WorldWideScience

Sample records for shi ni okeru

  1. Dark matter at the SHiP experiment

    International Nuclear Information System (INIS)

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  2. Dicty_cDB: SHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  3. Dicty_cDB: SHI777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  4. Civil Engineering for the SHiP facility

    CERN Document Server

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  5. Dicty_cDB: SHI251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  6. Radiation protection studies for the SHiP facility

    CERN Document Server

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  7. Women stereotypes in Shi Zhecun's short stories.

    Science.gov (United States)

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  8. Brothers or Rivals? Iran and the Shi'a of Iraq

    National Research Council Canada - National Science Library

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  9. Interaction and conflict between Sufism and Shi`ism during Safavid era

    Directory of Open Access Journals (Sweden)

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  10. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    International Nuclear Information System (INIS)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  11. Dr. Shi Hanzhang's Experience in Treating Andropathy

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  12. Calibrating the SHiP muon-flux using NA61/SHINE

    CERN Document Server

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  13. $\\mu$-flux measurements for SHiP using NA61/SHINE

    CERN Document Server

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  14. Muon-flux measurements for SHiP at H4

    CERN Document Server

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  15. A SHiP to explore new routes

    CERN Multimedia

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  16. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Directory of Open Access Journals (Sweden)

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  17. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    International Nuclear Information System (INIS)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  18. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Science.gov (United States)

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  19. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  20. TianShuiShi space breeding current situation and developing trend

    International Nuclear Information System (INIS)

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  1. Search for New Physics in SHiP and at future colliders

    CERN Document Server

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  2. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Science.gov (United States)

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  3. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Science.gov (United States)

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  4. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    CERN Document Server

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  5. Study of nu-tau properties with the SHiP experiment

    CERN Document Server

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  6. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Science.gov (United States)

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  7. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Science.gov (United States)

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  8. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Directory of Open Access Journals (Sweden)

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  9. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Science.gov (United States)

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  10. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Science.gov (United States)

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  11. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Science.gov (United States)

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  12. ν{sub τ}-physics with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  13. Design of a detector to study associated charm production in the SHiP beam dump facility

    CERN Document Server

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  14. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Energy Technology Data Exchange (ETDEWEB)

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  15. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    CERN Document Server

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  16. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Science.gov (United States)

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  17. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    Directory of Open Access Journals (Sweden)

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  18. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  19. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    CERN Document Server

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  20. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  1. Extraction and beam transfer for the SHiP facility

    CERN Document Server

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  2. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Science.gov (United States)

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  3. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    African Journals Online (AJOL)

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  4. Catalytic technology in the energy/environment field. Utilization of catalyst in coal pyrolysis and gasification processes; Energy kankyo bun`ya ni okeru shokubai gijutsu. Sekitan no netsubunkai oyobi gas ka ni okeru shokubai no riyo

    Energy Technology Data Exchange (ETDEWEB)

    Otsuka, Y. [Tohoku University, Institute for Chemical Reaction Science (Japan)

    1998-05-20

    This review article focuses on the utilization of several catalysts during coal pyrolysis and gasification. In situ or off line catalytic upgrading of volatile matters during pyrolysis of low rank coals is carried out in pressurized H2 with different reactors to produce BTX (benzene, toluene and xylene). When NiSO4 and Ni(OH)2 are used in the hydropyrolysis of Australian brown coal using an entrained bed reactor with two separated reaction zones, BTX yield reaches 18-23%. MS-13X zeolite and USY zeolite mixed with Al2O3 are effective for producing BTX with powder-particle fluidized bed and two-stage reactors, respectively. Catalytic gasification is described from a standpoint of direct production of SNG(CH4) from coal and steam. When K2CO3 and Ni are compared for this purpose, Ni catalyst is more suitable at low temperatures of 500-600degC, where CH4 formation is thermodynamically favorable. Fe and Ca catalysts can successfully be prepared from inexpensive raw materials and are rather active for steam gasification at {>=}700degC. The use of upgrading and gasification catalysts is discussed in terms of preparation, performance, life and recovery. 27 refs., 6 figs., 2 tabs.

  5. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    CERN Document Server

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  6. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    CERN Document Server

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  7. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Science.gov (United States)

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  8. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    International Nuclear Information System (INIS)

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  9. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Science.gov (United States)

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  10. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  11. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Directory of Open Access Journals (Sweden)

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  12. SHI induced irradiation effect on Mo/Si interface

    International Nuclear Information System (INIS)

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  13. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Science.gov (United States)

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  14. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  15. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Directory of Open Access Journals (Sweden)

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  16. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Science.gov (United States)

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  17. SHiP: a new multipurpose beam-dump experiment at the SPS.

    CERN Document Server

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  18. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    DEFF Research Database (Denmark)

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  19. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    African Journals Online (AJOL)

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  20. The SHiP physics program

    Science.gov (United States)

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  1. 160 MeV Ni12+ ion irradiation effects on the structural, optical and electrical properties of spherical polypyrrole nanoparticles

    International Nuclear Information System (INIS)

    Hazarika, J.; Kumar, A.

    2014-01-01

    Highlights: • Upon SHI irradiation the average diameters of PPy nanoparticles increases. • Crystallinity of PPy nanoparticles increases with increasing ion fluence. • IR active vibrational bands have different cross sections for SHI irradiation. • Upon SHI irradiation optical band gap energy of PPy nanoparticles decreases. • Upon SHI irradiation thermal stability of PPy nanoparticles increases. -- Abstract: In this study we report 160 MeV Ni 12+ swift heavy ion irradiation induced enhancement in the structural, optical and electrical properties of spherical polypyrrole (PPy) nanoparticles. High resolution transmission electron microscope results show that the pristine PPy nanoparticles have an average diameter of 11 nm while upon irradiation the average diameter increases to 18 nm at the highest ion fluence of 1 × 10 12 ions/cm 2 . X-ray diffraction studies show an enhancement of crystallinity and average crystallite size of PPy nanoparticles with increasing fluence. Studies of Fourier transform infrared spectra suggest the structural modifications of different functional groups upon irradiation. It also reveals that different functional groups have different sensitivity to irradiation. The infrared active N–H vibrational band at 3695 cm −1 is more sensitive to irradiation with a formation cross-section of 5.77 × 10 −13 cm 2 and effective radius of 4.28 nm. The UV–visible absorption spectra of PPy nanoparticles show that the absorption band undergoes a red shift with increasing fluence. Moreover upon irradiation the optical band gap energy decreases and Urbach’s energy increases with fluence. Thermo-gravimetric analysis studies suggest that upon irradiation the thermal stability of PPy nanoparticles increases which may be attributed to their enhanced crystallinity. Current–voltage characteristics of PPy nanoparticles exhibit non-Ohmic, symmetric behavior which increases with fluence

  2. 160 MeV Ni{sup 12+} ion irradiation effects on the structural, optical and electrical properties of spherical polypyrrole nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Hazarika, J.; Kumar, A., E-mail: ask@tezu.ernet.in

    2014-01-01

    Highlights: • Upon SHI irradiation the average diameters of PPy nanoparticles increases. • Crystallinity of PPy nanoparticles increases with increasing ion fluence. • IR active vibrational bands have different cross sections for SHI irradiation. • Upon SHI irradiation optical band gap energy of PPy nanoparticles decreases. • Upon SHI irradiation thermal stability of PPy nanoparticles increases. -- Abstract: In this study we report 160 MeV Ni{sup 12+} swift heavy ion irradiation induced enhancement in the structural, optical and electrical properties of spherical polypyrrole (PPy) nanoparticles. High resolution transmission electron microscope results show that the pristine PPy nanoparticles have an average diameter of 11 nm while upon irradiation the average diameter increases to 18 nm at the highest ion fluence of 1 × 10{sup 12} ions/cm{sup 2}. X-ray diffraction studies show an enhancement of crystallinity and average crystallite size of PPy nanoparticles with increasing fluence. Studies of Fourier transform infrared spectra suggest the structural modifications of different functional groups upon irradiation. It also reveals that different functional groups have different sensitivity to irradiation. The infrared active N–H vibrational band at 3695 cm{sup −1} is more sensitive to irradiation with a formation cross-section of 5.77 × 10{sup −13} cm{sup 2} and effective radius of 4.28 nm. The UV–visible absorption spectra of PPy nanoparticles show that the absorption band undergoes a red shift with increasing fluence. Moreover upon irradiation the optical band gap energy decreases and Urbach’s energy increases with fluence. Thermo-gravimetric analysis studies suggest that upon irradiation the thermal stability of PPy nanoparticles increases which may be attributed to their enhanced crystallinity. Current–voltage characteristics of PPy nanoparticles exhibit non-Ohmic, symmetric behavior which increases with fluence.

  3. 3D seismic experiment in difficult area in Japan; Kokunai nanchiiki ni okeru sanjigen jishin tansa jikken

    Energy Technology Data Exchange (ETDEWEB)

    Minegishi, M; Nakagami, K; Tanaka, H [Japan National Oil Corp., Tokyo (Japan). Technology Research Center

    1997-05-27

    Difficult area in this context means an exploration-difficult area supposed to store oil/gas but retarded in exploration for the lack of knowledge about the geological structure due to poor quality of available seismic survey records. Discussed in this paper is a survey conducted into an area covering the southern part of Noshiro-shi, Akita-ken, and Yamamoto-cho, Yamamoto-gun, Akita-ken. An area size suitable for data collection at a target depth of 2500m is determined using an interpretation structure compiled on the basis of available well data and 2D seismic survey data. The plan for siting shock points and receiving points is modified case by case as restrictive factors come to the surface (resulting from the complicated hilly terrain, presence of pipes for agricultural water, etc.). The peculiarities of seismic waves in the terrain are studied through the interpretation of the available well data and 2D seismic survey data for the construction of a 3D velocity model for the confirmation of the appropriateness of the plan for siting shock points and receiving points. Efforts are exerted through enhanced coordination with the contractor to acquire data so that a technologically best design may be won within the limits of the budget. The quality of the data obtained from this experiment is in general better than those obtained from previous experiments, yet many problems remain to be settled in future studies about exploration-difficult areas. 4 refs., 4 figs., 1 tab.

  4. Tuning of optical and electrical properties of wide band gap Fe:SnO{sub 2}/Li:NiO p-n junctions using 80 MeV oxygen ion beam

    Energy Technology Data Exchange (ETDEWEB)

    Mistry, Bhaumik V.; Joshi, U.S. [Gujarat University, Department of Physics, School of Sciences, Ahmedabad (India); Avasthi, D.K. [Inter University Accelerator Centre, New Delhi (India)

    2016-12-15

    Electrical and optical properties of pristine and swift heavy ion (SHI) irradiated p-n junction diode have been investigated for advanced electronics application. Fe:SnO{sub 2}/Li:NiO p-n junction was fabricated by using pulsed laser deposition on c-sapphire substrate. The optical band gaps of Fe:SnO{sub 2} and Li:NiO films were obtained to be 3.88 and 3.37 eV, respectively. The current-voltage characteristics of the oxide-based p-n junction showed a rectifying behaviour with turn-on voltage of 0.95 V. The oxide-based p-n junction diode was irradiated to 80 MeV O{sup +6} ions with 1 x 10{sup 12} ions/cm{sup 2} fluence. Decrease in grain size due to SHI irradiation is confirmed by the grazing angle X-ray diffraction and atomic force microscopy. In comparison with the pristine p-n junction diode, O{sup +6} ion irradiated p-n junction diode shows the increase of surface roughness and decrease of percentage transmittance in visible region. For irradiated p-n junction diode, current-voltage curve has still rectifying behaviour but exhibits lower turn-on voltage than that of virgin p-n junction diode. (orig.)

  5. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Directory of Open Access Journals (Sweden)

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  6. Neutrino physics with the SHiP experiment

    CERN Document Server

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  7. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Science.gov (United States)

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  8. The SHiP project at CERN

    Science.gov (United States)

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  9. The SHiP experiment at CERN

    Science.gov (United States)

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  10. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Institute of Scientific and Technical Information of China (English)

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  11. Search for hidden particles with the SHiP experiment

    Energy Technology Data Exchange (ETDEWEB)

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  12. The SHiP experiment at CERN SPS

    CERN Document Server

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  13. Structural modification by swift heavy ion at metal/Si interface

    Energy Technology Data Exchange (ETDEWEB)

    Sisodia, Veenu; Jain, R.K.; Bhattacharaya, D.; Kabiraj, D.; Jain, I.P. E-mail: ipjain46@sify.com

    2003-06-01

    Transition metal silicides produced by swift heavy ion (SHI) irradiation have found applications in ultra-large-scale integrated circuits due to their small contact resistivities and higher thermal and chemical stabilities. In the present work, the mixing in Ni/Si and Ti/Si systems was studied under irradiation with Au ions. A layer of Ni (15 nm) and Ti (18 nm) was deposited by e-gun evaporation on Si (1 0 0) substrate at 10{sup -8} Torr vacuum. The samples were irradiated with 95 Mev Au ions at room temperature to a fluence of 10{sup 13} ions/cm{sup 2} and 1 pna beam current. Rutherford backscattering spectroscopy and X-Ray reflectivity have been employed to characterize the samples. The large electronic excitation due to SHI irradiation produces defects in the system. It is expected that SHI irradiation followed by thermal annealing in Ni/Si system will provide the required energy to the atoms to diffuse across the interface resulting in mixing.

  14. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Science.gov (United States)

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  15. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Science.gov (United States)

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  16. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  17. Neutrino scattering physics with the SHiP Experiment

    CERN Document Server

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  18. SHiP: a new facility to search for heavy neutrinos and study $\

    CERN Document Server

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  19. Improvement of magnetic properties of Fe-50mass%Ni in MIM process; MIM process ni okeru Fe-50mass%Ni no jiki tokusei kaizen

    Energy Technology Data Exchange (ETDEWEB)

    Miura, H. [Kumamoto University, Kumamoto (Japan). Faculty of Engineering; Fujita, S. [Kumamoto University, Kumamoto (Japan); Fujita, M.; Ninomiya, R. [Mitsuikinzoku Co. Ltd., Tokyo (Japan)

    2000-12-15

    Metal injection molding (MIM) process is hoped to be one of processing for required to more complicated parts of magnetic components. In this study, the effect of different types of powders (prealloyed and mixed elemental powders) on the magnetic properties of permalloy (Fe-50mass%Ni) through the MIM technique was investigated. Approximately 94% of theoretical density was obtained by using the prealloyed powder, and the retained carbon and oxygen contents were controlled to be low. On the other hand, 96% of theoretical density was obtained by using the mixed elemental powder, but the magnetic properties were inferior to that of prealloyed powder's because of high retained oxygen content. By using the carbonyl Fe powder with high carbon, the retained oxygen and carbon content could be controlled to be low, resulting in the improved magnetic properties. (author)

  20. Why investors shy away from coal

    International Nuclear Information System (INIS)

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  1. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Science.gov (United States)

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  2. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Science.gov (United States)

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  3. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Science.gov (United States)

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  4. First reliability test of a surface micromachined microengine using SHiMMeR

    Energy Technology Data Exchange (ETDEWEB)

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  5. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Science.gov (United States)

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  6. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Directory of Open Access Journals (Sweden)

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  7. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    Science.gov (United States)

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  8. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    Directory of Open Access Journals (Sweden)

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  9. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Directory of Open Access Journals (Sweden)

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  10. Bridging exchange bias effect in NiO and Ni(core)@NiO(shell) nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Rinaldi-Montes, Natalia, E-mail: nataliarin@gmail.com [Departamento de Física, Universidad de Oviedo, E-33007 Oviedo (Spain); Gorria, Pedro [Departamento de Física & IUTA, EPI, Universidad de Oviedo, E-33203 Gijón (Spain); Martínez-Blanco, David [Servicios Científico-Técnicos, Universidad de Oviedo, E-33006 Oviedo (Spain); Fuertes, Antonio B. [Instituto Nacional del Carbón, CSIC, E-33080 Oviedo (Spain); Fernández Barquín, Luis [CITIMAC, Facultad de Ciencias, Universidad de Cantabria, E-39005 Santander (Spain); Puente-Orench, Inés [Instituto de Ciencia de Materiales de Aragón, CSIC-Universidad de Zaragoza and Institut Laue-Langevin, BP 156, F-38042 Grenoble Cedex 9 (France); Blanco, Jesús A. [Departamento de Física, Universidad de Oviedo, E-33007 Oviedo (Spain)

    2016-02-15

    Among all bi-magnetic core(transition metal)@shell(transition metal oxide) nanoparticles (NPs), Ni@NiO ones show an onset temperature for the exchange bias (EB) effect far below the Néel temperature of bulk antiferromagnetic NiO. In this framework, the role played by the magnetism of NiO at the nanoscale is investigated by comparing the microstructure and magnetic properties of NiO and Ni@NiO NPs. With the aim of bridging the two systems, the diameter of the NiO NPs (~4 nm) is chosen to be comparable to the shell thickness of Ni@NiO ones (~2 nm). The EB effect in Ni@NiO NPs is attributed to the exchange coupling between the core and the shell, with an interfacial exchange energy of ΔE~0.06 erg cm{sup −2}, thus comparable to previous reports on Ni/NiO interfaces both in thin film and NP morphologies. In contrast, the EB detected in NiO NPs is explained in a picture where uncompensated spins located on a magnetically disordered surface shell are exchange coupled to the antiferromagnetic core. In all the studied NPs, the variation of the EB field as a function of temperature is described according to a negative exponential law with a similar decay constant, yielding a vanishing EB effect around T~40–50 K. In addition, the onset temperature for the EB effect in both NiO and Ni@NiO NPs seems to follow a universal dependence with the NiO crystallite size. - Highlights: • Comparison of the exchange bias effect in NiO and Ni(core)@NiO(shell) nanoparticles. • Universal temperature dependence of the exchange bias effect. • Suggested similar physical origin of the effect in both systems. • Size and crystallinity of the NiO shell hold the key for exchange bias properties.

  11. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Science.gov (United States)

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  12. Microstructural development in NiAl/Ni-Si-B/Ni transient liquid phase bonds

    International Nuclear Information System (INIS)

    Gale, W.F.; Orel, S.V.

    1996-01-01

    A transmission electron microscopy (TEM) based investigation of microstructural development during transient liquid phase bonding of near-stoichiometric NiAl to commercial purity nickel is presented in this article. The work described employed Ni-4.5 wt pct Si-3.2 wt pct B (BNi-3) melt-spun interlayers. The precipitation of both Ni-Al based phases and borides within the joint and adjacent substrate regions is discussed. The article considers martensite formation (within the NiAl substrate) and the precipitation of L1 2 type phases (both within the joint and at the interface with the NiAl substrate). The relative roles of the two substrate materials (NiAl and Ni) in the isothermal resolidification process are identified. The preferential formation of Ni 3 B boride phases in the Ni substrate near the original location of the Ni substrate-joint interface is discussed and contrasted with the absence of similar events in the NiAl substrate

  13. Internal carbonitriding behavior of Ni-V, Ni-Cr, and Ni-3Nb alloys

    International Nuclear Information System (INIS)

    Allen, A.T.; Douglass, D.L.

    1999-01-01

    Ni-2V, Ni-5V, Ni-12V, Ni-10Cr, Ni-20Cr, and Ni-3Nb alloys were carbonitrided in C 3 H 6 and NH 3 gas mixtures (bal H 2 ) over the range 700--1,000 C. Carbonitridation of Ni-12V and Ni-20Cr in C 3 H 6 /NH 3 /H 2 (1.5/1.5/97 v/o) and (1.5/10/88.5 v/o) produced duplex subscales consisting of near-surface nitrides with underlying carbides. Growth of each zone obeyed the parabolic rate law under most conditions. The presence of carbon generally did not effect the depth of the nitride zones compared to nitriding the alloys in NH 3 /H 2 (10/90 v/o). However, at 700 C, the nitride zones were deeper in the carbonitrided Ni-V alloys and Ni-20Cr. The presence of nitrogen generally increased the depth of the carbide zones in Ni-12V and Ni-20Cr compared to carburizing these alloys in C 3 H 6 /H 2 (1.5/98.5 v/o). VN, CrN, and NbN formed in Ni-V, Ni-Cr, and Ni-Nb alloys, respectively, whereas the underlying carbide layers contained V 4 C 3 in Ni-12V, Cr 3 C 2 above a zone of Cr 7 C 3 in Ni-20Cr, and NbC in Ni-3Nb. The solubilities and diffusivities of nitrogen and carbon in nickel were determined. Nitrogen and carbon each exhibited retrograde solubility with temperature in pure Ni in both carbonitriding environments. Nitrogen diffusion in nickel was generally lower in each carbonitriding mixture compared to nitrogen diffusion in a nitriding environment, except at 700 C when nitrogen diffusion was higher. Carbon diffusion in nickel was generally higher in the carbonitriding environments compared to carbon diffusion in a carburizing environment

  14. Study of street-blockades caused by a large earthquake; Daishinsaiji ni okeru doro heisoku ni knsuru kenkyu (Hanshin Awaji daishinsai ni okeru jittai bunseki)

    Energy Technology Data Exchange (ETDEWEB)

    Imaizumi, K. [Kajima Corp., Tokyo (Japan); Asami, Y. [The University of Tokyo, Tokyo (Japan)

    1999-09-30

    The Great Hanshin-Awaji Earthquake caused great damage to roads. Not only on highways, but even in regional communities, a considerable number of streets became unusable because of falls of buildings, etc. to roads and occurrence of bumps. It provided obstacles in refuge and rescue activities. In building cities preparing for earthquake in future, it is important to re-evaluate how to make the road network including narrow streets. Therefore, paying attention to the physical distance of the roads in earthquake and the number of the points which people cannot reach, clarified was the relation between those phenomena and the characteristics of towns/roads which the region has. As an example of Higashinada-ward, Kobe-city, this report analyzed the data on the actual state from the aspects written below which become especially important in actions taken immediately after earthquake, and described the information/knowledge obtained therefrom: (1) difference in arrival distance between usually and in earthquake in case of walking from residence place to refuge place; (2) state of occurrence of the points where people cannot reach in going to hospitals by ambulance. (NEDO)

  15. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Science.gov (United States)

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  16. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Directory of Open Access Journals (Sweden)

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  17. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    International Nuclear Information System (INIS)

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  18. arXiv Search for new physics with the SHiP experiment at CERN

    CERN Document Server

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  19. Progress in photometry. Sokko ni okeru saikinno shinpo

    Energy Technology Data Exchange (ETDEWEB)

    Krochmann, J

    1991-07-01

    A recent progress in photometry was summarized. As to photometric error, photometric head, luminous intensity, luminous flux, and lighting system, a present situation was introduced. Was described the error in photometry using a silicon photodiode, which became in a level of 0.1% by the self-calibration. Also were illustrated the photometric heads for evaluating spatial luminous intensities, the detector for ratio temperature measurement needed for calibration of a normal standard light source, the filter-type monochromator for measuring a difference of spectral response, and the solar battery for reference which can correct the photometer used for the long period in the field. A measurement of high-speed photocurrent was shown, in which the resolving power of 10{sup {minus}14}ampere (10{sup {minus}6}lux) can be achieved. A goniophotometer for luminous flux measurement was also introduced. Furthermore, the stimulation direct-reading colorimeter, the reflectance and transmission measuring apparatus, the illumination meter with a remote control transmitter, the diffuse reflectance measuring apparatus, and the daylight factor measuring apparatus were illustrated. 14 refs., 11 figs.

