD-Lipos in microneedle arrays were investigated. The immune response of Institute of Cancer Research mice and potential skin irritation reaction of rabbits to OVA-PD-Lipos-MNs were evaluated.Results: The uptake of OVA by mouse BMDCs was greatly enhanced when OVA was prepared as OVA-PD-Lipos, and in this form, the toxicity of PD was dramatically reduced. OVA was chemically stable as OVA-PD-Lipos, when OVA-PD-Lipos was incorporated into a dissolving microneedle array. Institute of Cancer Research mice treated with OVA-PD-Lipos-MNs showed a significantly enhanced immune response. PD combined with OVA elicited a balanced Th1 and Th2 humoral immune response in mice, with minimal irritation in rabbit skin.Conclusion: The dissolving microneedle array-based system is a promising delivery vehicle for subunit vaccine and its adjuvant. Keywords: subunit vaccine, saponin adjuvant, liposomes, dissolving microneedle array, intradermal vaccination

  3. Clinical applications of somatostatin analogs for growth hormone-secreting pituitary adenomas

    Wang JW

    2014-01-01

    Full Text Available Ji-wen Wang,1,2 Ying Li,3 Zhi-gang Mao,1,2 Bin Hu,1,2 Xiao-bing Jiang,1,2 Bing-bing Song,4 Xin Wang,4 Yong-hong Zhu,4 Hai-jun Wang1,21Department of Neurosurgery and Pituitary Tumor Center, The First Affiliated Hospital, Sun Yat-sen University, 2Key Laboratory of Pituitary Adenoma in Guangdong Province, 3State Key Laboratory of Ophthalmology, Zhongshan Ophthalmic Center, Sun Yat-sen University, 4Department of Histology and Embryology, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, People's Republic of ChinaAbstract: Excessive growth hormone (GH is usually secreted by GH-secreting pituitary adenomas and causes gigantism in juveniles or acromegaly in adults. The clinical complications involving cardiovascular, respiratory, and metabolic systems lead to elevated morbidity in acromegaly. Control of serum GH and insulin-like growth factor (IGF 1 hypersecretion by surgery or pharmacotherapy can decrease morbidity. Current pharmacotherapy includes somatostatin analogs (SAs and GH receptor antagonist; the former consists of lanreotide Autogel (ATG and octreotide long-acting release (LAR, and the latter refers to pegvisomant. As primary medical therapy, lanreotide ATG and octreotide LAR can be supplied in a long-lasting formulation to achieve biochemical control of GH and IGF-1 by subcutaneous injection every 4–6 weeks. Lanreotide ATG and octreotide LAR provide an effective medical treatment, whether as a primary or secondary therapy, for the treatment of GH-secreting pituitary adenoma; however, to maximize benefits with the least cost, several points should be emphasized before the application of SAs. A comprehensive assessment, especially of the observation of clinical predictors and preselection of SA treatment, should be completed in advance. A treatment process lasting at least 3 months should be implemented to achieve a long-term stable blood concentration. More satisfactory surgical outcomes for noninvasive macroadenomas treated

  4. IGF2BP3 as a potential tissue marker for the diagnosis of esophageal high-grade intraepithelial neoplasia

    Zhang JJ

    2017-08-01

    Full Text Available Jingjing Zhang,1,* Qing Ji,2,* Chunhua Jiao,3,* Lihua Ren,4 Ye Zhao,4 Yanfang Chen,4 Ruihua Shi,4 Yadong Feng4 1State Key Laboratory of Reproductive Medicine, Department of Prenatal Diagnosis, Obstetrics and Gynecology Hospital Affiliated to Nanjing Medical University, Nanjing, 2Department of Emergency, Jingjiang People’s Hospital, Jingjiang, 3Department of Gastroenterology, First Affiliated Hospital with Nanjing Medical University, 4Department of Gastroenterology, Zhongda Hospital, School of Medicine, Southeast University, Nanjing, People’s Republic of China *These authors contributed equally to this work Background: The clinical significance of insulin-like growth factor-II mRNA-binding protein-3 (IGF2BP3 in esophageal high-grade intraepithelial neoplasia (HGIN is not clear. This study was designed to characterize the expression of IGF2BP3 in HGIN. Patients and methods: IGF2BP3 expression was evaluated by Western blot analyses in 12 cases and by immunohistochemistry (IHC in 112 cases. The associations between IGF2BP3 expression in HGIN and the clinicopathological parameters were examined. Results: Moderate to strong IGF2BP3 expression was present in HGIN samples. Using IHC, it was found that IGF2BP3 was positive in 68 (60.71% cases. Intense IHC of IGF2BP3 in HGIN was associated with a deeper lesion depth, and the lesion depth was the only predictor of the positive expression of IGF2BP3. Conclusion: Our results suggested that IGF2BP3 may be a supplementary tissue marker for preoperative diagnosis of HGIN. Keywords: esophageal squamous cell carcinoma, precancerous lesion, immunohistochemistry detection, early diagnosis