  20. Detection of vehicle crossing path at intersection; Mitoshi no yoi kosaten ni okeru deaigashira jiko ni tsuite (Ibarakiken ni okeru jiko tahatsu zone no tokucho)

    Energy Technology Data Exchange (ETDEWEB)

    Fujita, K; Uchida, N; Katayama, T [Japan Automobile Research Institute Inc., Tsukuba (Japan)

    1997-10-01

    An investigation was excuted to understand the actual state of accidents happened at intersections where there were no constructive obstacles in field of view. First, the aspects of fatal accidents are described under the basis of the data published by the police of Ibaraki prefecture. Then it is shown that there are at least 336 intersections where the accidents happened in the last two years. It is also clarified that many dangerous zones were located in line along rivers. The authors stress that it is urgent to inform the existence of dangerous zones to prevent the accidents. 2 refs., 5 figs.

  1. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  2. Exclusive study of Ni+Ni and Ni+Au central collisions: phase coexistence and spinodal decomposition; Etude exclusive des collisions centrales Ni+Ni et Ni+Au: coexistence de phase et decomposition spinodale

    Energy Technology Data Exchange (ETDEWEB)

    Guiot, B

    2002-12-01

    The INDRA multidetector allowed us to study the Ni+Ni collisions at 32A MeV and the Ni+Au collisions at 52,4 MeV. Central collisions leading to 'quasi-fused' systems were isolated using multidimensional analysis techniques: the Discriminant Analysis and the Principal Component Analysis. Comparison with a statistical model shows that the selected events are compatible with thermodynamical equilibrium. The average thermal excitation energy is 5A MeV for both systems. Calculations of heat capacities show that the deexcitation of the hot sources are akin to a liquid-gas phase transition of nuclear matter. Indeed heat capacities exhibit a negative branch as expected for a phase transition of a finite system. The dynamics of this phase transition has been investigated by applying the charge correlation method. An enhanced production of events with equal-sized fragments has been evidenced for Ni+Au at 52A MeV. No signal was found for Ni+Ni at 32A MeV. Finally this method was improved by taking into account the total charge conservation. The signal is seen more clearly for Ni+Au at 52A MeV, but is ambiguous for Ni+Ni at 32A MeV. The path followed in the state diagram, or the involved time scales, seem to be different for these systems. (authors)

  3. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    CERN Document Server

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  4. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Science.gov (United States)

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  5. Prevalence of swallowing and speech problems in daily life after chemoradiation for head and neck cancer based on cut-off scores of the patient-reported outcome measures SWAL-QOL and SHI.

    Science.gov (United States)

    Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René

    2016-07-01

    The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.

  6. Exclusive study of Ni+Ni and Ni+Au central collisions: phase coexistence and spinodal decomposition

    International Nuclear Information System (INIS)

    Guiot, B.

    2002-12-01

    The INDRA multidetector allowed us to study the Ni+Ni collisions at 32A MeV and the Ni+Au collisions at 52,4 MeV. Central collisions leading to 'quasi-fused' systems were isolated using multidimensional analysis techniques: the Discriminant Analysis and the Principal Component Analysis. Comparison with a statistical model shows that the selected events are compatible with thermodynamical equilibrium. The average thermal excitation energy is 5A MeV for both systems. Calculations of heat capacities show that the deexcitation of the hot sources are akin to a liquid-gas phase transition of nuclear matter. Indeed heat capacities exhibit a negative branch as expected for a phase transition of a finite system. The dynamics of this phase transition has been investigated by applying the charge correlation method. An enhanced production of events with equal-sized fragments has been evidenced for Ni+Au at 52A MeV. No signal was found for Ni+Ni at 32A MeV. Finally this method was improved by taking into account the total charge conservation. The signal is seen more clearly for Ni+Au at 52A MeV, but is ambiguous for Ni+Ni at 32A MeV. The path followed in the state diagram, or the involved time scales, seem to be different for these systems. (authors)

  7. Giant magnetoimpedance effect in sputtered single layered NiFe film and meander NiFe/Cu/NiFe film

    International Nuclear Information System (INIS)

    Chen, L.; Zhou, Y.; Lei, C.; Zhou, Z.M.; Ding, W.

    2010-01-01

    Giant magnetoimpedance (GMI) effect on NiFe thin film is very promising due to its application in developing the magnetic field sensors with highly sensitivity and low cost. In this paper, the single layered NiFe thin film and NiFe/Cu/NiFe thin film with a meander structure are prepared by the MEMS technology. The influences of sputtering parameters, film structure and conductor layer width on GMI effect in NiFe single layer and meander NiFe/Cu/NiFe film are investigated. Maximum of the GMI ratio in single layer and sandwich film is 5% and 64%, respectively. The results obtained are useful for developing the high-performance magnetic sensors based on NiFe thin film.

  8. Modification of PMMA/graphite nanocomposites through ion beam technique

    Science.gov (United States)

    Singhal, Prachi; Rattan, Sunita; Avasthi, Devesh Kumar; Tripathi, Ambuj

    2013-08-01

    Swift heavy ion (SHI) irradiation is a special technique for inducing physical and chemical modifications in bulk materials. In the present work, the SHI hs been used to prepare nanocomposites with homogeneously dispersed nanoparticles. The nanographite was synthesized from graphite using the intercalation-exfoliation method. PMMA Poly(methyl methacrylate)/graphite nanocomposites have been synthesized by in situ polymerization. The prepared PMMA/graphite nanocomposite films were irradiated with SHI irradiation (Ni ion beam, 80 MeV and C ion beam, 50 MeV) at a fluence of 1×1010 to 3×1012 ions/cm2. The nanocomposite films were characterized by scanning electron microscope (SEM) and were evaluated for their electrical and sensor properties. After irradiation, significant changes in surface morphology of nanocomposites were observed as evident from the SEM images, which show the presence of well-distributed nanographite platelets. The irradiated nanocomposites exhibit better electrical and sensor properties for the detection of nitroaromatics with marked improvement in sensitivity as compared with unirradiated nanocomposites.

  9. Morphological control of Ni/NiO core/shell nanoparticles and production of hollow NiO nanostructures

    International Nuclear Information System (INIS)

    Chopra, Nitin; Claypoole, Leslie; Bachas, Leonidas G.

    2010-01-01

    Chemical synthesis coupled with a microwave irradiation process allowed for the control of size (6-40 nm), shape, and shell thickness of Ni/NiO core/shell nanoparticles. In this unique synthetic route, the size of Ni nanoparticles (NiNPs) was strongly influenced by the nickel salt-to-stabilizer ratio and the amount of the stabilizer. Interestingly, it was observed that the shape of the nanoparticles was altered by varying the reaction time, where longer reaction times resulted in annealing effects and rupture of the stabilizer micelle leading to distinct shapes of Ni/NiO core/shell nanostructures. Product cooling rate was another important parameter identified in this study that not only affected the shape, but also the crystal structure of the core/shell nanoparticles. In addition, a simple and cost-effective method of microwave irradiation of NiNPs led to the formation of distinctly shaped hollow NiO nanoparticles. These high surface area core/shell nanoparticles with well-controlled morphologies are important and can lead to significant advancement in the design of improved fuel cells, electrochromic display devices, and catalysis systems.

  10. Morphological control of Ni/NiO core/shell nanoparticles and production of hollow NiO nanostructures

    Energy Technology Data Exchange (ETDEWEB)

    Chopra, Nitin [University of Alabama, Department of Metallurgical and Materials Engineering, Center for Materials for Information Technology (MINT) (United States); Claypoole, Leslie [Fairmont State University (United States); Bachas, Leonidas G., E-mail: bachas@uky.ed [University of Kentucky, Department of Chemistry (United States)

    2010-10-15

    Chemical synthesis coupled with a microwave irradiation process allowed for the control of size (6-40 nm), shape, and shell thickness of Ni/NiO core/shell nanoparticles. In this unique synthetic route, the size of Ni nanoparticles (NiNPs) was strongly influenced by the nickel salt-to-stabilizer ratio and the amount of the stabilizer. Interestingly, it was observed that the shape of the nanoparticles was altered by varying the reaction time, where longer reaction times resulted in annealing effects and rupture of the stabilizer micelle leading to distinct shapes of Ni/NiO core/shell nanostructures. Product cooling rate was another important parameter identified in this study that not only affected the shape, but also the crystal structure of the core/shell nanoparticles. In addition, a simple and cost-effective method of microwave irradiation of NiNPs led to the formation of distinctly shaped hollow NiO nanoparticles. These high surface area core/shell nanoparticles with well-controlled morphologies are important and can lead to significant advancement in the design of improved fuel cells, electrochromic display devices, and catalysis systems.

  11. Synthesis of Ni3Ta, Ni2Ta and NiTa by high-energy ball milling and subsequent heat treatment

    International Nuclear Information System (INIS)

    Benites, H.S.N.; Silva, B.P da; Ramos, A.S.; Silva, A.A.A.P.; Coelho, G.C.; Lima, B.B. de

    2014-01-01

    The tantalum has relevance for the development of multicomponent Ni-based superalloys which are hardened by solid solution and precipitation mechanisms. Master alloys are normally used in the production step in order to produce refractory metals and alloys. The present work reports on the synthesis of Ni_3Ta, Ni_2Ta and NiTa by high-energy ball milling and subsequent heat treatment. The elemental Ni-25Ta, Ni-33Ta and Ni-50Ta (at.-%) powder mixtures were ball milled under Ar atmosphere using stainless steel balls and vials, 300 rpm and a ball-to-powder weight ratio of 10:1. Following, the as-milled samples were uniaxially compacted and heat-treated at 1100 deg C for 4h under Ar atmosphere. The characterization of as-milled and heat-treated samples was conducted by means of X-ray diffraction, scanning electron microscopy, and energy dispersive spectrometry. A large amount of Ni_3Ta, Ni_2Ta and NiTa was formed in the mechanically alloyed heat-treated Ni-25Ta, Ni-33Ta and Ni-50Ta alloys. (author)

  12. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    CERN Document Server

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  13. On the nature of Ni···Ni interaction in a model dimeric Ni complex.

    Science.gov (United States)

    Kamiński, Radosław; Herbaczyńska, Beata; Srebro, Monika; Pietrzykowski, Antoni; Michalak, Artur; Jerzykiewicz, Lucjan B; Woźniak, Krzysztof

    2011-06-07

    A new dinuclear complex (NiC(5)H(4)SiMe(2)CHCH(2))(2) (2) was prepared by reacting nickelocene derivative [(C(5)H(4)SiMe(2)CH=CH(2))(2)Ni] (1) with methyllithium (MeLi). Good quality crystals were subjected to a high-resolution X-ray measurement. Subsequent multipole refinement yielded accurate description of electron density distribution. Detailed inspection of experimental electron density in Ni···Ni contact revealed that the nickel atoms are bonded and significant deformation of the metal valence shell is related to different populations of the d-orbitals. The existence of the Ni···Ni bond path explains the lack of unpaired electrons in the complex due to a possible exchange channel.

  14. Gd-Ni-Si system

    International Nuclear Information System (INIS)

    Bodak, O.I.; Shvets, A.F.

    1983-01-01

    By X-ray phase analysis method isothermal cross section of phase diagram of the Gd-Ni-Si system at 870 K is studied. The existence of nine previously known compounds (GdNisub(6.72)Sisub(6.28), GdNi 10 Si 2 , GdNi 5 Si 3 , GdNi 4 Si, GdNi 2 Si 2 , GdNiSi 3 , GdNiSi 2 , Gd 3 Ni 6 Si 2 and GdNiSi) is confirmed and three new compounds (GdNisub(0.2)Sisub(1.8), Gdsub(2)Nisub(1-0.8)Sisub(1-1.2), Gd 5 NiSi 4 ) are found. On the base of Gd 2 Si 3 compound up to 0.15 at. Ni fractions, an interstitial solid solution is formed up to 0.25 at Ni fractions dissolution continues of substitution type. The Gd-Ni-Si system is similar to the Y-Ni-Si system

  15. Improvement of the detection limits in radio-frequency-powered glow discharge optical emission spectrometry associated with bias-current conduction method; Jiko bias denryu donyuho ni yoru koshuha glow hoden hakko bunseki ni okeru kenshutsu genkai no kaizen

    Energy Technology Data Exchange (ETDEWEB)

    Wagatsuma, K. [Tohoku University, Sendai (Japan). Research Institute for Materials

    1999-01-01

    A d.c. bias current driven by the self-bias voltage which is conducted through the r.f.-powered glow discharge plasma varies the emission characteristics drastically, leading to improvement of the detection power in the optical emission spectrometry. By conducting the bias currents of 20-30 mA, the emission intensities of the atomic resonance lines were 10-20 times larger than those obtained with conventional r.t.- powered plasmas. The detection limits for determination of alloyed elements in the re-based binary alloy samples were estimated to be l.6 x 10{sup -3}% Cr for CrI 425.43nm, 7 x 10{sup -4}% Mn for MnI 403.10nm, 1.9>10{sup -3}% Cu for CuI 327.40nm, 1.1 x 10{sup -3}% Al for AlI 396.16nm, and 6.6 x 10{sup -3}% Ni for NiI 352.45 nm. (author)

  16. Electronic structure of Ni/sub 3/Al and Ni/sub 3/Ga alloys

    CERN Document Server

    Pong, W F; Chang, Y K; Tsai, M H; Hsieh, H H; Pieh, J Y; Tseng, P K; Lee, J F; Hsu, L S

    1999-01-01

    This work investigates the charge transfer and Al(Ga) p-Ni d hybridization effects in the intermetallic Ni/sub 3/Al(Ni/sub 3/Ga) alloy using the NiL/sub 3.2/- and K-edge and Al(Ga)K X-ray absorption near edge structure (XANES) measurements. We find that the intensity of white-line features at the NiL/sub 3.2/-edge in the Ni/sub 3/Al(Ni /sub 3/Ga) alloy decreased in comparison with that of pure Ni, which can be attributed to the enhancement of Ni3d states filling and the depletion of the density of Ni 3d unoccupied states in the Ni/sub 3 /Al(Ni/sub 3/Ga) alloy. Two clear features are also observed in the Ni/sub 3/Al(Ni/sub 3/Ga) XANES spectrum at the Al(Ga) K-edge, which can be assigned to the Al(Ga) unoccupied 3p (4p) states and their hybridized states with the Ni 3d/4sp states above the Fermi level in Ni/sub 3/Al(Ni/sub 3/Ga). The threshold at Al K-edge XANES for Ni/sub 3/Al clearly shifts towards higher photon energies relative to that of pure Al, indicating that Al loses charges upon forming Ni/sub 3 /Al. ...

  17. Ni-NiO core-shell inverse opal electrodes for supercapacitors.

    Science.gov (United States)

    Kim, Jae-Hun; Kang, Soon Hyung; Zhu, Kai; Kim, Jin Young; Neale, Nathan R; Frank, Arthur J

    2011-05-14

    A general template-assisted electrochemical approach was used to synthesize three-dimensional ordered Ni core-NiO shell inverse opals (IOs) as electrodes for supercapacitors. The Ni-NiO IO electrodes displayed pseudo-capacitor behavior, good rate capability and cycling performance. © The Royal Society of Chemistry 2011

  18. An Ultrastable and High-Performance Flexible Fiber-Shaped Ni-Zn Battery based on a Ni-NiO Heterostructured Nanosheet Cathode.

    Science.gov (United States)

    Zeng, Yinxiang; Meng, Yue; Lai, Zhengzhe; Zhang, Xiyue; Yu, Minghao; Fang, Pingping; Wu, Mingmei; Tong, Yexiang; Lu, Xihong

    2017-11-01

    Currently, the main bottleneck for the widespread application of Ni-Zn batteries is their poor cycling stability as a result of the irreversibility of the Ni-based cathode and dendrite formation of the Zn anode during the charging-discharging processes. Herein, a highly rechargeable, flexible, fiber-shaped Ni-Zn battery with impressive electrochemical performance is rationally demonstrated by employing Ni-NiO heterostructured nanosheets as the cathode. Benefiting from the improved conductivity and enhanced electroactivity of the Ni-NiO heterojunction nanosheet cathode, the as-fabricated fiber-shaped Ni-NiO//Zn battery displays high capacity and admirable rate capability. More importantly, this Ni-NiO//Zn battery shows unprecedented cyclic durability both in aqueous (96.6% capacity retention after 10 000 cycles) and polymer (almost no capacity attenuation after 10 000 cycles at 22.2 A g -1 ) electrolytes. Moreover, a peak energy density of 6.6 µWh cm -2 , together with a remarkable power density of 20.2 mW cm -2 , is achieved by the flexible quasi-solid-state fiber-shaped Ni-NiO//Zn battery, outperforming most reported fiber-shaped energy-storage devices. Such a novel concept of a fiber-shaped Ni-Zn battery with impressive stability will greatly enrich the flexible energy-storage technologies for future portable/wearable electronic applications. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Science.gov (United States)

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  20. Thermal stability and electrical characteristics of NiSi films with electroplated Ni(W) alloy

    International Nuclear Information System (INIS)

    Xin Yuhang; Hu Anmin; Li Ming; Mao Dali

    2011-01-01

    In this study, an electroplating method to deposited Ni, crystalline NiW(c-NiW), amorphous NiW (a-NiW) films on P-type Si(1 0 0) were used to form Ni-silicide (NiSi) films. After annealed at various temperatures, sheet resistance of Ni/Cu, c-NiW/Cu and a-NiW/Cu was measured to observe the performance of those diffusion barrier layers. With W added in the barrier layer, the barrier performance was improved. The results of XRD and resistance measurement of the stacked Si/Ni(W)/Cu films reveal that Cu atom could diffuse through Ni barrier layer at 450 deg. C, could diffuse through c-NiW at 550 deg. C, but could hardly diffuse through a-NiW barrier layer. c-NiW layer has a better barrier performance than Ni layer, meanwhile the resistance is lower than a-NiW layer.

  1. First-principles calculations for the elastic properties of Ni-base model superalloys: Ni/Ni3Al multilayers

    International Nuclear Information System (INIS)

    Yun-Jiang, Wang; Chong-Yu, Wang

    2009-01-01

    A model system consisting of Ni[001](100)/Ni 3 Al[001](100) multi-layers are studied using the density functional theory in order to explore the elastic properties of single crystal Ni-based superalloys. Simulation results are consistent with the experimental observation that rafted Ni-base superalloys virtually possess a cubic symmetry. The convergence of the elastic properties with respect to the thickness of the multilayers are tested by a series of multilayers from 2γ'+2γ to 10γ'+10γ atomic layers. The elastic properties are found to vary little with the increase of the multilayer's thickness. A Ni/Ni 3 Al multilayer with 10γ'+10γ atomic layers (3.54 nm) can be used to simulate the mechanical properties of Ni-base model superalloys. Our calculated elastic constants, bulk modulus, orientation-dependent shear modulus and Young's modulus, as well as the Zener anisotropy factor are all compatible with the measured results of Ni-base model superalloys R1 and the advanced commercial superalloys TMS-26, CMSX-4 at a low temperature. The mechanical properties as a function of the γ' phase volume fraction are calculated by varying the proportion of the γ and γ' phase in the multilayers. Besides, the mechanical properties of two-phase Ni/Ni 3 Al multilayer can be well predicted by the Voigt–Reuss–Hill rule of mixtures. (classical areas of phenomenology)

  2. Influence of ni thickness on oscillation coupling in Cu/Ni multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Gagorowska, B; Dus-Sitek, M [Institute of Physics, Czestochowa University of Technology, Al. Armii Krajowej 19, 42-200 Czestochowa (Poland)

    2007-08-15

    The results of investigation of magnetic properties of [Cu/Ni]x100 were presented. Samples were deposited by face-to-face sputtering method onto the silicon substrate, the thickness of Cu layer was constant (d{sub Cu} = 2 nm) and the thickness of Ni layer - variable (1 nm {<=} d{sub Ni} {<=} 6 nm). In Cu/Ni multilayers, for the thickness of Ni layer bigger than 2 nm antiferromagnetic coupling (A-F) were observed, for the thickness of Ni smaller than 2 nm A-F coupling is absent.

  3. Influence of ni thickness on oscillation coupling in Cu/Ni multilayers

    International Nuclear Information System (INIS)

    Gagorowska, B; Dus-Sitek, M

    2007-01-01

    The results of investigation of magnetic properties of [Cu/Ni]x100 were presented. Samples were deposited by face-to-face sputtering method onto the silicon substrate, the thickness of Cu layer was constant (d Cu = 2 nm) and the thickness of Ni layer - variable (1 nm ≤ d Ni ≤ 6 nm). In Cu/Ni multilayers, for the thickness of Ni layer bigger than 2 nm antiferromagnetic coupling (A-F) were observed, for the thickness of Ni smaller than 2 nm A-F coupling is absent

  4. Gravitational observation in central Hokkaido; Hokkaido chuobu ni okeru juryoku sokutei ni tsuite

    Energy Technology Data Exchange (ETDEWEB)

    Murata, Y; Makino, M [Geological Survey of Japan, Tsukuba (Japan)

    1997-10-22

    To compile a base map of gravity in Hokkaido, gravity was measured in central Hokkaido where gravity data are absent. Gravity anomaly was made clear in this region. Survey area was 87 km in the east-west and 224 km in the north-south. A topographic map with a scale of 25,000:1 was initially used for determining location and altitude of gravity measuring points. Since the GPS survey was found to be very useful for gravitational observation in the region of Hyogo-ken Nanbu Earthquake in 1995, the GPS has been used in this survey from 1996. Based on new measurements at 2,148 points in addition to existing points, Bouguer anomaly map was made, and density distribution of surface layer of the crust was estimated. As a result, the gravity anomaly pattern in the north-south direction and gravity anomaly in basins and volcanoes were made clear. Quantitative analysis is to be conducted using these gravity data. Using these gravity data, the density distribution of surface layer of the crust was estimated. This distribution agreed well with the geological map in this region. 4 refs., 6 figs.

  5. Study of dipole interaction in micron-width NiFe/Cu/NiFe/NiO wire using exchange anisotropy

    International Nuclear Information System (INIS)

    Kimura, Takashi; Itagaki, Yoshio; Wakaya, Fujio; Gamo, Kenji

    2001-01-01

    The dipole interaction between a NiFe layer pinned by a NiO and a free NiFe layer in a micron-wide NiFe/Cu/NiFe/NiO wire was studied by changing the direction of the exchange bias from the NiO layer. The effect of the dipole interaction when the exchange bias was perpendicular to the wire axis was larger than that when the exchange bias was parallel to the wire axis, and was consistently explained by the stray field caused by the magnetic charges of the pinned layer. It was demonstrated that this method, using exchange anisotropy, is useful for investigating the dipole interaction between ferromagnetic materials separated by a nonmagnetic material in small-scale magnetic multilayers. [copyright] 2001 American Institute of Physics

  6. Atomistic calculations of hydrogen interactions with Ni3Al grain boundaries and Ni/Ni3Al interfaces

    International Nuclear Information System (INIS)

    Baskes, M.I.; Angelo, J.E.; Moody, N.R.

    1995-01-01

    Embedded Atom Method (EAM) potentials have been developed for the Ni/Al/H system. The potentials have been fit to numerous properties of this system. For example, these potentials represent the structural and elastic properties of bulk Ni, Al, Ni 3 Al, and NiAl quite well. In addition the potentials describe the solution and migration behavior of hydrogen in both nickel and aluminum. A number of calculations using these potentials have been performed. It is found that hydrogen strongly prefers sites in Ni 3 Al that are surrounded by 6 Ni atoms. Calculations of the trapping of hydrogen to a number of grain boundaries in Ni 3 Al have been performed as a function of hydrogen chemical potential at room temperature. The failure of these bicrystals under tensile stress has been examined and will be compared to the failure of pure Ni 3 Al boundaries. Boundaries containing a preponderance of nickel are severely weakened by hydrogen. In order to investigate the potential embrittlement of γ/γ' alloys, trapping of hydrogen to a spherical Ni 3 Al precipate in nickel as a function of chemical potential at room temperature has been calculated. It appears that the boundary is not a strong trap for hydrogen, hence embrittlement in these alloys is not primarily due to interactions of hydrogen with the γ/γ interface

  7. Effects of Ni vacancy, Ni antisite, Cr and Pt on the third-order elastic constants and mechanical properties of NiAl

    KAUST Repository

    Wu, Shaohua; Wu, Xiaozhi; Wang, Rui; Liu, Qing; Gan, Liyong

    2014-01-01

    Effects of Ni vacancy, Ni antisite in Al sublattice, Cr in Al sublattice, Pt in Ni sublattice on the second-order elastic constants (SOECs) and third-order elastic constants (TOECs) of the B2 NiAl have been investigated using the first-principles methods. Lattice constant and the SOECs of NiAl are in good agreement with the previous results. The brittle/ductile transition map based on Pugh ratio G/B and Cauchy pressure Pc shows that Ni antisite, Cr, Pt and pressure can improve the ductility of NiAl, respectively. Ni vacancy and lower pressure can enhance the Vickers hardness Hv of NiAl. The density of states (DOS) and the charge density difference are also used to analysis the effects of vacancy, Ni antisite, Cr and Pt on the mechanical properties of NiAl, and the results are in consistent with the transition map. © 2014 Elsevier Ltd. All rights reserved.

  8. Effects of Ni vacancy, Ni antisite, Cr and Pt on the third-order elastic constants and mechanical properties of NiAl

    KAUST Repository

    Wu, Shaohua

    2014-12-01

    Effects of Ni vacancy, Ni antisite in Al sublattice, Cr in Al sublattice, Pt in Ni sublattice on the second-order elastic constants (SOECs) and third-order elastic constants (TOECs) of the B2 NiAl have been investigated using the first-principles methods. Lattice constant and the SOECs of NiAl are in good agreement with the previous results. The brittle/ductile transition map based on Pugh ratio G/B and Cauchy pressure Pc shows that Ni antisite, Cr, Pt and pressure can improve the ductility of NiAl, respectively. Ni vacancy and lower pressure can enhance the Vickers hardness Hv of NiAl. The density of states (DOS) and the charge density difference are also used to analysis the effects of vacancy, Ni antisite, Cr and Pt on the mechanical properties of NiAl, and the results are in consistent with the transition map. © 2014 Elsevier Ltd. All rights reserved.

  9. Ni Foam-Ni3 S2 @Ni(OH)2 -Graphene Sandwich Structure Electrode Materials: Facile Synthesis and High Supercapacitor Performance.

    Science.gov (United States)

    Wang, Xiaobing; Hu, Jiangjiang; Su, Yichang; Hao, Jin; Liu, Fanggang; Han, Shuang; An, Jian; Lian, Jianshe

    2017-03-23

    A novel Ni foam-Ni 3 S 2 @Ni(OH) 2 -graphene sandwich-structured electrode (NF-NN-G) with high areal mass loading (8.33 mg cm -2 ) has been developed by sulfidation and hydrolysis reactions. The conductivity of Ni 3 S 2 and Ni(OH) 2 were both improved. The upper layer of Ni(OH) 2 , covered with a thin graphene film, is formed in situ from the surface of the lower layer of Ni 3 S 2 , whereas the Ni 3 S 2 grown on Ni foam substrate mainly acts as a rough support bridging the Ni(OH) 2 and Ni foam. The graphene stabilized the Ni(OH) 2 and the electrochemical properties were effectively enhanced. The as-synthesized NF-NN-G-5mg electrode shows a high specific capacitance (2258 F g -1 at 1 A g -1 or 18.81 F cm -2 at 8.33 mA cm -2 ) and an outstanding rate property (1010 F g -1 at 20 Ag -1 or 8.413 F cm -2 at 166.6 mA cm -2 ). This result is around double the capacitance achieved in previous research on Ni 3 S 2 @Ni(OH) 2 /3DGN composites (3DGN=three-dimensional graphene network). In addition, the as-fabricated NF-NN-G-5mg composite electrode has an excellent cycle life with no capacitance loss after 3000 cycles, indicating a potential application as an efficient electrode. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Relation between shape of Ni-particles and Ni migration in Ni-YSZ electrodes – a hypothesis

    DEFF Research Database (Denmark)

    Mogensen, Mogens Bjerg; Hauch, Anne; Sun, Xiufu

    2016-01-01

    This is an attempt to explain a phenomenon of total depletion of Ni next to the electrolyte in Ni-YSZ cermet electrodes in solid oxide electrolysis cells during electrolysis at high current density/overpotential. Intuitively, we would think that Ni would always migrate down the steam partial...

  11. Magnetoresistance of nanogranular Ni/NiO controlled by exchange anisotropy

    International Nuclear Information System (INIS)

    Del Bianco, L.; Spizzo, F.; Tamisari, M.; Allia, P.

    2013-01-01

    A link between exchange anisotropy and magnetoresistance has been found to occur in a Ni/NiO sample consisting of Ni nanocrystallites (mean size ∼13 nm, Ni content ∼33 vol%) dispersed in a NiO matrix. This material shows metallic-type electric conduction and isotropic spin-dependent magnetoresistance as well as exchange bias effect. The latter is the outcome of an exchange anisotropy arising from the contact interaction between the Ni phase and the NiO matrix. Combined analysis of magnetization M(H) and magnetoresistance MR(H) loops measured in the 5–250 K temperature range after zero-field-cooling (ZFC) and after field-cooling (FC) from 300 K reveals that the magnetoresistance is influenced by exchange anisotropy, which is triggered by the FC process and can be modified in strength by varying the temperature. Compared to the ZFC case, the exchange anisotropy produces a horizontal shift of the FC MR(H) loop along with a reduction of the MR response associated to the reorientation of the Ni moments. A strict connection between magnetoresistance and remanent magnetization of FC loops on one side and the exchange field on the other, ruled by exchange anisotropy, is indicated. - Highlights: • Nanogranular Ni/NiO with giant magnetoresistance (MR) and exchange bias effect. • Exchange anisotropy produces a shift of the field-cooled MR(H) loop and reduces MR. • MR, remanence of field-cooled loops and exchange field are three correlated quantities. • It is possible to control MR of nanogranular systems through the exchange anisotropy

  12. Niños y niñas como cuidadores familiares

    OpenAIRE

    María Rosa Estupiñán Aponte

    2015-01-01

    En el contexto familiar, el cuidado de otra persona por parte de niños y niñas constituye un terreno inexplorado tanto en su significado como en las implicaciones que podrían darse en el proceso. Aunque históricamente se ha asignado el cuidado familiar a las mujeres generando condiciones de inequidad, incrementada con los cambios sociales de los últimos tiempos, es necesario reconocer que en muchos hogares niños y niñas se han visto obligados a desempeñar esta labor sin la preparación ni las ...

  13. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Directory of Open Access Journals (Sweden)

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  14. Nanoscale structural heterogeneity in Ni-rich half-Heusler TiNiSn

    International Nuclear Information System (INIS)

    Douglas, Jason E.; Pollock, Tresa M.; Chater, Philip A.; Brown, Craig M.; Seshadri, Ram

    2014-01-01

    The structural implications of excess Ni in the TiNiSn half-Heusler compound are examined through a combination of synchrotron x-ray and neutron scattering studies, in conjunction with first principles density functional theory calculations on supercells. Despite the phase diagram suggesting that TiNiSn is a line compound with no solid solution, for small x in TiNi 1+x Sn there is indeed an appearance—from careful analysis of the scattering—of some solubility, with the excess Ni occupying the interstitial tetrahedral site in the half-Heusler structure. The analysis performed here would point to the excess Ni not being statistically distributed, but rather occurring as coherent nanoclusters. First principles calculations of energetics, carried out using supercells, support a scenario of Ni interstitials clustering, rather than a statistical distribution.

  15. Synthesis and electrochemical behavior of nanostructured cauliflower-shape Co-Ni/Co-Ni oxides composites

    International Nuclear Information System (INIS)

    Gupta, Vinay; Kawaguchi, Toshikazu; Miura, Norio

    2009-01-01

    Nanostructured Co-Ni/Co-Ni oxides were electrochemically deposited onto stainless steel electrode by electrochemical method and characterized for their structural and supercapacitive properties. The SEM images indicated that the obtained Co-Ni/Co-Ni oxides had cauliflower-type nanostructure. The X-ray diffraction pattern showed the formation of Co 3 O 4 , NiO, Co and Ni. The EDX elemental mapping images indicated that Ni, Co and O are distributed uniformly. The deposited Co-Ni/Co-Ni oxides showed good supercapacitive characteristics with a specific capacitance of 331 F/g at 1 mA/cm 2 current density in 1 M KOH electrolyte. A mechanism of the formation of cauliflower-shape Co-Ni/Co-Ni oxides was proposed. A variety of promising applications in the fields such as energy storage devices and sensors can be envisioned from Co-Ni/Co-Ni oxides

  16. Interfacial reaction of Ni{sub 3}Sn{sub 4} intermetallic compound in Ni/SnAg solder/Ni system under thermomigration

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Yi-Shan; Yang, Chia-Jung; Ouyang, Fan-Yi, E-mail: fyouyang@ess.nthu.edu.tw

    2016-07-25

    The growth of Ni{sub 3}Sn{sub 4} intermetallic compound (IMC) between liquid–solid interface in micro-scale Ni/SnAg/Ni system was investigated under a temperature gradient of 160 °C/cm at 260 °C on a hot plate. In contrast to a symmetrical growth of Ni{sub 3}Sn{sub 4} on both interfaces under isothermally annealed at 260 °C, the interfacial Ni{sub 3}Sn{sub 4} IMC exhibited asymmetric growth under a temperature gradient; the growth of Ni{sub 3}Sn{sub 4} at cold interface was faster than that at hot side because of temperature gradient induced mass migration of Ni atoms from the hot end toward the cold end. It was found that two-stage growth behavior of Ni{sub 3}Sn{sub 4} IMC under a temperature gradient. A growth model was established and growth kinetic analysis suggested that the chemical potential gradient controlled the growth of Ni{sub 3}Sn{sub 4} at stage I (0–120 min) whereas the dynamic equilibrium between chemical potential gradient and temperature gradient forces was attained at the hot end at stage II (120–210 min). When dynamic equilibrium was achieved at 260 °C, the critical length-temperature gradient product at the hot end was experimentally estimated to be 489.18 μm × °C/cm and the moving velocity of Ni{sub 3}Sn{sub 4} interface due to Ni consumption was calculated to be 0.134 μm/h. The molar heat of transport (Q*) of Ni atoms in molten SnAg solder was calculated to be +0.76 kJ/mol. - Highlights: • Interfacial reaction in Ni/SnAg solder/Ni system under thermal gradient. • Growth rate of Ni{sub 3}Sn{sub 4} at cold end is faster than that at hot end. • Critical length-temperature gradient product at hot end is 489.2 μm°C/cm at 260 °C. • Velocity of Ni{sub 3}Sn{sub 4} moving interface is 0.134 μm/h during dynamic equilibrium. • Molar heat of transport (Q*) of Ni in molten SnAg was +0.76 kJ/mol.

  17. Formation enthalpy of NiBe and Ni5Be21

    International Nuclear Information System (INIS)

    Ivanov, M.I.; Karpova, T.F.; Dalago, N.Yu.

    1981-01-01

    The method of dissolution calorimetry is used to determine standard enthalpies of NiBe and Ni 5 Be 21 formation, which are 84.8+-2.2 and (-669+-37)kJ/mol. The enthalpy values of NiBe and Ni 5 Be 21 at 331 K are shown to coincide (within the limits of errors of these values) with the values at the standard temperature of 298.15 K [ru

  18. Effects of solvent and catalysts on the hydrogenolysis of alkylnaphthalenes; Alkylnaphthalene no suisoka bunkai ni okeru yobai to shokubai no koka

    Energy Technology Data Exchange (ETDEWEB)

    Futamura, S. [National Institute for Resources and Environment, Tsukuba (Japan)

    1996-10-28

    Catalytic effects of metal and carbon materials, which promote hydrogen transfer from hydrogen donor solvents, are investigated during hydrogenolysis of benzyl-1-methylnaphthalenes (BMN) selected as a hydrogen acceptor. For the isomer distribution of BMN after the reaction, almost the same molecular ratio before the reaction was obtained independent of the presence of catalysts. Selectivity of position during the addition of hydrogen atoms from tetralin was not found. For the reaction of BMN in tetralin, 1-methylnaphthalene and toluene were obtained as products, but the formation of benzylnaphthalene was not found. As for the nuclear hydride of BMN, the trace amount formation was confirmed by gas chromatography. For the hydrogen transfer from tetralin progressed catalytically, it was found that the nuclear of naphthalene can not be hydrogenated easily. This was considered to be due to the obstruction of hydrogen transfer from tetralin by the strong adsorption of BMN on the Ni surface. 1 ref., 1 fig., 2 tabs.

  19. Ni4Ti3 precipitate structures in Ni-rich NiTi shape memory alloys

    International Nuclear Information System (INIS)

    Holec, D.; Bojda, O.; Dlouhy, A.

    2008-01-01

    Non-uniform distributions of Ni 4 Ti 3 precipitate crystallographic variants are investigated in a Ni-rich NiTi shape memory alloy after aging, assisted by external stress. A finite-element method model is presented that considers the elastic anisotropy of the B2 parent phase and also mutual misorientations of grains in a polycrystalline sample. On loading by the external stress, the stress is redistributed in the microstructure and the precipitation of some Ni 4 Ti 3 crystallographic variants becomes distinctly favorable in grain boundary regions since these variant configurations minimize the elastic interaction energy. The volume fraction of the affected grain boundary regions is calculated and the numerical results are compared with the data obtained by differential scanning calorimetry and transmission electron microscopy

  20. Fiscal 1998 survey report. Assessment and analysis of collected data in wind power generation field test project; 1998 nendo furyoku hatsuden field test jigyo ni okeru shushu data hyoka kaiseki chosa hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Examination was made on wind conditions, power generating characteristics, and the reliability of a system by analyzing the operation record of the wind power generation equipment which was installed at Hiraizumi-cho, Nishi-Iwai gun, Iwate prefecture and at Misaki-cho, Miura-shi, Kanagawa prefecture. The equipment at Hiraizumi had a rated output of 490 kW, and at Miura 400 kW. The period of the examination was from April, 1998 through February, 1999, the items for data collection being the generator output, generated energy, average wind velocity, record of abnormality occurrence, and maximum wind velocity. At Hiraizumi, annual average utilization rate was 12.9%; annual average operation rate, 49.9%; average wind velocity, 4.6 m/s; and maximum wind velocity of the period, 31 m/s. At Miura, annual average utilization rate was 16.5%; annual average operation rate, 77.0%; and average wind velocity, 5.0 m/s. The utilization rate is desirably 17%. The top three abnormalities were drop in AC control voltage, actuation of main shaft brake and eddy current/actuation of open phase relay, accounting for 83.3% of the total abnormalities at Hiraizumi, while they were unbalance in current, grid drop and automatic unwinding of cable, accounting for 74.5% at Miura. (NEDO)

  1. Core/shell AgNi/PtAgNi nanoparticles as methanol-tolerant oxygen reduction electrocatalysts

    International Nuclear Information System (INIS)

    Wu, Dengfeng; Cheng, Daojian

    2015-01-01

    A core/shell AgNi/PtAgNi nanoparticle (NP) was synthesized via a new seed-mediated growth method in organic solvent medium. The as-synthesized AgNi/PtAgNiNP exhibits an AgNi core coated with PtAgNi shell, which was confirmed by transmission electron microscopy (TEM), ultraviolet–visible absorption spectroscopy and X-ray Photoelectron Spectroscopy (XPS). The AgNi/PtAgNiNPs/C catalyst possesses higher oxygen reduction reaction (ORR) activity and better durability compared with the commercial Pt/C catalyst. It is found that the ORR polarization curve of the AgNi/PtAgNiNPs/C catalyst shows an onset potential of 0.91 V vs. RHE, which is superior to the commercial Pt/C (0.88 V vs. RHE). In addition, the AgNi/PtAgNiNPs/C catalyst shows much better durability than the commercial Pt/C catalyst. More interestingly, the AgNi/PtAgNiNPs/C catalyst displays much higher methanol tolerance than the commercial Pt/C catalyst in 0.1 M KOH solution in the presence of 0.5 M methanol. Our results show that core/shell AgNi/PtAgNiNPs possess selective activity for ORR even in the presence of methanol, showing potential application as methanol-tolerant cathode catalysts in direct methanol fuel cells.