  5. An n-dimensional pseudo-differential operator involving the Hankel ...

    ji =0 bji x. 2 ji +μ+1/2 i. (x−1 i ∂/∂xi )ri + ji. (x. −μ−1/2 i φ(x1,..., xn)). ⎞. ⎠ ,. (1.8) where the bji are constants depending only on μ. For i = 1, 2,..., n, let (xi , yi , zi ) ...

  6. Blogs and Wikis as Instructional Tools: A Social Software Adaptation of Just-in-Time Teaching

    Higdon, Jude; Topaz, Chad

    2009-01-01

    Just-in-Time Teaching (JiTT) methodology uses Web-based tools to gather student responses to questions on preclass reading assignments. However, the technological requirements of JiTT and the content-specific nature of the questions may prevent some instructors from implementing it. Our own JiTT implementation uses publicly and freely available…

  7. [Raamat] / Elisa Loopealne

    Loopealne, Elisa

    2007-01-01

    Tutvustus: Bristol, Piret. Nöörist ja seebist. Pärnu : Jumalikud Ilmutused, 2006. (Ji) ; Kivisildnik. Vägistatud jäämägi. Pärnu : Jumalikud Ilmutused, 2006. (Ji) ; Sild, Ivar. Spermaga ja puha. Pärnu : Jumalikud Ilmutused, 2006. (Ji) ; Meiel, Kaupo. Polügrafisti käsiraamat, 2006

  8. Koreade juhid lõid rahu eelduseks käed / Triin Oppi

    Oppi, Triin

    2007-01-01

    Lõuna-Korea president Roh Moo-Hyan ja Põhja-Korea rahvavabariigi juht Kim Yong Il tõotavad ühisavalduses muuta Korea poolsaare tuumavabaks ja edendada kaubavahetust, turismi ja poliitilist läbikäimist

  9. Chemical engineering in the pharmaceutical industry: R&D to manufacturing

    Ende, David J. am

    2011-01-01

    ... Process R&D Edward L. Paul 73 7 Reaction Kinetics and Characterization Utpal K. Singh and Charles J. Orella 79 vvi CONTENTS 8 Understanding Rate Processes in Catalytic Hydrogenation Reactions Yong...

  10. The Role of MicroRNAs in Pancreatitis

    2015-10-01

    AD______________ AWARD NUMBER: W81XWH-14-1-0469 TITLE: The Role of microRNAs in Pancreatitis PRINCIPAL INVESTIGATOR: Li, Yong RECIPIENT...The Role of MicroRNAs in Pancreatitis 5b. GRANT NUMBER W81XWH-14-1-0469 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER Li, Yong 5e...AVAILABILITY STATEMENT Approved for Public Release; Distribution Unlimited 13. SUPPLEMENTARY NOTES 14. ABSTRACT Pancreatitis (inflammation of the