  2. Effects of Ni particle morphology on cell performance of Na/NiCl2 battery

    Science.gov (United States)

    Kim, Mangi; Ahn, Cheol-Woo; Hahn, Byung-Dong; Jung, Keeyoung; Park, Yoon-Cheol; Cho, Nam-ung; Lee, Heesoo; Choi, Joon-Hwan

    2017-11-01

    Electrochemical reaction of Ni particle, one of active cathode materials in the Na/NiCl2 battery, occurs on the particle surface. The NiCl2 layer formed on the Ni particle surface during charging can disconnect the electron conduction path through Ni particles because the NiCl2 layer has very low conductivity. The morphology and size of Ni particles, therefore, need to be controlled to obtain high charge capacity and excellent cyclic retention. Effects of the Ni particle size on the cell performance were investigated using spherical Ni particles with diameters of 0.5 μm, 6 μm, and 50 μm. The charge capacities of the cells with spherical Ni particles increased when the Ni particle size becomes smaller because of their higher surface area but their charge capacities were significantly decreased with increasing cyclic tests owing to the disconnection of electron conduction path. The inferior cyclic retention of charge capacity was improved using reticular Ni particles which maintained the reliable connection for the electron conduction in the Na/NiCl2 battery. The charge capacity of the cell with the reticular Ni particles was higher than the cell with the small-sized spherical Ni particles approximately by 26% at 30th cycle.

  3. One dimensional motion of interstitial clusters and void growth in Ni and Ni alloys

    Science.gov (United States)

    Yoshiie, T.; Ishizaki, T.; Xu, Q.; Satoh, Y.; Kiritani, M.

    2002-12-01

    One dimensional (1-D) motion of interstitial clusters is important for the microstructural evolution in metals. In this paper, the effect of 2 at.% alloying with elements Si (volume size factor to Ni: -5.81%), Cu (7.18%), Ge (14.76%) and Sn (74.08%) in Ni on 1-D motion of interstitial clusters and void growth was studied. In neutron irradiated pure Ni, Ni-Cu and Ni-Ge, well developed dislocation networks and voids in the matrix, and no defects near grain boundaries were observed at 573 K to a dose of 0.4 dpa by transmission electron microscopy. No voids were formed and only interstitial type dislocation loops were observed near grain boundaries in Ni-Si and Ni-Sn. The reaction kinetics analysis which included the point defect flow into planar sink revealed the existence of 1-D motion of interstitial clusters in Ni, Ni-Cu and Ni-Ge, and lack of such motion in Ni-Si and Ni-Sn. In Ni-Sn and Ni-Si, the alloying elements will trap interstitial clusters and thereby reduce the cluster mobility, which lead to the reduction in void growth.

  4. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Directory of Open Access Journals (Sweden)

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  5. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Science.gov (United States)

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  6. Study of the central collisions in the reactions Ni + Al and Ni + Ni at 28 A.MeV; Etude des collisions centrales dans les reactions Ni + Al et Ni + Ni a 28 A.MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lebreton, L.

    1995-12-01

    The work is in characterisation of mechanisms in the energy range of onset of multifragmentation (excitation energy of composed nucleus around 4 - 5 AMeV). This work focused on an experiment performed at the SARA facility, in Grenoble, using the AMPHORA multi detection array. I have been particularly interested in central collisions in the Ni + Al and Ni + Ni systems. The possibility to detect complete events for Ni + Al, and quasi-complete events for the Ni + Ni case, is the reason of this choice. Furthermore Ni + Ni presents the interest of a symmetrical system, for which the excitation energy per nucleon is maximum. The study of these reactions has been focused on the quasi-complete events (events for which at least 80 % of the total charge has been detected). Heavy ions produced in peripheral collisions are very likely emitted along the beam line or stopped in the plastic detectors, energy thresholds are too high for the quasi-target products detection, consequently by requiring complete or quasi-complete measurement of the total charge, we are able to detect mostly central events. The knowledge of informations like charge, energy or detection angles allows to isolate the source(s) and to reconstruct the size and the excitation energy of the source(s). Comparisons with simulations like sequential emission (GEMINI code), very deep inelastic collision or instantaneous emission (Berliner code) allows to characterise the first stage of the collision (binary collisions or central collisions) and the type of deexcitation of the source(s). Some calculations was also performed with the statistical model code MODGAN. Indeed azimuthal correlations seem to be a good tool in getting more information about involved reaction mechanisms. Comparisons with MODGAN provide information about angular momentum of the source and time delay between emissions of the two particles (separation between sequential or instantaneous process). (author). 69 refs.

  7. Ni/boride interfaces and environmental embrittlement in Ni-based superalloys: A first-principles study

    International Nuclear Information System (INIS)

    Sanyal, Suchismita; Waghmare, Umesh V.; Hanlon, Timothy; Hall, Ernest L.

    2011-01-01

    Highlights: ► Fracture strengths of Ni/boride interfaces through first-principles calculations. ► Fracture strengths of Ni/boride interfaces are higher than Ni/Ni 3 Al and NiΣ5 grain boundaries. ► Ni/boride interfaces have higher resistance to O-embrittlement than Ni/Ni 3 Al and NiΣ5 grain boundaries. ► CrMo-borides are more effective than Cr-borides in resisting O-embrittlement. ► Electronegativity differences between alloying elements correlate with fracture strengths. - Abstract: Motivated by the vital role played by boride precipitates in Ni-based superalloys in improving mechanical properties such as creep rupture strength, fatigue crack growth rates and improved resistance towards environmental embrittlement , we estimate fracture strength of Ni/boride interfaces through determination of their work of separation using first-principles simulations. We find that the fracture strength of Ni/boride interfaces is higher than that of other commonly occurring interfaces in Ni-alloys, such as Ni Σ-5 grain boundaries and coherent Ni/Ni 3 Al interfaces, and is less susceptible to oxygen-induced embrittlement. Our calculations show how the presence of Mo in Ni/M 5 B 3 (M = Cr, Mo) interfaces leads to additional reduction in oxygen-induced embrittlement. Through Electron-Localization-Function based analyses, we identify the electronic origins of effects of alloying elements on fracture strengths of these interfaces and observe that chemical interactions stemming from electronegativity differences between different atomic species are responsible for the trends in calculated strengths. Our findings should be useful towards designing Ni-based alloys with higher interfacial strengths and reduced oxygen-induced embrittlement.

  8. Corrosion Resistance Of Electroless Ni-P/Cu/Ni-P Multilayer Coatings

    Directory of Open Access Journals (Sweden)

    Zhao G.L.

    2015-06-01

    Full Text Available Ni-P/Cu/Ni-P multilayer coatings were prepared by deposition of Cu layer between two Ni–P layers. The Cu layer was deposited by metal displacement reaction between Cu2+ and Fe atoms. Corrosion behavior of single-layer Ni-P coatings, double-layer Ni-P/Cu coatings, and three-layer Ni-P/Cu/Ni-P coatings were investigated by electrochemical tests in 3.5% NaCl solution. The three-layer coatings exhibited more positive Ecorr and decreased Icorr compared with conventional single-layer Ni-P coatings, which indicated an improved corrosion resistance. The polarization curves of the three-layer coatings were characterized by two passive regions. The improved corrosion resistance was not only attributed to the function of the blocked pores of Cu. The Cu interlayer also acted as a sacrificial layer instead of a barrier in the coatings, which altered the corrosion mechanism and further improved the corrosion resistance of the coatings.

  9. Exchange bias in finite sized NiO nanoparticles with Ni clusters

    International Nuclear Information System (INIS)

    Gandhi, Ashish Chhaganlal; Lin, Jauyn Grace

    2017-01-01

    Structural and magnetic properties of finite sized NiO nanoparticles are investigated with synchrotron X-ray diffraction (XRD), transmission electron microscopy, magnetometer and ferromagnetic resonance (FMR) spectroscopy. A minor Ni phase is detected with synchrotron XRD, attributed to the oxygen defects in the NiO core. A considerable exchange bias of ~100 Oe is observed at 50 K and it drops abruptly and vanishes above 150 K, in association with the reduction of frozen spins. FMR data indicate a strong interaction between ferromagnetic (FM) and antiferromagnetic (AFM) phases below 150 K, consistent with the picture of isolated FM clusters in AFM matrix. - Highlights: • Structural and magnetic properties of finite sized NiO nanoparticles are systematically investigated with several advanced techniques. • A strong interaction between ferromagnetic and antiferromagnetic phases is found below 150 K. • Exchange bias field in finite sized NiO nanoparticles is due to anisotropy energy of Ni clusters over riding the domain wall energy of NiO.

  10. Exchange bias in finite sized NiO nanoparticles with Ni clusters

    Energy Technology Data Exchange (ETDEWEB)

    Gandhi, Ashish Chhaganlal; Lin, Jauyn Grace, E-mail: jglin@ntu.edu.tw

    2017-02-15

    Structural and magnetic properties of finite sized NiO nanoparticles are investigated with synchrotron X-ray diffraction (XRD), transmission electron microscopy, magnetometer and ferromagnetic resonance (FMR) spectroscopy. A minor Ni phase is detected with synchrotron XRD, attributed to the oxygen defects in the NiO core. A considerable exchange bias of ~100 Oe is observed at 50 K and it drops abruptly and vanishes above 150 K, in association with the reduction of frozen spins. FMR data indicate a strong interaction between ferromagnetic (FM) and antiferromagnetic (AFM) phases below 150 K, consistent with the picture of isolated FM clusters in AFM matrix. - Highlights: • Structural and magnetic properties of finite sized NiO nanoparticles are systematically investigated with several advanced techniques. • A strong interaction between ferromagnetic and antiferromagnetic phases is found below 150 K. • Exchange bias field in finite sized NiO nanoparticles is due to anisotropy energy of Ni clusters over riding the domain wall energy of NiO.

  11. Enthalpy of mixing of liquid Ni-Zr and Cu-Ni-Zr alloys

    International Nuclear Information System (INIS)

    Witusiewicz, V.T.; Sommer, F.

    2000-01-01

    Since the Al-Cu-Ni-Zr system is a basis for the production of bulk amorphous materials by rapid solidification techniques from the liquid state, it is of great scientific interest to determine the partial and the integral thermodynamic functions of liquid and undercooled liquid alloys. Such data, as was pointed out previously, are important in order to understand their extremely good glass-forming ability in multicomponent metallic systems as well as for processing improvements. In order to measure the thermodynamic properties of the Al-Cu-Ni-Zr quaternary, it is necessary to have reliable thermochemical data for its constituent canaries and ternaries first. In a series of articles, the authors have reported in detail the thermodynamic properties of liquid Al-Cu, Al-Ni, Cu-Ni, Cu-Zr, Al-Zr, Al-Cu-Ni, and Al-Cu-Zr alloys. This article deals with the direct calorimetric measurements of the partial and the integral enthalpies of mixing of liquid Ni-Zr and Cu-Ni-Zr alloys and the heat capacity of liquid Ni 26 Zr 74 . In a subsequent article, the authors will present similar data for the liquid ternary Al-Ni-Zr and for the liquid quaternary Al-Cu-Ni-Zr alloys

  12. Nitriding behavior of Ni and Ni-based binary alloys

    Energy Technology Data Exchange (ETDEWEB)

    Fonovic, Matej

    2015-01-15

    Gaseous nitriding is a prominent thermochemical surface treatment process which can improve various properties of metallic materials such as mechanical, tribological and/or corrosion properties. This process is predominantly performed by applying NH{sub 3}+H{sub 2} containing gas atmospheres serving as the nitrogen donating medium at temperatures between 673 K and 873 K (400 C and 600 C). NH{sub 3} decomposes at the surface of the metallic specimen and nitrogen diffuses into the surface adjacent region of the specimen whereas hydrogen remains in the gas atmosphere. One of the most important parameters characterizing a gaseous nitriding process is the so-called nitriding potential (r{sub N}) which determines the chemical potential of nitrogen provided by the gas phase. The nitriding potential is defined as r{sub N} = p{sub NH{sub 3}}/p{sub H{sub 2}{sup 3/2}} where p{sub NH{sub 3}} and p{sub H{sub 2}} are the partial pressures of the NH{sub 3} and H{sub 2} in the nitriding atmosphere. In contrast with nitriding of α-Fe where the nitriding potential is usually in the range between 0.01 and 1 atm{sup -1/2}, nitriding of Ni and Ni-based alloys requires employing nitriding potentials higher than 100 atm{sup -1/2} and even up to ∞ (nitriding in pure NH{sub 3} atmosphere). This behavior is compatible with decreased thermodynamic stability of the 3d-metal nitrides with increasing atomic number. Depending on the nitriding conditions (temperature, nitriding potential and treatment time), different phases are formed at the surface of the Ni-based alloys. By applying very high nitriding potential, formation of hexagonal Ni{sub 3}N at the surface of the specimen (known as external nitriding) leads to the development of a compound layer, which may improve tribological properties. Underneath the Ni{sub 3}N compound layer, two possibilities exist: (i) alloying element precipitation within the nitrided zone (known as internal nitriding) and/or (ii) development of metastable and

  13. Thermodynamic characterization of Ni3TeO6, Ni2Te3O8 and NiTe2O5

    Science.gov (United States)

    Dawar, Rimpi; Babu, R.; Ananthasivan, K.; Anthonysamy, S.

    2017-09-01

    Measurement of vapour pressure of TeO2(g) over the biphasic mixture Ni3TeO6 (s) + NiO(s) in the temperature range 1143-1272 K was carried out using transpiration-thermogravimetric technique (TTG). Gibbs energy of formation of Ni3TeO6 was obtained from the temperature dependence of vapour pressure of TeO2 (g) generated by the incongruent vapourisation reaction, Ni3TeO6 (s) → NiO(s) + TeO2 (g) + 1/2 O2 in the temperature range 1143-1272 K. An isoperibol type drop calorimeter was used to measure the enthalpy increments of Ni3TeO6, Ni2Te3O8 and NiTe2O5. Thermodynamic functions viz., heat capacity, entropy and Gibbs energy functions of these compounds were derived from the experimentally measured enthalpy increment values. Third-law analysis was carried out to ascertain absence of temperature dependent systematic errors in the measurement of vapour pressure of TeO2 (g). A value of -1265.1 ± 1.5 kJ mol-1 was obtained for Δ Hf,298K o (Ni3TeO6) using third-law analysis.

  14. Ferromagnetic resonance study of sputtered NiFe/V/NiFe heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Alayo, W., E-mail: willian.rodriguez@ufpel.edu.br [Departamento de Física – IFM, Universidade Federal de Pelotas, 96010-900 Rio Grande do Sul (Brazil); Pelegrini, F. [Instituto de Física, Universidade Federal de Goiás, Goiânia, 74001-970 (Brazil); Baggio-Saitovitch, E. [Centro Brasileiro de Pesquisas Físicas, Rio de Janeiro, RJ, 22290-180 (Brazil)

    2015-03-01

    The Ni{sub 81}Fe{sub 19}/V/Ni{sub 81}Fe{sub 19} heterostructures has been produced by magnetron sputtering and analyzed by ferromagnetic resonance. Two systems were investigated: the non symmetrical NiFe(50 Å)/V(t)/NiFe(30 Å) trilayers and the symmetrical NiFe(80 Å)/V(t)/NiFe(80 Å) trilayers, with variable ultrathin V thickness t. Ferromagnetic exchange coupling was evidenced for t below 10 Å by the excitation of the optic mode, in the case of the non symmetrical samples, and by the observation of a single resonance mode for the symmetrical trilayers. For larger V thickness, all samples exhibited two modes, which were attributed to the resonance of the individual NiFe layers with different effective magnetizations. The analysis with the equilibrium and resonance conditions provided the exchange coupling constants and effective magnetizations. - Highlights: • We present a study of symmetrical and non symmetrical NiFe/V/NiFe trilayers deposited on Si single crystals by ferromagnetic resonance (FMR) at room temperature. • For the non symmetrical trilayers, the FMR spectra show the optic and acoustic modes for samples with very thin V layer thicknesses, evidencing ferromagnetic exchange coupling, whereas, for larger V thickness, the spectra exhibited two well resolved modes associated to each independent NiFe layer. For the symmetrical trilayers, strong ferromagnetic exchange coupling is evidenced by the observation of a single resonance mode. • The analysis with the equilibrium condition and dispersion relation provides the exchange coupling constants and effective magnetizations.

  15. Microporous Ni@NiO nanoparticles prepared by chemically dealloying Al_3Ni_2@Al nanoparticles as a high microwave absorption material

    International Nuclear Information System (INIS)

    Pang, Yu; Xie, Xiubo; Li, Da; Chou, Wusheng; Liu, Tong

    2017-01-01

    The Al_3Ni_2@Al nanoparticles (NPs) were prepared from Ni_4_5Al_5_5 master alloy by hydrogen plasma-metal reaction method, and were subsequently dealloyed to produce porous Ni@NiO NPs of 36 nm. The pore size ranges from 0.7 to 1.6 nm, leading to large specific surface area of 69.5 m"2/g and big pore volume of 0.507 cc/g. The saturation magnetization (M_S) and coercivity (H_C) of the microporous Ni@NiO NPs are 11.5 emu/g and 5.2 Oe. They exhibit high microwave absorption performance with a minimum reflection coefficient (RC) of −86.9 dB and an absorption bandwidth of 2.6 GHz (RC≤−10 dB) at thickness of 4.5 mm. The enhanced microwave absorption properties are attributed to the synergistic effect of the magnetic Ni core and dielectric NiO shell, and the micropore architecture. The NPs with micropore morphology and core/shell structure open a new way to modify the microwave absorption performance. - Graphical abstract: The microporous Ni/NiO nanoparticles prepared by chemically dealloying Al_3Ni_2@Al NPs exhibit high microwave absorption intensity (−86.9 dB) and wide absorption bandwidth (2.6 GHz for RC≤−10 dB). - Highlights: • Microporous Ni/NiO nanoparticals were prepared by chemically dealloying method. • They possessed micropores of 0.7–1.6 nm with a surface area of 69.5 m"2/g. • They showed high microwave absorption intensity and wide absorption bandwidth. • Microwave absorption mechanism was explained by micropore and core/shell structures.

  16. Phase stability and magnetism in NiPt and NiPd alloys

    International Nuclear Information System (INIS)

    Paudyal, Durga; Mookerjee, Abhijit

    2004-01-01

    We show that the differences in stability of 3d-5d NiPt and 3d-4d NiPd alloys arise mainly due to relativistic corrections. The magnetic properties of disordered NiPd and NiPt alloys also differ due to these corrections, which lead to increase in the separation between the s-d bands of 5d elements in these alloys. For the magnetic case we also analyse the results in terms of splitting of majority and minority spin d band centres of the 3d elements. We further examine the effect of relativistic corrections to the pair energies and order-disorder transition temperatures in these alloys. The magnetic moments and Curie temperatures have also been studied along with the short range ordering/segregation effects in NiPt/NiPd alloys

  17. Investigation into the MgF2-NiF2, CaF2-NiF2, SrF2-NiF2 systems

    International Nuclear Information System (INIS)

    Ikrami, D.D.; Petrov, S.V.; Fedorov, P.P.; Ol'khovaya, L.A.; Luginina, A.A.; AN SSSR, Moscow. Inst. Fizicheskikh Problem; AN SSSR, Moscow. Inst. Kristallografii)

    1984-01-01

    Using the methods of differential thermal and X-ray phase analyses the systems MgF 2 -NiF 2 , CaF 2 -NiF 2 , SrF 2 -NiF 2 have been studied. In the system SrF 2 -NiF 2 the only orthorhombic compounds SrNiF 4 (a=14.43; b=3.93; c=5.66 (+-0.01 A)) is formed. SrNiF 4 density constitutes: dsub(X-ray)=4.60+-0.01 g/cm 3 , dsub(exp.)=4.60+-0.03 g/cm 3 . Refraction indices are as follows SrNiF 4 :Ng=1.500; Nsub(m)=1.497; Nsub(p)=1.479. SrNiF 4 magnetic ordering temperature Tsub(N) approximately 100 K

  18. Density functional theory study of the interfacial properties of Ni/Ni3Si eutectic alloy

    International Nuclear Information System (INIS)

    Zhao, Yuhong; Wen, Zhiqin; Hou, Hua; Guo, Wei; Han, Peide

    2014-01-01

    In order to clarify the heterogeneous nucleation potential of α-Ni grains on Ni 3 Si particles in Ni-Ni 3 Si eutectic alloy, the work of adhesion (W ad ), fracture toughness (G), interfacial energy (γ i ), and electronic structure of the index (0 0 1), (1 1 0) and (1 1 1) Ni/Ni 3 Si interfaces with two different cohesive manners are investigated using first-principles method based on density functional theory. Results indicate that the center site stacking sequence (OM) is preferable to continue the natural stacking sequence of bulk Ni and Ni 3 Si. Since OM stacking interfaces have larger W ad , G and γ i than that of the top site stacking (OT) interfaces. The Ni/Ni 3 Si (1 1 0) interface with OM stacking has the best mechanical properties. Therefore, the formation of this interface can improve the stability, ductility and fracture toughness of Ni-Ni 3 Si eutectic alloy. The calculated interfacial energy of Ni/Ni 3 Si (0 0 1), (1 1 0) and (1 1 1) interfaces with OM stacking proves the excellent nucleation potency of Ni 3 Si particles for α-Ni phase from thermodynamic considerations. Besides, the electronic structure and chemical bonding of (1 1 0) interface with OM stacking are also discussed.