  11. Teaching undergraduate biomechanics with Just-in-Time Teaching.

    Riskowski, Jody L

    2015-06-01

    Biomechanics education is a vital component of kinesiology, sports medicine, and physical education, as well as for many biomedical engineering and bioengineering undergraduate programmes. Little research exists regarding effective teaching strategies for biomechanics. However, prior work suggests that student learning in undergraduate physics courses has been aided by using the Just-in-Time Teaching (JiTT). As physics understanding plays a role in biomechanics understanding, the purpose of study was to evaluate the use of a JiTT framework in an undergraduate biomechanics course. This two-year action-based research study evaluated three JiTT frameworks: (1) no JiTT; (2) mathematics-based JiTT; and (3) concept-based JiTT. A pre- and post-course assessment of student learning used the biomechanics concept inventory and a biomechanics concept map. A general linear model assessed differences between the course assessments by JiTT framework in order to evaluate learning and teaching effectiveness. The results indicated significantly higher learning gains and better conceptual understanding in a concept-based JiTT course, relative to a mathematics-based JiTT or no JiTT course structure. These results suggest that a course structure involving concept-based questions using a JiTT strategy may be an effective method for engaging undergraduate students and promoting learning in biomechanics courses.

  12. 專論/台灣圖書館史數位圖書館建構之研究/王梅玲;蔡明月;陳志銘;柯雲娥;蔡佳縈;陳勇汀;林怡甄 | A Digital Library Pilot Study on Taiwan Libraries' History / Mei-Ling Wang; Ming-Yueh Tsay; Chih-Ming Chen; Yun-Er Ke; Chia-Ying Tsai; Yong-Ting Chen; Yi-Jen Lin

    王梅玲、蔡明月、陳志銘、柯雲娥、蔡佳縈、陳勇汀、林怡甄

    2008-04-01

    Full Text Available

    圖書館是保存與詮釋人類文化重要的機構,1990 年代開始,網際網路的進步,促成數位圖書館蓬勃發展,有人預測它就是未來的圖書館,因此,圖書館界與教育界積極參與相關研究。台灣地區歷經日據時期、重建 時期、成長時期及茁壯時期四階段,建設許多圖書館,有其豐富的主題與素材值得發展成為數位圖書館。政治大學圖書資訊與檔案學研究所有鑑於此,提出「『台灣 百無圖書館史』數位圖書館」的構想,並獲得政大「發展國際一流大學及頂尖研究中心計畫」經費支持。本研究計畫目的包括:(1探索以台彎圖書館事業史為主 題的數位圖書館建構模式;(2建構數位圖書館以支援圖書資訊學教育與研究;(3研訂圖書館事業史料文獻的Metadata與數位資料格式;(4將圖 書文獻與文物數位化以建構數位館藏;(5發展數位圖書館系統與技術;(6研發數位圖書館網站的瀏覽與檢索功能;(7探討數位圖書館支援數位學習的模 式。計畫成果共研訂六種 Metadata標準:建置746筆數位化資料;以Dspace系統平台,依據需求設計台灣百年圖書館史系統架構與網站,最後提出結論與建議。

    Libraries are important social institutions that preserve and communicate human culture and knowledge. From the beginning of 1990s, the digital library has grown up rapidly based on the progress of the Internet. Libraries and educational institutions should be actively involved in digital library research and development. The Taiwan libraries’ history can be divided into four stages: Japanese occupation period, reconstruction period, growth period and strong period. In these processes, many events and libraries with rich materials that can be developed into a digital library. Graduate Institute of Library, Information and Archival Studies, National Chengchi University, planned the Digital Library Pilot Study on Taiwan Libraries’ History and got the university support. The pilot study objectives include: (1 exploring the digital library model on Taiwan libraries' history; (2 constructing digital library to support education and research in information and library science; (3 developing Metadata standards of library documents and heritage; (4 digitalizing documents and heritage to build digital collections (5 developing digital library systems and technology; (6 researching browsing and search functions of the digital library; (7 exploring the model of the digital library supports e-learning. In this pilot study, we developed six Metadata standards, built 746 digital resources, constructed a digital library system and web site, and proposed the conclusions and suggestions finally.

    頁次:15-38

  13. Joint Implementation under the UN Framework Convention on Climate Change. Technical and institutional challenges

    Swisher, J.N.