  19. Microstructure and tribological properties of NiMo/Mo2Ni3Si intermetallic 'in-situ' composites

    International Nuclear Information System (INIS)

    Gui Yongliang; Song Chunyan; Yang Li; Qin Xiaoling

    2011-01-01

    Research highlights: → Wear resistant NiMo/Mo 2 Ni 3 Si intermetallic 'in-situ' composites was fabricated successfully with Mo-Ni-Si powder blends as the starting materials. Microstructure of the NiMo/Mo 2 Ni 3 Si composites consists of Mo 2 Ni 3 Si primary dendrites, binary intermetallic phase NiMo and small amount of Ni/NiMo eutectics structure. The NiMo/Mo 2 Ni 3 Si composites exhibited high hardness and outstanding tribological properties under room-temperature dry-sliding wear test conditions which were attributed to the covalent-dominant strong atomic bonds and excellent combination of strength and ductility and toughness. - Abstract: Wear resistant NiMo/Mo 2 Ni 3 Si intermetallic 'in-situ' composites with a microstructure of ternary metal silicide Mo 2 Ni 3 Si primary dendritic, the long strip-like NiMo intermetallic phase, and a small amount of Ni/NiMo eutectics structure were designed and fabricated using molybdenum, nickel and silicon elemental powders. Friction and wear properties of NiMo/Mo 2 Ni 3 Si composites were evaluated under different contact load at room-temperature dry-sliding wear test conditions. Microstructure, worn surface morphologies and subsurface microstructure were characterized by OM, XRD, SEM and EDS. Results indicate that NiMo/Mo 2 Ni 3 Si composites have low fiction coefficient, excellent wear resistance and sluggish wear-load dependence. The dominant wear mechanisms of NiMo/Mo 2 Ni 3 Si composites are soft abrasion and slightly superficial oxidative wear.

  20. Joining of Ni-TiC FGM and Ni-Al Intermetallics by Centrifugal Combustion Synthesis

    International Nuclear Information System (INIS)

    Ohmi, Tatsuya; Matsuura, Kiyotaka; Iguchi, Manabu; Mizuma, Kiminori

    2008-01-01

    A centrifugal combustion synthesis (CCS) process has been investigated to join a Ni-Al intermetallic compound and a Ni-TiC cermet. The cermet, a tubular graphite mold, and a green compact of reactants consisting of Al, Ni and NiO were set in a centrifugal caster. When the combustion synthesis reaction was induced in the centrifugal force field, a synthesized molten Ni-Al alloy flowed into the graphite mold and joined to the cermet. The soundness of the joint interface depended on the volume percentage of TiC phase in the cermet. A lot of defects were formed near the interface between the Ni-TiC cermet and the cast Ni-Al alloy when the volume percentage of TiC was 50% or higher. For this kind of cermet system, using a functionally graded cermet such as Ni-10 vol.%TiC/Ni-25 vol.%TiC/Ni-50 vol.%TiC overcame this difficulty. The four-point bending strength of the joined specimen consisting of the three-layered FGM cermet and cast Ni-29 mol%Al alloy was 1010 MPa which is close to the result for a Ni-29 mol%Al alloy specimen

  1. CONFIGURATION-INTERACTION IN NI METAL AND NI-ALLOYS AND HIGH-ENERGY SPECTROSCOPY

    NARCIS (Netherlands)

    TANAKA, A; JO, T; SAWATZKY, GA

    We discuss the electronic state of Ni atoms in Ni metal and of Ni impurity in Cu and Au metals from the viewpoint of 3d configuration interaction (CI) using the Anderson impurity model including atomic multiplets. On the basis of the discussion, we give an interpretation for the Ni 2p-core X-ray

  2. Growth of single-crystal W whiskers during humid H2/N2 reduction of Ni, Fe-Ni, and Co-Ni doped tungsten oxide

    International Nuclear Information System (INIS)

    Wang Shiliang; He Yuehui; Zou Jou; Wang Yong; Huang Han

    2009-01-01

    Numbers of W whiskers were obtained by reducing Ni, Ni-Fe, and Ni-Co doped tungsten oxide in a mixed atmosphere of humid H 2 and N 2 . The phases and morphologies of the reduction products were characterized by XRD and SEM. Intensive TEM and EDS analyses showed that the obtained whiskers were W single crystals which typical have alloyed particles (Ni-W, Fe-Ni, or Co-Ni-W) at the growth tips. The formed W whiskers were presumed to be induced by the alloyed particles. Our experimental results revealed that, during the reduction process of tungsten oxide, the pre-reduced Ni, Fe-Ni, or Co-Ni particles not only served as nucleation aids for the initial growth of W phase from W oxide but also played the roles of catalysts during the reductive decomposition of gaseous WO 2 (OH) 2 .

  3. Preparation of one-step NiO/Ni-CGO composites using factorial design

    International Nuclear Information System (INIS)

    Araujo, A.J.M. de; Sousa, A R.O. de; Camposa, L.F.A.; Macedo, D.A.; Loureiro, F. J.A.; Fagg, D.P.

    2016-01-01

    This work deals with the synthesis, processing and characterization of NiO/Ni- CGO composite materials as potential solid oxide fuel cell (SOFC) anodes. The particulate materials were obtained by a one-step synthesis method and characterized by thermal analysis (prior to calcination) and X-ray diffraction (calcined powder). The ceramic processing of samples containing from 30 to 70 wt.% NiO was carried out by factorial design. Besides the NiO content controlled during the chemical synthesis, the impacts of the pore-former content (citric acid, used in proportions of 0, 7.5 and 15 wt.%) and the sintering temperature (1300, 1350 and 1400 °C) were also investigated. The open porosity of NiO-CGO composites and reduced Ni-CGO cermets was modeled as a function of factors (NiO content, citric acid content and sintering temperature) and interaction of factors. (author)

  4. Synthesis of a novel Au nanoparticles decorated Ni-MOF/Ni/NiO nanocomposite and electrocatalytic performance for the detection of glucose in human serum.

    Science.gov (United States)

    Chen, Jingyuan; Xu, Qin; Shu, Yun; Hu, Xiaoya

    2018-07-01

    A nonenzymatic glucose electrochemical sensor was constructed based on Au nanoparticles (AuNPs) decorated Ni metal-organic-framework (MOF)/Ni/NiO nanocomposite. Ni-MOF/Ni/NiO nanocomposite was synthesized by one-step calcination of Ni-MOF. Then AuNPs were loaded onto the Ni-based nanocomposites' surface through electrostatic adsorption. Through characterization by transmission electron microscopy (TEM), high resolution TEM (HRTEM) and energy disperse spectroscopy (EDS) mapping, it is found that the AuNPs were well distributed on the surface of Ni-based nanocomposite. Cyclic voltammetric (CV) study showed the electrocatalytic activity of Au-Ni nanocomposite was highly improved after loading AuNPs onto it. Amperometric study demonstrated that the Au-Ni nanocomposites modified glassy carbon electrode (GCE) exhibited a high sensitivity of 2133.5 mA M -1 cm -2 and a wide linear range (0.4-900 μM) toward the oxidation of glucose with a detection limit as low as 0.1 μM. Moreover, the reproducibility, selectivity and stability of the sensor all exhibited outstanding performance. We applied the as-fabricated high performance sensor to measure the glucose levels in human serum and obtained satisfactory results. It is believed that AuNPs decorated Ni MOF/Ni/NiO nanocomposite provides a new platform for developing highly performance electrochemical sensors in practical applications. Copyright © 2018 Elsevier B.V. All rights reserved.

  5. Electroplating condition for Ni nanocrystalline on metal (Ni and Cu) plates

    Energy Technology Data Exchange (ETDEWEB)

    Park, Keun Yung; Uhm, Young Rang; Son, Kwang Jae; Shim, Young Ho; Choi, Sun Ju [KAERI, Daejeon (Korea, Republic of)

    2012-10-15

    Ni 63, a beta radiation source, is prepared by the electrical deposition of radioactive Ni 63 ions on a thin non radioactive nickel foil or Cu plate. Given a half life of 100 years, a nuclear battery will still produce half of its initial starting power after 100 years. A speck of a radioisotope like nickel 63, for example, contains enough energy to power a nano nuclear battery for decades, and to do so safely. Ni 63 plating is similar to other electroplating processes that employ soluble metal anodes. It requires the passage of a direct current between two electrodes that are immersed in a conductive, aqueous solution of nickel salts. The charged Ni ions are formed by sulfate, sulfamate, chloride, and a Watts bath. However, the charged Ni 63 ions are formed by dissolving metal Ni 63. To established the coating condition of Ni 63, non radioactive metal Ni particles are dissolved an acid solution and electroplated on a Ni sheet. The nickel plating process is used extensively for decorative, engineering and electro forming purposes because the appearance and other properties of electrodeposited nickel can be varied over a wide range by controlling the composition and operating parameters of the plating solution. A continuous increase in the grain size versus current density has also been recognized in the direct current electrodeposition of nickel coating. On the other hand, A runa et al. reported that the current density has no significant effect on the grain size of nickel electro deposits. A review of the literature shows that saccharin has often been added to a nickel plating bath since the 1980s to improve the ductility and brightness, and in later periods as a grain refiner agent. In the present paper, not only the preparation of a Ni plating solution prepared by dissolving metal particles, but also an optimization of the deposition conditions, such as the current density, saccharin concentration in the bath, and different metal substrates were investigated

  6. Electroplating condition for Ni nanocrystalline on metal (Ni and Cu) plates

    International Nuclear Information System (INIS)

    Park, Keun Yung; Uhm, Young Rang; Son, Kwang Jae; Shim, Young Ho; Choi, Sun Ju

    2012-01-01

    Ni 63, a beta radiation source, is prepared by the electrical deposition of radioactive Ni 63 ions on a thin non radioactive nickel foil or Cu plate. Given a half life of 100 years, a nuclear battery will still produce half of its initial starting power after 100 years. A speck of a radioisotope like nickel 63, for example, contains enough energy to power a nano nuclear battery for decades, and to do so safely. Ni 63 plating is similar to other electroplating processes that employ soluble metal anodes. It requires the passage of a direct current between two electrodes that are immersed in a conductive, aqueous solution of nickel salts. The charged Ni ions are formed by sulfate, sulfamate, chloride, and a Watts bath. However, the charged Ni 63 ions are formed by dissolving metal Ni 63. To established the coating condition of Ni 63, non radioactive metal Ni particles are dissolved an acid solution and electroplated on a Ni sheet. The nickel plating process is used extensively for decorative, engineering and electro forming purposes because the appearance and other properties of electrodeposited nickel can be varied over a wide range by controlling the composition and operating parameters of the plating solution. A continuous increase in the grain size versus current density has also been recognized in the direct current electrodeposition of nickel coating. On the other hand, A runa et al. reported that the current density has no significant effect on the grain size of nickel electro deposits. A review of the literature shows that saccharin has often been added to a nickel plating bath since the 1980s to improve the ductility and brightness, and in later periods as a grain refiner agent. In the present paper, not only the preparation of a Ni plating solution prepared by dissolving metal particles, but also an optimization of the deposition conditions, such as the current density, saccharin concentration in the bath, and different metal substrates were investigated

  7. CLASSICAL AREAS OF PHENOMENOLOGY: First-principles calculations for the elastic properties of Ni-base model superalloys: Ni/Ni3Al multilayers

    Science.gov (United States)

    Wang, Yun-Jiang; Wang, Chong-Yu

    2009-10-01

    A model system consisting of Ni[001](100)/Ni3Al[001](100) multi-layers are studied using the density functional theory in order to explore the elastic properties of single crystal Ni-based superalloys. Simulation results are consistent with the experimental observation that rafted Ni-base superalloys virtually possess a cubic symmetry. The convergence of the elastic properties with respect to the thickness of the multilayers are tested by a series of multilayers from 2γ'+2γ to 10γ'+10γ atomic layers. The elastic properties are found to vary little with the increase of the multilayer's thickness. A Ni/Ni3Al multilayer with 10γ'+10γ atomic layers (3.54 nm) can be used to simulate the mechanical properties of Ni-base model superalloys. Our calculated elastic constants, bulk modulus, orientation-dependent shear modulus and Young's modulus, as well as the Zener anisotropy factor are all compatible with the measured results of Ni-base model superalloys R1 and the advanced commercial superalloys TMS-26, CMSX-4 at a low temperature. The mechanical properties as a function of the γ' phase volume fraction are calculated by varying the proportion of the γ and γ' phase in the multilayers. Besides, the mechanical properties of two-phase Ni/Ni3Al multilayer can be well predicted by the Voigt-Reuss-Hill rule of mixtures.

  8. Synthesis of Ni core NiO shell nanostructure and magnetic investigation for shell thickness determination

    International Nuclear Information System (INIS)

    Arabi, H.; Bruck, E.; Tichelaar, F.D.

    2007-01-01

    Full text: Nickel oxide has received a considerable amount of attention in recent years for its catalytic, electronic and magnetic properties. Ni nanoparticles with an average size of 8 nm were prepared by dc - arc discharge in argon atmosphere. A current of 130 A and 300 milli bar pressure of argon have been applied. The produced Ni nanoparticles were annealed for oxidizing in air at 350 for six hours to produce antiferromagnetic NiO particles. The structure of Ni and NiO nanoparticles and size estimation of them studied by means of X-ray diffraction. The size and morphology of the particles were also characterized by high resolution transmission microscopy (TEM). The Ni core NiO shell structure, resulting from the oxidation process, were studied by magnetic properties measurements. A quantum design squid magnetometer, model MPMS5S was used for measuring saturation magnetization of both nanoparticles of Ni with and without NiO layer. By knowing the density of Ni and NiO, we were able to deduce the thickness of the Ni core and NiO outer layer. They are around 3 and 5 nanometers respectively. (authors)

  9. Electroless Ni-P/Ni-B duplex coatings: preparation and evaluation of microhardness, wear and corrosion resistance

    International Nuclear Information System (INIS)

    Narayanan, T.S.N. Sankara; Krishnaveni, K.; Seshadri, S.K.

    2003-01-01

    The present work deals with the formation of Ni-P/Ni-B duplex coatings by electroless plating process and evaluation of their hardness, wear resistance and corrosion resistance. The Ni-P/Ni-B duplex coatings were prepared using dual baths (acidic hypophosphite- and alkaline borohydride-reduced electroless nickel baths) with both Ni-P and Ni-B as inner layers and with varying single layer thickness. Scanning electron microscopy (SEM) was used to assess the duplex interface. The microhardness, wear resistance and corrosion resistance of electroless nickel duplex coatings were compared with electroless Ni-P and Ni-B coatings of similar thickness. The study reveals that the Ni-P and Ni-B coatings are amorphous in their as-plated condition and upon heat-treatment at 450 deg. C for 1 h, both Ni-P and Ni-B coatings crystallize and produce nickel, nickel phosphide and nickel borides in the respective coatings. All the three phases are formed when Ni-P/Ni-B and Ni-B/Ni-P duplex coatings are heat-treated at 450 deg. C for 1 h. The duplex coatings are uniform and the compatibility between the layers is good. The microhardness, wear resistance and corrosion resistance of the duplex coating is higher than Ni-P and Ni-B coatings of similar thickness. Among the two types of duplex coatings studied, hardness and wear resistance is higher for coatings having Ni-B coating as the outer layer whereas better corrosion resistance is offered by coatings having Ni-P coating as the outer layer

  10. Electrochemical Behaviour of Ni and Ni-PVC Electrodes for the Electroxidation of Ethanol

    International Nuclear Information System (INIS)

    Mohd Syafiq Hamdan; Norazzizi Nordin; Siti Fathrita Mohd Amir; Riyanto; Mohamed Rozali Othman

    2011-01-01

    In this study, two nickel based electrodes were prepared; nickel foil and nickel-polyvinylchloride (Ni-PVC), in order to study their electrochemical behavior using cyclic voltammetry, CV and chronocoulometry, CC. Ni electrode was prepared from Ni metal foil while Ni-PVC electrode was prepared by mixing a weighed portion of Ni powder and PVC in THF solvent, swirled until the suspension was homogeneous and drying the suspension in an oven at 50 degree Celsius for 3 h. The dry sample was then placed in a 1 cm diameter stainless steel mould and pressed at 10 ton/ cm 2 . From CV data, Ni-PVC electrode showed a better electrochemical behavior compared to Ni metal foil electrode. The use of Ni-PVC electrode at higher concentration of supporting electrolyte (1.0 M KOH) was better than at lower concentration of the same supporting electrolyte in electroxidation of ethanol. In addition to acetic acid, the oxidation of ethanol also produced ethyl acetate and acetaldehyde. (author)

  11. SYNTHESIS AND CHARACTERISATION OF Ni0.25Co0.75Fe2O4 ...

    African Journals Online (AJOL)

    characterised for their size and structure using X-ray diffraction (XRD), high .... the sample shows broad peaks, indicating the fine crystalline nature of the particles. ... Zhao, L.J.; Zhang, H.J.; Xing,Y.; Song, S.Y.; Yu, S.Y.; Shi, W.D.; Guo, X.M.; ...

  12. Nonenzymatic Glucose Sensor Based on In Situ Reduction of Ni/NiO-Graphene Nanocomposite

    Directory of Open Access Journals (Sweden)

    Xiaohui Zhang

    2016-10-01

    Full Text Available Ni/NiO nanoflower modified reduced graphene oxide (rGO nanocomposite (Ni/NiO-rGO was introduced to screen printed electrode (SPE for the construction of a nonenzymatic electrochemical glucose biosensor. The Ni/NiO-rGO nanocomposite was synthesized by an in situ reduction process. Graphene oxide (GO hybrid Nafion sheets first chemical adsorbed Ni ions and assembled on the SPE. Subsequently, GO and Ni ions were reduced by hydrazine hydrate. The electrochemical properties of such a Ni/NiO-rGO modified SPE were carefully investigated. It showed a high activity for electrocatalytic oxidation of glucose in alkaline medium. The proposed nonenzymatic sensor can be utilized for quantification of glucose with a wide linear range from 29.9 μM to 6.44 mM (R = 0.9937 with a low detection limit of 1.8 μM (S/N = 3 and a high sensitivity of 1997 μA/mM∙cm−2. It also exhibited good reproducibility as well as high selectivity.

  13. Structural and magnetic properties of Ni-Zn and Ni-Zn-Co ferrites

    Energy Technology Data Exchange (ETDEWEB)

    Knyazev, A.V., E-mail: knyazevav@gmail.com [N.I. Lobachevsky State University of Nizhni Novgorod, Gagarin Prospekt 23/2, 603950 Nizhni Novgorod (Russian Federation); Zakharchuk, I.; Lähderanta, E. [Lappeenranta University of Technology, P.O. Box 20, FI-53851 Lappeenranta (Finland); Baidakov, K.V.; Knyazeva, S.S. [N.I. Lobachevsky State University of Nizhni Novgorod, Gagarin Prospekt 23/2, 603950 Nizhni Novgorod (Russian Federation); Ladenkov, I.V. [Joint-stock Company “Research and Production Company “Salut”, Nizhni Novgorod (Russian Federation)

    2017-08-01

    Highlights: • Ni-Zn and Ni-Zn-Co ferrite powders were prepared by the solid-state reaction at 1073 K. • The room temperature saturation magnetizations are 59.7 emu/g for Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4} and 57.1 emu/g for Ni{sub 0.5}Zn{sub 0.3}Co{sub 0.2}Fe{sub 2}O{sub 4}. • The coercivity of the samples is found to be much larger than that of bulk ferrites and increases with Co introduction. • The temperature dependences of magnetization exhibit large spin frustration and spin-glass-like behavior. - Abstract: Ni-Zn and Ni-Zn-Co ferrite powders with nominal compositions Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4} and Ni{sub 0.5}Zn{sub 0.3}Co{sub 0.2}Fe{sub 2}O{sub 4} were prepared by the solid-state reaction synthesis with periodic regrinding during the calcination at 1073 K. The structure of Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4} and Ni{sub 0.5}Zn{sub 0.3}Co{sub 0.2}Fe{sub 2}O{sub 4} was refined assuming space group F d-3m. Scanning electron microscopy revealed the average sizes of the crystalline ferrite particles are 130–630 nm for Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4} and 140–350 nm for Ni{sub 0.5}Zn{sub 0.3}Co{sub 0.2}Fe{sub 2}O{sub 4}. The room temperature saturation magnetizations are 59.7 emu/g for Ni{sub 0.5}Zn{sub 0.5}Fe{sub 2}O{sub 4} and 57.1 emu/g for Ni{sub 0.5}Zn{sub 0.3}Co{sub 0.2}Fe{sub 2}O{sub 4}. The coercivity of the samples is found to be much larger than that of bulk ferrites and increases with Co introduction. The Curie temperature tends to increase upon Zn substitution by Co, as well. The temperature dependences of magnetization measured using zero-field cooled and field cooled protocols exhibit large spin frustration and spin-glass-like behavior.

  14. Polymer stabilized Ni-Ag and Ni-Fe alloy nanoclusters: Structural and magnetic properties

    Energy Technology Data Exchange (ETDEWEB)

    Kabir, L.; Mandal, A.R. [Department of Physics, Visva-Bharati, Santiniketan-731 235 (India); Mandal, S.K., E-mail: sk_mandal@hotmail.co [Department of Physics, Visva-Bharati, Santiniketan-731 235 (India)

    2010-04-15

    We report here the structural and magnetic behaviors of nickel-silver (Ni-Ag) and nickel-iron (Ni-Fe) nanoclusters stabilized with polymer (polypyrrole). High resolution transmission electron microscopy (HRTEM) indicates Ni-Ag nanoclusters to stabilize in core-shell configuration while that of Ni-Fe nanoclusters in a mixed type of geometry. Structural characterizations by X-ray diffraction (XRD) reveal the possibility of alloying in such bimetallic nanoclusters to some extent even at temperatures much lower than that of bulk alloying. Electron paramagnetic resonance (EPR) spectra clearly reveal two different absorption behaviors: one is ascribed to non-isolated Ni{sup 2+} clusters surrounded by either silver or iron giving rise to a broad signal, other (very narrow signal) being due to the isolated superparamagnetic Ni{sup 2+} clusters or bimetallic alloy nanoclusters. Results obtained for Ni-Ag and Ni-Fe nanoclusters have been further compared with the behavior exhibited by pure Ni nanoclusters in polypyrrole host. Temperature dependent studies (at 300 and 77 K) of EPR parameters, e.g. linewidth, g-value, line shape and signal intensity indicating the significant influence of surrounding paramagnetic silver or ferromagnetic iron within polymer host on the EPR spectra have been presented.

  15. Polymer stabilized Ni-Ag and Ni-Fe alloy nanoclusters: Structural and magnetic properties

    Science.gov (United States)

    Kabir, L.; Mandal, A. R.; Mandal, S. K.

    2010-04-01

    We report here the structural and magnetic behaviors of nickel-silver (Ni-Ag) and nickel-iron (Ni-Fe) nanoclusters stabilized with polymer (polypyrrole). High resolution transmission electron microscopy (HRTEM) indicates Ni-Ag nanoclusters to stabilize in core-shell configuration while that of Ni-Fe nanoclusters in a mixed type of geometry. Structural characterizations by X-ray diffraction (XRD) reveal the possibility of alloying in such bimetallic nanoclusters to some extent even at temperatures much lower than that of bulk alloying. Electron paramagnetic resonance (EPR) spectra clearly reveal two different absorption behaviors: one is ascribed to non-isolated Ni 2+ clusters surrounded by either silver or iron giving rise to a broad signal, other (very narrow signal) being due to the isolated superparamagnetic Ni 2+ clusters or bimetallic alloy nanoclusters. Results obtained for Ni-Ag and Ni-Fe nanoclusters have been further compared with the behavior exhibited by pure Ni nanoclusters in polypyrrole host. Temperature dependent studies (at 300 and 77 K) of EPR parameters, e.g. linewidth, g-value, line shape and signal intensity indicating the significant influence of surrounding paramagnetic silver or ferromagnetic iron within polymer host on the EPR spectra have been presented.

  16. Polymer stabilized Ni-Ag and Ni-Fe alloy nanoclusters: Structural and magnetic properties

    International Nuclear Information System (INIS)

    Kabir, L.; Mandal, A.R.; Mandal, S.K.

    2010-01-01

    We report here the structural and magnetic behaviors of nickel-silver (Ni-Ag) and nickel-iron (Ni-Fe) nanoclusters stabilized with polymer (polypyrrole). High resolution transmission electron microscopy (HRTEM) indicates Ni-Ag nanoclusters to stabilize in core-shell configuration while that of Ni-Fe nanoclusters in a mixed type of geometry. Structural characterizations by X-ray diffraction (XRD) reveal the possibility of alloying in such bimetallic nanoclusters to some extent even at temperatures much lower than that of bulk alloying. Electron paramagnetic resonance (EPR) spectra clearly reveal two different absorption behaviors: one is ascribed to non-isolated Ni 2+ clusters surrounded by either silver or iron giving rise to a broad signal, other (very narrow signal) being due to the isolated superparamagnetic Ni 2+ clusters or bimetallic alloy nanoclusters. Results obtained for Ni-Ag and Ni-Fe nanoclusters have been further compared with the behavior exhibited by pure Ni nanoclusters in polypyrrole host. Temperature dependent studies (at 300 and 77 K) of EPR parameters, e.g. linewidth, g-value, line shape and signal intensity indicating the significant influence of surrounding paramagnetic silver or ferromagnetic iron within polymer host on the EPR spectra have been presented.

  17. Elementary martensitic transformation processes in Ni-rich NiTi single crystals with Ni4Ti3 precipitates

    International Nuclear Information System (INIS)

    Michutta, J.; Somsen, Ch.; Yawny, A.; Dlouhy, A.; Eggeler, G.

    2006-01-01

    The present study shows that multiple-step martensitic transformations can be observed in aged Ni-rich NiTi single crystals. Ageing of solution-annealed and water-quenched Ni-rich NiTi single crystals results in a homogeneous precipitation of coherent Ni 4 Ti 3 particles. When the interparticle spacing reaches a critical value (order of magnitude: 200 nm), three distinct transformation processes are observed on cooling from the high-temperature phase using differential scanning calorimetry and in situ transmission electron microscopy. The transformation sequence begins with the formation of R-phase starting from all precipitate/matrix interfaces (first step). The transformation continues with the formation of B19' and its subsequent growth along all precipitate/matrix interfaces (second step). Finally, the matrix in between the precipitates transforms to B19' (third step). Elementary transformation mechanisms which account for two- and three-step transformations in a system with small-scale microstructural heterogeneities were identified

  18. Low-field spin dynamics of Cr7Ni and Cr7Ni-Cu -Cr 7Ni molecular rings as detected by μ SR

    Science.gov (United States)

    Sanna, S.; Arosio, P.; Bordonali, L.; Adelnia, F.; Mariani, M.; Garlatti, E.; Baines, C.; Amato, A.; Sabareesh, K. P. V.; Timco, G.; Winpenny, R. E. P.; Blundell, S. J.; Lascialfari, A.

    2017-11-01

    Muon spin rotation measurements were used to investigate the spin dynamics of heterometallic Cr7Ni and Cr7Ni -Cu-Cr7Ni molecular clusters. In Cr7Ni the magnetic ions are arranged in a quasiplanar ring and interact via an antiferromagnetic exchange coupling constant J , while Cr7Ni -Cu-Cr7Ni is composed of two Cr7Ni linked by a bridging moiety containing one Cu ion, that induces an inter-ring ferromagnetic interaction J'≪J . The longitudinal muon relaxation rate λ collected at low magnetic fields μ0H BPP)-like heuristic fitting model that takes into account of a distribution of electronic spin characteristic times for T >5 K, while the shoulder presented by Cr7Ni can be reproduced by a BPP function that incorporates a single electronic characteristic time theoretically predicted to dominate for T <5 K. The flattening of λ (T ) in Cr7Ni -Cu-Cr7Ni occurring at very low temperature can be tentatively attributed to field-dependent quantum effects and/or to an inelastic term in the spectral density of the electronic spin fluctuations.

  19. Reactive Ni/Ti nanolaminates

    International Nuclear Information System (INIS)

    Adams, D. P.; Bai, M. M.; Rodriguez, M. A.; McDonald, J. P.; Jones, E. Jr.; Brewer, L.; Moore, J. J.

    2009-01-01

    Nickel/titanium nanolaminates fabricated by sputter deposition exhibited rapid, high-temperature synthesis. When heated locally, self-sustained reactions were produced in freestanding Ni/Ti multilayer foils characterized by average propagation speeds between ∼0.1 and 1.4 m/s. The speed of a propagating reaction front was affected by total foil thickness and bilayer thickness (layer periodicity). In contrast to previous work with compacted Ni-Ti powders, no preheating of Ni/Ti foils was required to maintain self-propagating reactions. High-temperature synthesis was also stimulated by rapid global heating demonstrating low ignition temperatures (T ig )∼300-400 deg. C for nanolaminates. Ignition temperature was influenced by bilayer thickness with more coarse laminate designs exhibiting increased T ig . Foils reacted in a vacuum apparatus developed either as single-phase B2 cubic NiTi (austenite) or as a mixed-phase structure that was composed of monoclinic B19 ' NiTi (martensite), hexagonal NiTi 2 , and B2 NiTi. Single-phase, cubic B2 NiTi generally formed when the initial bilayer thickness was made small.

  20. Electronic structure of Ni-- and Ni2--ethylene cluster complexes

    International Nuclear Information System (INIS)

    Basch, H.; Newton, M.D.; Moskowitz, J.W.

    1978-01-01

    The electronic structure of metal cluster--ethylene complexes has been investigated by carrying out ab initio bonding pair-correlated, self-consistent field, and configuration interaction (CI) calculations on the NiC 2 H 4 and Ni 2 C 2 H 4 species. The π-NiC 2 H 4 and π-Ni 2 C 2 H 4 cluster complexes are found to be bound, the former only with CI, while disigma-Ni 2 C 2 H 4 has only a repulsive Ni 2 --C 2 H 4 ground state potential curve. The bonding in the π-type cluster complexes can be described as follows: The metal atom configuration is 3d 9 4s 1 with the 4s hybridized (by the metal 4p) away from the ethylene molecule, thereby allowing the π orbital to form a dative sigma bond with the metal atom. The bonding interaction is promoted by the presence of a second nickel atom behind the first one, leading to a 4s orbital electron deficiency of the bonded nickel atom and thus making this nickel atom a better electron acceptor. Back donation from the occupied metal 3d into the ethylene π* molecular orbital also takes place to some extent, and thus both features of the classical Dewar--Chatt--Duncanson model are observed. The π-Ni 2 C 2 H 4 species is analyzed in terms of the addition of a bare nickel atom to a π-NiC 2 H 4 cluster complex, with concomitant stabilization of the orbitals of the bonded nickel atom. A study of the excited electronic states of π-NiC 2 H 4 shows that low-lying 4s→π* and 3d→π* (M→L) charge transfer transitions are predicted. The former is not observed experimentally, probably due to the diffuse nature of the 4s orbital. The relationship between small cluster--ethylene complex systems and ethylene chemisorption on a nickel metal surface is discussed

  1. Effects of Ni{sub 3}Sn{sub 4} and (Cu,Ni){sub 6}Sn{sub 5} intermetallic layers on cross-interaction between Pd and Ni in solder joints

    Energy Technology Data Exchange (ETDEWEB)

    Baek, Yong-Ho [Department of Materials Science and Engineering, Korea University, Seoul 136-713 (Korea, Republic of); Division of Advanced Circuit Interconnect, Samsung Electro-Mechanics Co., Ltd., Suwon 443-743 (Korea, Republic of); Chung, Bo-Mook [Department of Materials Science and Engineering, Korea University, Seoul 136-713 (Korea, Republic of); Department of Research and Development, KPM TECH, Ansan 425-090 (Korea, Republic of); Choi, Young-Sik [Division of Advanced Circuit Interconnect, Samsung Electro-Mechanics Co., Ltd., Suwon 443-743 (Korea, Republic of); Choi, Jaeho [Department of Advanced Metal and Materials Engineering, Gangneung-Wonju National University, Gangneung 210-702 (Korea, Republic of); Huh, Joo-Youl, E-mail: jyhuh@korea.ac.kr [Department of Materials Science and Engineering, Korea University, Seoul 136-713 (Korea, Republic of)

    2013-12-05

    Highlights: •Ni{sub 3}Sn{sub 4} acts as a source of Ni atoms, leading to a strong cross-interaction with Pd. •(Cu,Ni){sub 6}Sn{sub 5} is an effective Ni diffusion barrier, inhibiting Pd resettlement. •Dissolution kinetics of (Pd,Ni)Sn{sub 4} was interpreted based on the Sn–Ni–Pd isotherm. •Cu addition to solder alleviates the (Pd,Ni)Sn{sub 4}-related risk of reliability deterioration. -- Abstract: We examined the effects of layers of intermetallic compound (IMC) Ni{sub 3}Sn{sub 4} and (Cu,Ni){sub 6}Sn{sub 5} formed at the solder/Ni interface, on the cross-interactions between Pd and Ni during solid-state aging and reflow soldering. Two types of diffusion couples, Pd/Sn/Ni and Pd/Sn–Cu/Ni, were aged at 150 °C to study the solid-state interactions. In contrast to the Pd/Sn/Ni couples in which a Ni{sub 3}Sn{sub 4} layer formed at the Ni interface, the Pd/Sn–Cu/Ni couple where a (Cu,Ni){sub 6}Sn{sub 5} layer formed at the Ni interface exhibited no significant interaction between Pd and Ni. The (Cu,Ni){sub 6}Sn{sub 5} layer acted as an effective barrier against Ni diffusion and thus inhibited the resettlement of (Pd,Ni)Sn{sub 4} onto the Ni interface. For the interaction during reflow, Sn–3.5Ag and Sn–3.0Ag–0.5Cu solder balls were isothermally reflowed on an electroless Ni(P)/electroless Pd/immersion Au (ENEPIG) surface finish at 250 °C, and the dissolution kinetics of the (Pd,Ni)Sn{sub 4} particles converted from the 0.2-μm-thick Pd-finish layer were examined. The spalled (Pd,Ni)Sn{sub 4} particles very quickly dissolved into the molten solder when the IMC layer formed on the Ni substrate was (Cu,Ni){sub 6}Sn{sub 5} rather than Ni{sub 3}Sn{sub 4}. The dependence of the dissolution kinetics of the spalled (Pd,Ni)Sn{sub 4} particles on the IMC layers was rationalized on the basis of a Sn–Ni–Pd isotherm at 250 °C. The present study suggests that the formation of a dense (Cu,Ni){sub 6}Sn{sub 5} layer at the solder/Ni interface can effectively

  2. Ultrathin NiO/NiFe2O4 Nanoplates Decorated Graphene Nanosheets with Enhanced Lithium Storage Properties

    International Nuclear Information System (INIS)

    Du, Dejian; Yue, Wenbo; Fan, Xialu; Tang, Kun; Yang, Xiaojing

    2016-01-01

    Highlights: • Ultrathin NiO/NiFe 2 O 4 nanoplates derived from NiFe layered double hydroxides are fabricated on the graphene. • NiO/NiFe 2 O 4 nanoplates on the graphene show superior electrochemical performance compared to pure NiO/NiFe 2 O 4 aggregates. • The effects of the content and the particle size/component of NiO/NiFe 2 O 4 on the electrochemical performances are studied. • Graphene-encapsulated NiO/NiFe 2 O 4 is prepared and shows slightly decreased performance compared to graphene-based composite. - Abstract: As anode materials for lithium-ion batteries, bicomponent metal oxide composites show high reversible capacities; but the morphology and particle size of the composites are hardly controllable, which may reduce their electrochemical properties. In this work, ultrathin NiO/NiFe 2 O 4 nanoplates with a diameter of 5 ∼ 7 nm and a thickness of ∼2 nm are controllably fabricated on the graphene derived from NiFe layered double hydroxides (NiFe-LDHs), and exhibit superior electrochemical performance compared to pure NiO/NiFe 2 O 4 aggregates without graphene. The nanosized NiO and NiFe 2 O 4 plates are separated from each other and the graphene substrate can prevent the aggregation of NiO/NiFe 2 O 4 as well as enhance the electronic conductivity of the composite, which is beneficial to improving the electrochemical performance. Moreover, the effects of the content and the particle size/component of NiO/NiFe 2 O 4 on the electrochemical performances are also studied in order to achieve optimal performance. Ultrathin NiO/NiFe 2 O 4 nanoplates are further encapsulated by graphene nanosheets and show slightly decreased performance compared to those supported by graphene nanosheets. The different electrochemical behaviors of graphene-containing composites may be attributed to the different interactions between graphene nanosheets and NiO/NiFe 2 O 4 nanoplates.

  3. Properties of mechanically alloyed Mg-Ni-Ti ternary hydrogen storage alloys for Ni-MH batteries

    Science.gov (United States)

    Ruggeri, Stéphane; Roué, Lionel; Huot, Jacques; Schulz, Robert; Aymard, Luc; Tarascon, Jean-Marie

    MgNiTi x, Mg 1- xTi xNi and MgNi 1- xTi x (with x varying from 0 to 0.5) alloys have been prepared by high energy ball milling and tested as hydrogen storage electrodes. The initial discharge capacities of the Mg-Ni-Ti ternary alloys are inferior to the MgNi electrode capacity. However, an exception is observed with MgNi 0.95Ti 0.05, which has an initial discharge capacity of 575 mAh/g compared to 522 mAh/g for the MgNi electrode. The Mg-Ni-Ti ternary alloys show improved cycle life compared to Mg-Ni binary alloys with the same Mg/Ni atomic ratio. The best cycle life is observed with Mg 0.5Ti 0.5Ni electrode which retains 75% of initial capacity after 10 cycles in comparison to 39% for MgNi electrodes, in addition to improved high-rate dischargeability (HRD). According to the XPS analysis, the cycle life improvement of the Mg 0.5Ti 0.5Ni electrode can be related to the formation of TiO 2 which limits Mg(OH) 2 formation. The anodic polarization curve of Mg 0.5Ti 0.5Ni electrode shows that the current related to the active/passive transition is much less important and that the passive region is more extended than for the MgNi electrode but the corrosion of the electrode is still significant. This suggests that the cycle life improvement would be also associated with a decrease of the particle pulverization upon cycling.

  4. Ni-P/Zn-Ni compositionally modulated multilayer coatings - Part 2: Corrosion and protection mechanisms

    Science.gov (United States)

    Bahadormanesh, Behrouz; Ghorbani, Mohammad

    2018-06-01

    The Ni-P/Zn-Ni compositionally modulated multilayer coatings CMMCs were electrodeposited from a single bath by switching the deposition current density. The corrosion resistance of the deposits was studied and compared with that of monolayers of Ni-P and Zn-Ni alloys via Tafel polarization, EIS and salt spray tests. Characterization of corrosion products by means of EDS and XRD revealed more details from the corrosion mechanism of the monolayers and multilayers. The corrosion current density of Ni-P/Zn-Ni CMMCs were around one tenth of Zn-Ni monolayer. The CMMC with incomplete layers performed lower polarization resistance and higher corrosion current density compared to the CMMC with complete layers. The electrical circuit that was proposed for modeling the corrosion process based on the EIS spectrum, proved that layering reduces the porosity and consequently improves the barrier properties. Although, layering of Zn-Ni layers with Ni-P deposits increased the time to red rust in salt spray test, the time for white rust formation decreased. The corrosion mechanism of both Zn-Ni and Ni-P (containing small amount of Zn) was preferential dissolution of Zn and the corrosion products were comprised of mainly Zn hydroxychloride and Zn hydroxycarbonate. Also, Ni and P did not take part in the corrosion products. Based on the electrochemical character of the layers and the morphology of the corroded surface, the corrosion mechanism of multilayers was discussed.

  5. NiCo2S4 nanosheet-decorated 3D, porous Ni film@Ni wire electrode materials for all solid-state asymmetric supercapacitor applications.

    Science.gov (United States)

    Saravanakumar, Balasubramaniam; Jayaseelan, Santhana Sivabalan; Seo, Min-Kang; Kim, Hak-Yong; Kim, Byoung-Suhk

    2017-12-07

    Wire type supercapacitors with high energy and power densities have generated considerable interest in wearable applications. Herein, we report a novel NiCo 2 S 4 -decorated 3D, porous Ni film@Ni wire electrode for high performance supercapacitor application. In this work, a facile method is introduced to fabricate a 3D, porous Ni film deposited on a Ni wire as a flexible electrode, followed by decoration with NiCo 2 S 4 as an electroactive material. The fabricated NiCo 2 S 4 -decorated 3D, porous Ni film@Ni wire electrode displays a superior performance with an areal and volumetric capacitance of 1.228 F cm -2 and 199.74 F cm -3 , respectively, at a current density of 0.2 mA cm -1 with a maximum volumetric energy and power density (E V : 6.935 mW h cm -3 ; P V : 1.019 W cm -3 ). Finally, the solid state asymmetric wire type supercapacitor is fabricated using the fabricated NiCo 2 S 4 -decorated 3D, porous Ni film@Ni wire as a positive electrode and N-doped reduced graphene oxide (N-rGO) as a negative electrode and this exhibits good areal and volumetric capacitances of C A : 0.12 F cm -2 and C V : 19.57 F cm -2 with a higher rate capability (92%). This asymmetric wire type supercapacitor demonstrates a low leakage current and self-discharge with a maximum volumetric energy (E V : 5.33 mW h cm -3 ) and power (P V : 855.69 mW cm -3 ) density.