    1997-01-01

    The UN Framework Convention of Climate Change (FCCC) allows for the Joint Implementation (JI) of measures to mitigate the emissions of greenhouse gases. The concept of JI refers to the implementation of such measures in one country with partial and/or technical support from another country, potentially fulfilling some of the supporting country's emission-reduction commitment under the FCCC. At present, all JI transactions are voluntary, and no country has claimed JI credit against existing FCCC commitments. Nevertheless, JI could have important implications for both the economic efficiency and the international equity of the implementation of the FCCC. The paper discusses some of the information needs of JI projects and seeks to clarify some of the common assumptions and arguments about JI. Issues regarding JI are distinguished according to those that are specific to JI as well as other types of regimes and transactions. The focus is on the position of developing countries and their potential risks and benefits regarding JI. 2 figs., 3 tabs., 35 refs

  14. Fotografové ve službách aristokracie. Vizuální reprezentace buquoyského panství za Jiřího Jana Jindřicha Buquoye v polovině 19. století

    Trnková, Petra

    2011-01-01

    Roč. 59, č. 2 (2011), s. 145-160 ISSN 0049-5123 R&D Projects: GA MŠk(CZ) 7F09107 Institutional research plan: CEZ:AV0Z80330511 Keywords : Buquoy * photography * 19th century Subject RIV: AL - Art , Architecture, Cultural Heritage

  15. Fiscal 2000 report on geothermal energy development promotion survey. Phase 1. Report on environmental impact survey in No. C-5 Appi district (Weather); 2000 nendo chinetsu kaihatsu sokushin chosa hokokusho. No.C-5. Appi chiiki - kankyo eikyo chosa (kisho) dai 1 ji

    NONE

    2001-07-01

    For grasping the characteristics of weather, climate, and natural earthquakes in and around the geothermal survey area in the Appi district, Iwate Prefecture, observation data of weather stations or the like in the neighborhood were collected and put in an easy-to-use order. Weather and earthquake data of the 1990-1999 decade were collected and subjected to statistical processing. Weather in the Appi District Survey C area is characterized in that it assumes the Japan Sea side pattern with much snow in winter and much rain in the rainy season. In the other seasons, however, it assumes the Pacific side inland pattern. Weather data in the Appi district and its vicinity are deemed to be similar to the values observed at the Hachimantai weather station. The area covered by the survey, however, is higher than the Hachimantai weather station by 400-900m, and therefore is that much colder and has more rain and snow. As for earthquakes, a total of 647 were recorded in the decade 1990-1999. In the Appi District Survey C area, which is approximately 20km times 20km large, suffered 31.1 events/month in 1998, which indicated a great rise in seismic occurrence. The rise is now attributed to the volcanic activity of Mt. Iwate which is deemed to be waning. (NEDO)

  16. Utajovaná přívalová povodeň na jižní Moravě 9. června 1970. K 40. výročí přírodní katastrofy, která si vyžádala 35 lidských životů

    Munzar, Jan; Ondráček, Stanislav

    2010-01-01

    Roč. 89, č. 6 (2010), s. 376-379 ISSN 0042-4544 Institutional research plan: CEZ:AV0Z30860518 Keywords : catastrophic flash flood * Southern Moravia * communist censorship Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  17. Švejk na nás něco ví : S Jiřím Trávníčkem o zániku románu, českých čtenářích a o knihách, na něž nesahá

    Trávníček, Jiří

    2007-01-01

    Roč. 18, č. 47 (2007), s. 42-45 ISSN 0862-6545 Institutional research plan: CEZ:AV0Z90560517 Keywords : Reading Surveys (2007) * Contemporary Novel Subject RIV: AJ - Letters, Mass-media, Audiovision

  18. Rybník jako součást hospodářství vrchnostenského panství a indikátor podoby krajiny jižního Valašska v 15. až 17. století

    Petřík, J.; Hlavica, M.; Petr, L.; Chmela, T.; Schenk, Z.; Lukšíková, H.; Milo, P.; Vrla, R.; Odehnal, P.; Petrůj, Z.; Petrůj, M.; Kočár, Petr

    2017-01-01

    Roč. 42, č. 2 (2017), s. 789-817 ISSN 0231-5823 Institutional support: RVO:67985912 Keywords : fish farming * southern Moravian Wallachia (Czech Republic) * late Middle Ages Subject RIV: AC - Archeology, Anthropology, Ethnology OBOR OECD: Archaeology http://hdl.handle.net/11222.digilib/137056

  19. Intermediate and longer-term outcomes from a prospective active-surveillance program for favorable-risk prostate cancer. Tosoian JJ, Mamawala M, Epstein JI, Landis P, Wolf S, Trock BJ, Carter HB.J Clin Oncol. 2015 Oct 20;33(30):3379-85. [Epub 2015 Aug 31]. doi: 10.1200/JCO.2015.62.5764.