  6. The acceleration intermediate phase (NiS and Ni3S2) evolution by nanocrystallization in Li/NiS2 thermal batteries with high specific capacity

    Science.gov (United States)

    Jin, Chuanyu; Zhou, Lingping; Fu, Licai; Zhu, Jiajun; Li, Deyi; Yang, Wulin

    2017-06-01

    The intermediate phase of NiS2 is thought to be a bottleneck currently to improve the overall performance of Li/NiS2 thermal batteries because of its low conductivity and close formation enthalpy between NiS2 and the intermediate phase (NiS, Ni3S2, etc). For improving the discharge performances of Li/NiS2 thermal batteries, the nano NiS2 with an average size of 85 ± 5 nm is designated as a cathode material. The electrochemical measurements show that the specific capacity of nano NiS2 cathode is higher than micro NiS2. The nano NiS2 cathode exhibits excellent electrochemical performances with high specific capacities of 794 and 654 mAh g-1 at current density of 0.1 and 0.5 A cm-2 under a cut-off voltage of 0.5 V, respectively. These results show that the rapid intermediate phase evolution from the nanocrystallization can obviously enhance use efficiency of NiS2 and improve discharge performances of thermal batteries.

  7. Valence electronic structure of Ni in Ni Si alloys from relative K X-ray intensity studies

    Science.gov (United States)

    Kalayci, Y.; Aydinuraz, A.; Tugluoglu, B.; Mutlu, R. H.

    2007-02-01

    The Kβ-to-Kα X-ray intensity ratio of Ni in Ni 3Si, Ni 2Si and NiSi has been determined by energy dispersive X-ray fluorescence technique. It is found that the intensity ratio of Ni decreases from pure Ni to Ni 2Si and then increases from Ni 2Si to NiSi, in good agreement with the electronic structure calculations cited in the literature. We have also performed band structure calculations for pure Ni in various atomic configurations by means of linear muffin-tin orbital method and used this data with the normalized theoretical intensity ratios cited in the literature to estimate the 3d-occupation numbers of Ni in Ni-Si alloys. It is emphasized that investigation of alloying effect in terms of X-ray intensity ratios should be carried out for the stoichiometric alloys in order to make reliable and quantitative comparisons between theory and experiment in transition metal alloys.

  8. Heavy metal environmental impact. Nickel (Ni); Impatto ambientale da metalli pesanti. Il Nichel (Ni)

    Energy Technology Data Exchange (ETDEWEB)

    Bressa, G. [Padua Univ. Padua (Italy). Dipt. di Farmacologia, Lab. di Tossicologia

    2001-02-01

    Nickel (Ni) is a heavy metal in over 3.000 different alloys used to produce kitchen utensils, batteries, coins, etc.. Human extractive and industrial activities are therefore a cause for environmental dispersion of this metal into the biosphere. This shows how in urban areas car traffic and house-heating are the main sources of nickel pollution. Nickel is relatively non-toxic, such as iron, cobalt, copper and zinc; nevertheless prolonged inhalation of dust containing such compounds as Ni O or NiCl{sub 2} concurs in the outbreak of respiratory pathologies. The carcinogenic effect of such compounds as Ni S, Ni O and Ni(CO){sub 4} has been confirmed by experiments on laboratory animals. Ni potentially toxic concentrations, and as a consequence of potential environmental impact, are to be mainly found in populated areas where the main sources are represented by industries and landfills. [Italian] Il nichel (Ni) e' un metallo presente in oltre 3.000 differenti leghe che vengono utilizzate per la produzione di utensili da cucina, batterie, monete, ecc.. Le attivita' estrattive ed industriali dell'uomo sono quindi causa di una dispersione del metallo nella biosfera. Sono stati riscontrati elevati tassi di Ni nell'atmosfera di aree urbane. Cio' sta a dimostrare che nelle aree urbane il traffico automobilistico e il riscaldamento domestico sono le fonti principali di inquinamento da tale metallo. Il nichel e' relativamente atossico, analogamente a ferro, cobalto, rame e zinco, tuttavia l'inalazione protratta di polveri contenenti composti come il NiO o il NiCl{sub 2} contribuisce al manifestarsi di patologie dell'apparato respiratorio. E' stato confermato sperimentalmente su animali da laboratorio l'effetto cancerogeno di alcuni composti quali NiS, NiO e Ni(CO){sub 4}. Concentrazioni potenzialmente tossiche di Ni, e quindi di probabile impatto ambientale, sono maggiormente da ricercare nelle zone antropizzate dove le fonti

  9. Positron annihilation studies in CeNiIn and LaNiIn

    International Nuclear Information System (INIS)

    Ray, R.; Giri, S.; Sen, M.; Nambissan, P.M.G.; Ghoshray, K.; Ghoshray, A.; Sen, P.

    1997-01-01

    Doppler broadened positron annihilation spectral lineshape (DBPAS) and positron lifetime measurements in the temperature range 18-280 K have been performed in CeNiIn and LaNiIn systems. The nature of the temperature variations of the lifetime in both systems is almost similar in the whole temperature range studied, whereas the nature of the temperature variation of the S parameter in CeNiIn is similar to that in LaNiIn except in the temperature region 18-40 K. For the former system there is a dip around 20 K in the S parameter versus temperature curve. The lifetime versus T curve in both systems could be explained by the thermal expansion of the lattice. The S parameter versus T curve in LaNiIn could also be attributed to the thermal expansion of the lattice, whereas in CeNiIn the above mentioned dip seems an extra feature of the thermal expansion of the lattice. To understand this low temperature behaviour other results on the same system have been discussed. (orig.)

  10. Interacción familiar y desarrollo emocional en niños y niñas

    Directory of Open Access Journals (Sweden)

    Gloria Cecilia Henao López

    2009-01-01

    Full Text Available En la presente investigación se tuvo como objetivo principal abordar los estilos de interacción de padres y madres de niños y niñas preescolares y su relación con el desarrollo emocional de sus hijos e hijas (235 niños y 169 niñas entre cinco y seis años de edad. Las dimensiones que se consideraron para evaluar el nivel emocional de los niños y niñas fueron: autorregulación, comprensión emocional, y empatía. Como primer aspecto describimos los tipos de interacción con sus hijos e hijas y el desarrollo emocional de los niños y niñas evaluados. Un segundo aspecto que se abordó, es el de explorar las asociaciones entre el estilo de interacción familiar y el desarrollo emocional infantil. El instrumento utilizado dirigido a los padres y madres fue la Escala de Identificación de Prácticas Educativas Familiares (PEF, versión española realizada por Alonso y Román; a los niños y niñas les aplicamos la evaluación del desempeño emocional (EDEI, que se construye como parte de esta investigación. Se trabajó con una muestra de 404 niños y niñas, y sus respectivos padres y madres. Los resultados obtenidos en esta investigación resaltan el estilo equilibrado como generador de conductas adecuadas y adaptativas en el niño o niña, al igual que rescata este estilo como el que más posibilita el nivel de comprensión emocional en los niños y niñas de nuestro estudio.

  11. High-frequency permeability of electroplated CoNiFe and CoNiFe-C alloys

    International Nuclear Information System (INIS)

    Rhen, Fernando M.F.; McCloskey, Paul; O'Donnell, Terence; Roy, Saibal

    2008-01-01

    We have investigated CoNiFe and CoNiFe-C electrodeposited by pulse reverse plating (PRP) and direct current (DC) techniques. CoNiFe(PRP) films with composition Co 59.4 Fe 27.7 Ni 12.8 show coercivity of 95 A m -1 (1.2 Oe) and magnetization saturation flux (μ 0 M s ) of 1.8 T. Resistivity of CoNiFe (PRP) is about 24 μΩ cm and permeability remains almost constant μ r ' ∼475 up to 30 MHz with a quality factor (Q) larger than 10. Additionally, the permeability spectra analysis shows that CoNiFe exhibits a classical eddy current loss at zero bias field and ferromagnetic resonance (FMR) when biased with 0.05 T. Furthermore, a crossover between eddy current and FMR loss is observed for CoNiFe-PRP when baised with 0.05 T. DC and PRP plated CoNiFe-C, which have resistivity and permeability of 85, 38 μΩ cm, μ r '=165 and 35 with Q>10 up to 320 MHz, respectively, showed only ferromagnetic resonance losses. The ferromagnetic resonance peaks in CoNiFe and CoNiFe-C are broad and resembles a Gaussian distribution of FMR frequencies. The incorporation of C to CoNiFe reduces eddy current loss, but also reduces the FMR frequency

  12. Water dissociation on Ni(100) and Ni(111): Effect of surface temperature on reactivity

    International Nuclear Information System (INIS)

    Seenivasan, H.; Tiwari, Ashwani K.

    2013-01-01

    Water adsorption and dissociation on Ni(100) and Ni(111) surfaces are studied using density functional theory calculations. Water adsorbs on top site on both the surfaces, while H and OH adsorb on four fold hollow and three fold hollow (fcc) sites on Ni(100) and Ni(111), respectively. Transition states (TS) on both surfaces are identified using climbing image-nudged elastic band method. It is found that the barrier to dissociation on Ni(100) surface is slightly lower than that on Ni(111) surface. Dissociation on both the surfaces is exothermic, while the exothermicity on Ni(100) is large. To study the effect of lattice motion on the energy barrier, TS calculations are performed for various values of Q (lattice atom coordinate along the surface normal) and the change in the barrier height and position is determined. Calculations show that the energy barrier to reaction decreases with increasing Q and increases with decreasing Q on both the surfaces. Dissociation probability values at different surface temperatures are computed using semi-classical approximation. Results show that the influence of surface temperature on dissociation probability on the Ni(100) is significantly larger compared to that of Ni(111). Moreover, on Ni(100), a dramatic shift in energy barrier to lower incident energy values is observed with increasing surface temperature, while the shift is smaller in the case of Ni(111)

  13. Microporous Ni@NiO nanoparticles prepared by chemically dealloying Al{sub 3}Ni{sub 2}@Al nanoparticles as a high microwave absorption material

    Energy Technology Data Exchange (ETDEWEB)

    Pang, Yu; Xie, Xiubo; Li, Da [Key Laboratory of Aerospace Materials and Performance (Ministry of Education), School of Materials Science and Engineering, Beihang University, No.37 Xueyuan Road, Beijing 100191 (China); Chou, Wusheng [School of Mechanical Engineering and Automation, Beihang University, Beijing 100191 (China); Liu, Tong, E-mail: tongliu@buaa.edu.cn [Key Laboratory of Aerospace Materials and Performance (Ministry of Education), School of Materials Science and Engineering, Beihang University, No.37 Xueyuan Road, Beijing 100191 (China)

    2017-03-15

    The Al{sub 3}Ni{sub 2}@Al nanoparticles (NPs) were prepared from Ni{sub 45}Al{sub 55} master alloy by hydrogen plasma-metal reaction method, and were subsequently dealloyed to produce porous Ni@NiO NPs of 36 nm. The pore size ranges from 0.7 to 1.6 nm, leading to large specific surface area of 69.5 m{sup 2}/g and big pore volume of 0.507 cc/g. The saturation magnetization (M{sub S}) and coercivity (H{sub C}) of the microporous Ni@NiO NPs are 11.5 emu/g and 5.2 Oe. They exhibit high microwave absorption performance with a minimum reflection coefficient (RC) of −86.9 dB and an absorption bandwidth of 2.6 GHz (RC≤−10 dB) at thickness of 4.5 mm. The enhanced microwave absorption properties are attributed to the synergistic effect of the magnetic Ni core and dielectric NiO shell, and the micropore architecture. The NPs with micropore morphology and core/shell structure open a new way to modify the microwave absorption performance. - Graphical abstract: The microporous Ni/NiO nanoparticles prepared by chemically dealloying Al{sub 3}Ni{sub 2}@Al NPs exhibit high microwave absorption intensity (−86.9 dB) and wide absorption bandwidth (2.6 GHz for RC≤−10 dB). - Highlights: • Microporous Ni/NiO nanoparticals were prepared by chemically dealloying method. • They possessed micropores of 0.7–1.6 nm with a surface area of 69.5 m{sup 2}/g. • They showed high microwave absorption intensity and wide absorption bandwidth. • Microwave absorption mechanism was explained by micropore and core/shell structures.

  14. Thermal capture cross section for 58Ni (n,γ)59 Ni reaction

    International Nuclear Information System (INIS)

    Carbonari, A.W.; Pecequilo, B.R.S.

    1989-01-01

    The 58 Ni total thermal capture cross section was determined by suming the partial cross sections calculated for the primary transitions of the reaction 58 Ni (n,γ) 59 Ni. The primary transitions energies and intensities were determined from the 58 Ni thermal neutrons prompt gamma capture gamma rays spectrum in the 3.7 to 9.3 MeV region. The obtained value for the total cross section was 4.52 + 0.10b. (author) [pt

  15. 石氏针药结合治疗急性踝关节扭伤早期疗效研究%Clinical Observation on the Treatment of Acute Ankle Sprain by Shi's Acupuncture Therapy Combined with Compound Zijing Plaster

    Institute of Scientific and Technical Information of China (English)

    李涛; 郭海玲; 杨光月; 商海滨; 赵咏芳

    2017-01-01

    目的:研究石氏针刺结合复方紫荆消伤膏外用治疗急性踝关节扭伤早期症状改善特点,评价石氏针刺结合外用膏药治疗急性踝关节扭伤、弹力绷带固定治疗和功能锻炼治疗的优效性.方法:对上海市浦东新区6家医院2014年1月至2016年10月收治的300例急性踝关节扭伤患者随机分为针药结合治疗组、弹力绷带固定组和功能锻炼组,三组受试者分别予石氏针刺结合膏药外用治疗,弹力绷带固定结合膏药治疗和功能锻炼处方结合膏药治疗.在入组时(入组)、第7天(第1周、访视一)、第28天(第4周、访视二)和第42天(第6周、访视三)采用美国足踝外科学会AOFAS踝后足评分量表、VAS疼痛评分进行优效性评价.结果:三种治疗方法对急性踝关节扭伤均有疗效(P<0.05).在第7天,针药结合组AOFAS评分与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组AOFAS评分高于绷带固定组和功能锻炼组评分.在第7天、第28天针药结合组VAS疼痛评分变化与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组VAS疼痛评分改善大于弹力绷带固定组和功能锻炼组.针药结合组AOFAS疗效评定痊愈率和VAS疼痛疗效评定痊愈率高于绷带固定组和功能锻炼组(P<0.05).结论:石氏针药结合治疗急性踝关节扭伤临床疗效明确,对损伤早期的疼痛改善和功能恢复疗效优于弹力绷带固定治疗和功能锻炼治疗.%Objective:To study the improvement characteristics of early symptoms of acute ankle sprain treated with the Shi's acupuncture therapy combined with compound Zijing plaster,and to evaluate the superiority of the Shi's therapy combined with topical plaster,elastic bandage fixation and functional exercise therapy in the treatment of acute ankle sprain.Methods:All 300 cases of acute ankle sprain patients were randomly assigned to groups of Shi's therapy

  16. Niños y niñas como cuidadores familiares

    Directory of Open Access Journals (Sweden)

    María Rosa Estupiñán Aponte

    2015-01-01

    Full Text Available En el contexto familiar, el cuidado de otra persona por parte de niños y niñas constituye un terreno inexplorado tanto en su significado como en las implicaciones que podrían darse en el proceso. Aunque históricamente se ha asignado el cuidado familiar a las mujeres generando condiciones de inequidad, incrementada con los cambios sociales de los últimos tiempos, es necesario reconocer que en muchos hogares niños y niñas se han visto obligados a desempeñar esta labor sin la preparación ni las destrezas necesarias. Desde una perspectiva de género, el artículo busca evidenciar esta situación mediante la revisión de los abordajes que sobre el tema se han hecho en países de Europa y Norteamérica, así como el análisis de información obtenida a partir de las Encuestas de Hogares y Uso del Tiempo (EUT en algunos países de Latinoamérica. Se establece la forma como las problemáticas sociales inciden en las dinámicas, tipo de tareas y responsabilidades que deben asumir niños y niñas en los hogares, mostrando delgados límites entre la colaboración al interior de las familias, la transmisión cultural de roles y funciones y las actividades que podrían incidir negativamente en su crecimiento y el ejercicio de sus derechos.

  17. Iodine capture by Hofmann-type clathrate Ni(II)(pz)[Ni(II)(CN)_4

    International Nuclear Information System (INIS)

    Massasso, Giovanni; Long, Jerome; Haines, Julien; Devautour-Vinot, Sabine; Maurin, Guillaume; Larionova, Joulia; Guerin, Christian; Guari, Yannick; Grandjean, Agnes; Onida, Barbara; Donnadieu, Bruno

    2014-01-01

    The thermally stable Hofmann-type clathrate framework Ni(II)(pz)[Ni(II)(CN)_4] (pz = pyrazine) was investigated for the efficient and reversible sorption of iodine (I_2) in the gaseous phase and in solution with a maximum adsorption capacity of 1 mol of I_2 per 1 mol of Ni(II)pz)[Ni(II)(CN)_4] in solution. (authors)

  18. Electrochemical properties of the ball-milled LaMg10NiMn alloy with Ni powders

    International Nuclear Information System (INIS)

    Wang Yi; Wang Xin; Gao Xueping; Shen Panwen

    2008-01-01

    The electrochemical characteristics of the ball-milled LaMg 10 NiMn alloys with Ni powders were investigated. It was found that the ball-milled LaMg 10 NiMn + 150 wt.% Ni composite exhibited higher first discharge capacity and better cycle performance. By means of the analysis of electrochemical impedance spectra (EIS), it was shown that the existence of manganese in LaMg 10 NiMn alloy increased the electrocatalytic activity due to its catalytic effect, and destabilized metal hydrides, and so reduced the hydrogen diffusion resistance. These contributed to the higher discharge capacity of the ball-milled LaMg 10 NiMn-Ni composite. According to the analytical results of X-ray diffraction (XRD), EIS and steady-state polarization (SSP) experiments, the inhibition of metal corrosion is not the main reason for the better cycle performance. The main reason is that the electrochemical reaction resistance of the ball-milled LaMg 10 NiMn-Ni composite is always lower than that of the ball-milled LaMg 10 Ni 2 -Ni composite because the former one contains manganese, which is a catalyst for the electrode reaction

  19. Development of the dentistry alloy Ni-Cr-Nb; Desenvolvimento de ligas odontologicas Ni-Cr-Nb

    Energy Technology Data Exchange (ETDEWEB)

    Souza, M.A.; Ramos, A.S.; Hashimoto, T.M., E-mail: mari_sou@hotmail.co [UNESP/FEG, Guaratingueta, SP (Brazil). Fac. de Engenharia. Dept. de Materiais e Tecnologia

    2010-07-01

    This work reports on the structural characterization of Ni-Cr-Mo and Ni-Cr-Nb alloys produced by arc melting. Samples were characterized by means of optical microscopy, X-ray diffraction, scanning electron microscopy, and EDS analysis. Results indicated that the arc melting process was efficient to produce homogeneous structures in Ni-Cr-Mo and Ni-Cr-Nb alloys. The nickel dissolved large amounts of Cr, Mo and Nb, which was detected by EDS analysis and X-ray diffraction. The alloy containing molybdenum indicated the presence of structure based on Ni{sub SS}, while that the alloys containing niobium presented primary grains of Ni{sub SS} and precipitates formed by the simultaneous transformation of the Ni and Ni{sub 3}Nb phases. (author)

  20. Enhanced Electrocatalytic Activity for Water Splitting on NiO/Ni/Carbon Fiber Paper

    Directory of Open Access Journals (Sweden)

    Ruoyu Zhang

    2016-12-01

    Full Text Available Large-scale growth of low-cost, efficient, and durable non-noble metal-based electrocatalysts for water splitting is crucial for future renewable energy systems. Atomic layer deposition (ALD provides a promising route for depositing uniform thin coatings of electrocatalysts, which are useful in many technologies, including the splitting of water. In this communication, we report the growth of a NiO/Ni catalyst directly on carbon fiber paper by atomic layer deposition and report subsequent reduction and oxidation annealing treatments. The 10–20 nm NiO/Ni nanoparticle catalysts can reach a current density of 10 mA·cm−2 at an overpotential of 189 mV for hydrogen evolution reactions and 257 mV for oxygen evolution reactions with high stability. We further successfully achieved a water splitting current density of 10 mA·cm−2 at 1.78 V using a typical NiO/Ni coated carbon fiber paper two-electrode setup. The results suggest that nanoparticulate NiO/Ni is an active, stable, and noble-metal-free electrocatalyst, which facilitates a method for future water splitting applications.

  1. Microstructure and mechanical properties of sputter deposited Ni/Ni{sub 3}Al multilayer films at elevated temperature

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Chao [Shanghai Key Laboratory of Materials Laser Processing and Modification, School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Collaborative Innovation Center for Advanced Ship and Deep-Sea Exploration, Shanghai 200240 (China); Feng, Kai, E-mail: fengkai@sjtu.edu.cn [Shanghai Key Laboratory of Materials Laser Processing and Modification, School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Collaborative Innovation Center for Advanced Ship and Deep-Sea Exploration, Shanghai 200240 (China); Li, Zhuguo, E-mail: lizg@sjtu.edu.cn [Shanghai Key Laboratory of Materials Laser Processing and Modification, School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Collaborative Innovation Center for Advanced Ship and Deep-Sea Exploration, Shanghai 200240 (China); Lu, Fenggui; Huang, Jian; Wu, Yixiong [Shanghai Key Laboratory of Materials Laser Processing and Modification, School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai 200240 (China); Collaborative Innovation Center for Advanced Ship and Deep-Sea Exploration, Shanghai 200240 (China)

    2016-08-15

    Highlights: • Ni/Ni{sub 3}Al multilayers are prepared by magnetron sputtering. • Both grain size and phase constitution of annealed Ni/Ni{sub 3}Al multilayers are dependent on individual layer thickness. • The hardness of annealed Ni/Ni{sub 3}Al multilayers varies with individual layer thickness and annealing temperature. • 40 nm Ni/Ni{sub 3}Al multilayer exhibits excellent hardness at elevated temperature. - Abstract: Nano-structured Ni/Ni{sub 3}Al multilayer was prepared by magnetron sputtering, with individual layer thicknesses h varying from 10 to 160 nm. The microstructure and hardness of Ni/Ni{sub 3}Al multilayer were investigated by X-ray diffraction, transmission electron microscopy and nanoindentation. The results show that the hardness increases with decreasing h for as-deposited and 500 °C annealed multilayers. When annealed at 700 °C, the hardness approach a peak value at h = 40 nm with followed by softening at smaller h. The influence of individual layer thickness, grain size as well as formation of ordered Ni{sub 3}Al on strengthening mechanisms of Ni/Ni{sub 3}Al multilayers at elevated temperature are discussed.