    Scott, Eggener; Mamawala, M; Epstein, J I; Landis, P; Wolf, S; Trock; Carter, H B

    2017-03-01

    To assess long-term outcomes of men with favorable-risk prostate cancer in a prospective, active surveillance program. Curative intervention was recommended for disease reclassification to higher cancer grade or volume on prostate biopsy. Primary outcomes were overall, cancer-specific, and metastasis-free survival. Secondary outcomes were the cumulative incidence of reclassification and curative intervention. Factors associated with grade reclassification and curative intervention were evaluated in a Cox proportional hazards model. A total of 1,298 men (median age = 66y) with a median follow-up of 5 years (range: 0.01-18.00y) contributed 6,766 person-years of follow-up since 1995. Overall, cancer-specific, and metastasis-free survival rates were 93%, 99.9%, and 99.4%, respectively, at 10 years and 69%, 99.9%, and 99.4%, respectively, at 15 years. The cumulative incidence of grade reclassification was 26% at 10 years and was 31% at 15 years; cumulative incidence of curative intervention was 50% at 10 years and was 57% at 15 years. The median treatment-free survival was 8.5 years (range: 0.01-18y). Factors associated with grade reclassification were older age (hazard ratio [HR] = 1.03 for each additional year; 95% CI: 1.01-1.06), prostate-specific antigen density (HR = 1.21 per 0.1 unit increase; 95% CI: 1.12-1.46), and greater number of positive biopsy cores (HR = 1.47 for each additional positive core; 95% CI: 1.26-1.69). Factors associated with intervention were prostate-specific antigen density (HR = 1.38 per 0.1 unit increase; 95% CI: 1.22-1.56) and a greater number of positive biopsy cores (HR = 1.35 for one additional positive core; 95% CI: 1.19-1.53). Men with favorable-risk prostate cancer should be informed of the low likelihood of harm from their diagnosis and should be encouraged to consider surveillance rather than curative intervention. Copyright © 2017. Published by Elsevier Inc.

  20. Subsurface temperature estimation from climatology and satellite SST for the sea around Korean Peninsula 1Bong-Guk, Kim, 1Yang-Ki, Cho, 1Bong-Gwan, Kim, 1Young-Gi, Kim, 1Ji-Hoon, Jung 1School of Earth and Environmental Sciences, Seoul National University

    Kim, Bong-Guk; Cho, Yang-Ki; Kim, Bong-Gwan; Kim, Young-Gi; Jung, Ji-Hoon

    2015-04-01

    Subsurface temperature plays an important role in determining heat contents in the upper ocean which are crucial in long-term and short-term weather systems. Furthermore, subsurface temperature affects significantly ocean ecology. In this study, a simple and practical algorithm has proposed. If we assume that subsurface temperature changes are proportional to surface heating or cooling, subsurface temperature at each depth (Sub_temp) can be estimated as follows PIC whereiis depth index, Clm_temp is temperature from climatology, dif0 is temperature difference between satellite and climatology in the surface, and ratio is ratio of temperature variability in each depth to surface temperature variability. Subsurface temperatures using this algorithm from climatology (WOA2013) and satellite SST (OSTIA) where calculated in the sea around Korean peninsula. Validation result with in-situ observation data show good agreement in the upper 50 m layer with RMSE (root mean square error) less than 2 K. The RMSE is smallest with less than 1 K in winter when surface mixed layer is thick, and largest with about 2~3 K in summer when surface mixed layer is shallow. The strong thermocline and large variability of the mixed layer depth might result in large RMSE in summer. Applying of mixed layer depth information for the algorithm may improve subsurface temperature estimation in summer. Spatial-temporal details on the improvement and its causes will be discussed.