  2. Calculation of Gibbs energy of Zr-Al-Ni, Zr-Al-Cu, Al-Ni-Cu and Zr-Al-Ni-Cu liquid alloys based on quasiregular solution model

    International Nuclear Information System (INIS)

    Li, H.Q.; Yang, Y.S.; Tong, W.H.; Wang, Z.Y.

    2007-01-01

    With the effects of electronic structure and atomic size being introduced, the mixing enthalpy as well as the Gibbs energy of the ternary Zr-Al-Cu, Ni-Al-Cu, Zr-Ni-Al and quaternary Zr-Al-Ni-Cu systems are calculated based on quasiregular solution model. The computed results agree well with the experimental data. The sequence of Gibbs energies of different systems is: G Zr-Al-Ni-Cu Zr-Al-Ni Zr-Al-Cu Cu-Al-Ni . To Zr-Al-Cu, Ni-Al-Cu and Zr-Ni-Al, the lowest Gibbs energy locates in the composition range of X Zr 0.39-0.61, X Al = 0.38-0.61; X Ni = 0.39-0.61, X Al = 0.38-0.60 and X Zr = 0.32-0.67, X Al = 0.32-0.66, respectively. And to the Zr-Ni-Al-Cu system with 66.67% Zr, the lowest Gibbs energy is obtained in the region of X Al = 0.63-0.80, X Ni = 0.14-0.24

  3. Length-dependent corrosion behavior, Ni2+ release, cytocompatibility, and antibacterial ability of Ni-Ti-O nanopores anodically grown on biomedical NiTi alloy.

    Science.gov (United States)

    Hang, Ruiqiang; Liu, Yanlian; Bai, Long; Zhang, Xiangyu; Huang, Xiaobo; Jia, Husheng; Tang, Bin

    2018-08-01

    In the present work, nickel-titanium-oxygen nanopores with different length (0.55-114 μm) were anodically grown on nearly equiatomic nickel-titanium (NiTi) alloy. Length-dependent corrosion behavior, nickel ion (Ni 2+ ) release, cytocompatibility, and antibacterial ability were investigated by electrochemical, analytical chemistry, and biological methods. The results show constructing nanoporous structure on the NiTi alloy improve its corrosion resistance. However, the anodized samples release more Ni 2+ than that of the bare NiTi alloy, suggesting chemical dissolution of the nanopores rather than electrochemical corrosion governs the Ni 2+ release. In addition, the Ni 2+ release amount increases with nanopore length. The anodized samples show good cytocompatibility when the nanopore length is covers the one (1-11 μm) that the nanopores showing favorable antibacterial ability. Consequently, the nanopores with length in the range of 1-11 μm are promising as coatings of biomedical NiTi alloy for anti-infection, drug delivery, and other desirable applications. Copyright © 2018 Elsevier B.V. All rights reserved.

  4. Structural Investigation of Fe-Ni-S and Fe-Ni-Si Melts by High-temperature Fluorescence XAFS Measurements

    International Nuclear Information System (INIS)

    Manghnani, Murli H.; Balogh, John; Hong Xinguo; Newville, Matthew; Amulele, G.

    2007-01-01

    Iron-nickel (Fe-Ni) alloy is regarded as the most abundant constituent of Earth's core, with an amount of 5.5 wt% Ni in the core based on geochemical and cosmochemical models. The structural role of nickel in liquid Fe-Ni alloys with light elements such as S or Si is poorly understood, largely because of the experimental difficulties of high-temperature melts. Recently, we have succeeded in acquiring Ni K-edge fluorescence x-ray absorption fine structure (XAFS) spectra of Fe-Ni-S and Fe-Ni-Si melts and alloys. Different structural environment of Ni atoms in Fe-Ni-S and Fe-Ni-Si melts is observed, supporting the effect of light elements in Fe-Ni melts

  5. Structure of Ni-rich Ni--Cr--B--Si coating alloys

    International Nuclear Information System (INIS)

    Knotek, O.; Lugscheider, E.; Reimann, H.

    1975-01-01

    The structures of quaternary, nickel-rich Ni--Cr--B--Si alloys were analyzed at a constant boron content of 10 at. percent and a temperature of 850 0 C. The composition range for silicide formation was determined. In these quaternary alloys, known binary nickel silicides, nickel and chromium borides, and the ternary silico-boride Ni 6 Si 2 B were confirmed. A new composition for the W 5 Si 3 -type phase in the Ni--B--Si system was proposed. (U.S.)

  6. On the Ni-Ion release rate from surfaces of binary NiTi shape memory alloys

    Science.gov (United States)

    Ševčíková, Jana; Bártková, Denisa; Goldbergová, Monika; Kuběnová, Monika; Čermák, Jiří; Frenzel, Jan; Weiser, Adam; Dlouhý, Antonín

    2018-01-01

    The study is focused on Ni-ion release rates from NiTi surfaces exposed in the cell culture media and human vascular endothelial cell (HUVEC) culture environments. The NiTi surface layers situated in the depth of 70 μm below a NiTi oxide scale are affected by interactions between the NiTi alloys and the bio-environments. The finding was proved with use of inductively coupled plasma mass spectrometry and electron microscopy experiments. As the exclusive factor controlling the Ni-ion release rates was not only thicknesses of the oxide scale, but also the passivation depth, which was two-fold larger. Our experimental data strongly suggested that some other factors, in addition to the Ni concentration in the oxide scale, admittedly hydrogen soaking deep below the oxide scale, must be taken into account in order to rationalize the concentrations of Ni-ions released into the bio-environments. The suggested role of hydrogen as the surface passivation agent is also in line with the fact that the Ni-ion release rates considerably decrease in NiTi samples that were annealed in controlled hydrogen atmospheres prior to bio-environmental exposures.

  7. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    CERN Document Server

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  8. Three-dimensional electrode of Ni/Co layered double hydroxides@NiCo2S4@graphene@Ni foam for supercapacitors with outstanding electrochemical performance

    International Nuclear Information System (INIS)

    Tao, Yan; Ruiyi, Li; Lin, Zhou; Chenyang, Ma; Zaijun, Li

    2015-01-01

    We reported a new strategy for fabricating three-dimensiona electrode of Ni/Co layered double hydroxide@NiCo 2 S 4 @graphene@Ni foam for supercapacitors. The resulting 3D electrode offers a jungle-like architecture. The unique structure creates ultra fast electron transfer and electrolyte transport as well as the maximum utilization rate of the space and the surface. The electrode exhibits a prominent advantage of high specific capacitance, high-current capacitive behaviour and cycle stability. - Highlights: • The study developed a new strategy for fabricating 3D electrode of Ni/Co-LDH@NiCo 2 S 4 @G. • The as-prepared 3D electrode offers a jungle-like architecture. • The unique structure creates an efficient conduction network and high mass loading. • The electrode achieves significantly synergetic effect among different materials. • The electrode exhibits an excellent electrochemical performance for supercapacitors. - ABSTRACT: Great challenge for the fabrication of free-standing three-dimensional electrode still remains to simultaneously achieve high specific capacitance, rate performance and cycle stability. The paper reprted a new three-dimensional (3D) electrode of Ni/Co layered double hydroxide@NiCo 2 S 4 @graphene@Ni foam (Ni/Co-LDH@NiCo 2 S 4 @G) for supercapacitors. The as-prepared 3D electrode offers an unique architecture, which create an efficient conduction network and maximum utilization of space and interface. The graphene acts as well-knit and conductive skin coated on the skeleton of Ni foam for growing NiCo 2 S 4 . The conductive NiCo 2 S 4 array serves as bridge between Ni/Co-LDH and graphene, leading to ultrafast electron transfer and electrolyte transport. A slew of splits and holes existing in the NiCo 2 S 4 array play one role as the ion-reservoir to contain host of electrolyte ions. To evaluate the feasibility of 3D electrode’s application in supercapacitors, the electrochemical performance was investigated by using the three

  9. Electrochemical preparation and characteristics of Ni-Co-LaNi5 composite coatings as electrode materials for hydrogen evolution

    International Nuclear Information System (INIS)

    Wu Gang; Li Ning; Dai Changsong; Zhou Derui

    2004-01-01

    Electrocatalytic activity for the hydrogen evolution reaction on Ni-Co-LaNi 5 composite electrodes prepared by electrochemical codeposition technique was evaluated. The relationship between the current density for hydrogen evolution reaction and the amount of LaNi 5 particles in Ni-Co baths is like the well-known 'volcano plot'. The Surface morphology and microstructure of Ni-Co-LaNi 5 coatings were determined by means of scanning electron microscopy (SEM) and X-ray diffraction (XRD). The kinetic parameters were determined from electrochemical steady-state Tafel polarization and electrochemical impedance spectroscopy technology in 1 M NaOH solution. The values obtained for the apparent energies of activation are 32.48, 46.29 and 57.03 kJ mol -1 for the Ni-Co-LaNi 5 , Ni-Co and Ni electrodes, respectively. The hydrogen evolution reaction on Ni-Co-LaNi 5 proceeds via Volmer-Tafel reaction route with the mixed rate determining characteristics. The composite coating Ni-Co-LaNi 5 is catalytically more active than Ni and Ni-Co electrodes due to the increase in its real surface areas and the decrease in the apparent free energy of activation caused by the electrocatalytic synergistic effect of the Ni-Co alloys and the hydrogen storage intermetallic particles on the electrode surface

  10. Exchange bias variations of the seed and top NiFe layers in NiFe/FeMn/NiFe trilayer as a function of seed layer thickness

    International Nuclear Information System (INIS)

    Sankaranarayanan, V.K.; Yoon, S.M.; Kim, C.G.; Kim, C.O.

    2005-01-01

    Development of exchange bias at the seed and top NiFe layers in the NiFe (t nm)/FeMn(10 nm)/NiFe(5 nm) trilayer structure is investigated as a function of seed layer thickness, in the range of 2-20 nm. The seed NiFe layer shows maximum exchange bias at 4 nm seed layer thickness. The bias shows inverse thickness dependence with increasing thickness. The top NiFe layer on the other hand shows only half the bias of the seed layer which is retained even after the sharp fall in seed layer bias. The much smaller bias for the top NiFe layer is related to the difference in crystalline texture and spin orientations at the top FeMn/NiFe interface, in comparison to the bottom NiFe/FeMn interface which grows on a saturated NiFe layer with (1 1 1) orientation

  11. Pituitary-dependent hyperadrenocorticism in a shi tzu dog treated with twice-daily oral trilostane: a case reportHyperadrenocorticismo hipófise dependente em um cão shi tzu tratado com trilostane oral a cada 12 horas: relato de caso

    Directory of Open Access Journals (Sweden)

    Lucas Alécio Gomes

    2012-10-01

    Full Text Available Hyperadrenocorticism can be defined as a chronic high circulating cortisol, and is a relatively common disease in dogs when compared to cats. Of dogs with naturally occurring HAC, 80 to 85% have pituitary-dependent hyperadrenocorticism (PDH, which is an excessive secretion of ACTH by the pituitary, causing bilateral adrenal hyperplasia and excessive secretion of glucocorticoids. More than 90% of dogs with PDH have a pituitary tumor. The aim of this article is to report a case of a dog, seven years old, female, Shi Tzu, that presented with panting, polyuria/polydipsia, polyphagia, pendulous abdomen and bilateral abdominal alopecia, and intermittent weakness in the pelvic limbs. Based on laboratorial and screening tests a pituitary-dependent hyperadrenocorticism was diagnosed and treated with twice-daily trilostane, orally. In the early monitoring period, ACTH test was performed with an unusual interval (to 30 days. In this case, the starting dose didn’t show improvement in the cutaneous alterations, requiring an increase on the dosage. Hiperadrenocorticismo (HAC é uma doença relativamente comum em cães quando comparado aos gatos e pode ser definido como aumento persistente do cortisol na circulação sanguínea. Quanto ao tipo de manifestação o HAC hipófise-dependente ocorre em 80 a 85% dos casos, causando secreção excessiva de ACTH pela hipófise levando ao aumento bilateral das glândulas adrenais. Mais de 90% dos casos de HAC hipófise-dependente (em cães ocorrem devido a tumores na glândula. O objetivo deste trabalho é relatar o caso de uma cadela da raça Shi Tzu, com sete anos de idade, que apresentou respiração ofegante, poliúria/polidipsia, polifagia, abdome pendular, alopecia bilateral simétrica e fraqueza intermitente em membros pélvicos. Os exames laboratoriais de rotina associados aos testes de triagem confirmaram a suspeita de hiperadrenocorticismo hipófise dependente. O tratamento desde o início tem sido com

  12. Combining Ru, Ni and Ni(OH){sub 2} active sites for improving catalytic performance in benzene hydrogenation

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Lihua, E-mail: lihuazhu@stu.xmu.edu.cn [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou 341000, Jiang Xi (China); Department of Chemical and Biochemical Engineering, National Engineering Laboratory for Green Productions of Alcohols-Ethers-Esters, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen 361005 (China); Sun, Hanlei; Zheng, Jinbao [Department of Chemical and Biochemical Engineering, National Engineering Laboratory for Green Productions of Alcohols-Ethers-Esters, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen 361005 (China); Yu, Changlin, E-mail: yuchanglinjx@163.com [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou 341000, Jiang Xi (China); Zhang, Nuowei [Department of Chemical and Biochemical Engineering, National Engineering Laboratory for Green Productions of Alcohols-Ethers-Esters, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen 361005 (China); Shu, Qing [School of Metallurgy and Chemical Engineering, Jiangxi University of Science and Technology, Ganzhou 341000, Jiang Xi (China); Chen, Bing H., E-mail: chenbh@xmu.edu.cn [Department of Chemical and Biochemical Engineering, National Engineering Laboratory for Green Productions of Alcohols-Ethers-Esters, College of Chemistry and Chemical Engineering, Xiamen University, Xiamen 361005 (China)

    2017-05-01

    In this study, the Ru{sub 0.04}Ni{sub 0.96}/C(T) catalysts were successfully prepared by the simple methods of hydrazine-reduction and galvanic replacement, where 0.04/0.96 and T represented the Ru/Ni atomic ratio and reducing temperature of the catalyst in N{sub 2}+10%H{sub 2}, respectively. The nanostructures of the Ru{sub 0.04}Ni{sub 0.96} nanoparticles in the Ru{sub 0.04}Ni{sub 0.96}/C(T) catalysts were controlled by modulating their annealing temperature in N{sub 2}+10%H{sub 2} and characterized by an array of techniques, including X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), transmission electron microscopy (TEM), high resolution transmission electron microscopy (HRTEM), scanning transmission electron microscopy energy dispersive X-ray spectroscopy (STEM-EDS) mapping and high-sensitivity low-energy ion scattering (HS-LEIS). The Ru{sub 0.04}Ni{sub 0.96}/C(30) catalyst, which was composed of Ru clusters or single atoms supported on Ni/Ni(OH){sub 2} nanoparticles, exhibited much better catalytic performance for benzene hydrogenation than the Ru{sub 0.04}Ni{sub 0.96}/C(T) catalysts reduced at above 30 °C, such as Ru{sub 0.04}Ni{sub 0.96}/C(160) with the nanostructure of partial Ru{sub 0.04}Ni{sub 0.9} alloy and Ru{sub 0.04}Ni{sub 0.96}/C(280) with the nanostructure of complete Ru{sub 0.04}Ni{sub 0.9} alloy. The reason was that the synergistic effect of multiple active sites – Ru, Ni and Ni(OH){sub 2} sites was present in the Ru{sub 0.04}Ni{sub 0.96}/C(30) catalyst, where hydrogen was preferentially activated at Ru sites, benzene was probably activated at Ni(OH){sub 2} surface and Ni acted as a “bridge” for transferring activated H{sup ∗} species to activated benzene by hydrogen spillover effect, hydrogenating and forming product – cyclohexane. This study also provided a typical example to illustrate that the synergy effect of multiple active sites can largely improve the catalytic hydrogenation performance. - Highlights: • The Ru

  13. H-Phase Precipitation and Martensitic Transformation in Ni-rich Ni-Ti-Hf and Ni-Ti-Zr High-Temperature Shape Memory Alloys

    Science.gov (United States)

    Evirgen, A.; Pons, J.; Karaman, I.; Santamarta, R.; Noebe, R. D.

    2018-03-01

    The distributions of H-phase precipitates in Ni50.3Ti29.7Hf20 and Ni50.3Ti29.7Zr20 alloys formed by aging treatments at 500 and 550 °C or slow furnace cooling and their effects on the thermal martensitic transformation have been investigated by TEM and calorimetry. The comparative study clearly reveals faster precipitate-coarsening kinetics in the NiTiZr alloy than in NiTiHf. For precipitates of a similar size of 10-20 nm in both alloys, the martensite plates in Ni50.3Ti29.7Zr20 have larger widths and span a higher number of precipitates compared with the Ni50.3Ti29.7Hf20 alloy. However, for large H-phase particles with hundreds of nm in length, no significant differences in the martensitic microstructures of both alloy systems have been observed. The martensitic transformation temperatures of Ni50.3Ti29.7Hf20 are 80-90 °C higher than those of Ni50.3Ti29.7Zr20 in the precipitate-free state and in the presence of large particles of hundreds on nm in length, but this difference is reduced to only 10-20 °C in samples with small H-phase precipitates. The changes in the transformation temperatures are consistent with the differences in the precipitate distributions between the two alloy systems observed by TEM.

  14. Microstructural investigations of Ni and Ni2Al3 coatings exposed in biomass power plants

    DEFF Research Database (Denmark)

    Wu, D. L.; Dahl, K. V.; Christiansen, T. L.

    2018-01-01

    The present work investigates the corrosion resistance of Ni and Ni2Al3 coated austenitic stainless steel (TP347H) tubes, which were exposed in a biomass-fired boiler with an outlet steam temperature of 540 °C for 6757 h. The Ni2Al3 coating was produced by electroplating Ni followed by low...... temperature pack cementation. After exposure, microstructural investigations were performed by light optical and electron microscopy (SEM-EDS). Electroplated Ni coatings were not protective in straw firing power plants and exhibited similar corrosion morphology as uncoated tubes. For Ni2Al3 coatings...

  15. NiCo-lead zirconium titanate-NiCo trilayered magnetoelectric composites prepared by electroless deposition

    International Nuclear Information System (INIS)

    Zhou, M. H.; Wang, Y. G.; Bi, K.; Fan, H. P.; Zhao, Z. S.

    2015-01-01

    The NiCo layers with various Ni/Co atomic ratio have been successfully electroless deposited on PZT layers by varying the bath composition. As the cobalt atomic ratio in the deposited layer increases from 17.2 to 54.8 wt%, the magnetostrictive coefficient decreases. The magnetoelectric effect depends strongly on the magnetostrictive properties of magnetostrictive phase. The magnetoelectric coefficient of NiCo/PZT/NiCo trilayers increases with Ni/Co atomic ratio of the deposited NiCo layers increasing from 45:55 to 83:17. A maximum ME voltage coefficient of α E,31 = 2.8 V ⋅ cm −1 ⋅ Oe −1 is obtained at a frequency of about 88 kHz, which makes these trilayers suitable for applications in actuators, transducers and sensors

  16. PRECIPITATION HARDENING IN B2-ORDERED NiAl BY Ni2AlTiCOMPOUND

    Institute of Scientific and Technical Information of China (English)

    W.H. Tian; K. Ohishi; M. Nemoto

    2001-01-01

    Microstructural variations and correlated hardness changes in B2-ordered NiAl containing fine precipitation of Ni2AlTi have been investigated by means of transmission electron microscopy (TEM) and hardness tests. The amount of age hardening is not large as compared to the large microstructural variations during aging. TEM observations have revealed that the L21-type Ni2AlTi precipitates keep a lattice coherency with the NiAl matrix at the beginning of aging. By longer periods of aging Ni2AlTi precipitates lose their coherency and change their morphology to the globular ones surrounded by misfit dislocations. The temperature dependence of the yield strength of precipitate-containing B2-ordered NiAl was investigated by compression tests over the temperature range of 873-1273K. The fine precipitation of Ni2AlTi was found to enhance greatly the yield strength and the high-temperature strength is comparison with that of superalloy Mar-M200.``

  17. Controlled growth of Ni/NiO core–shell nanoparticles: Structure, morphology and tuning of magnetic properties

    Energy Technology Data Exchange (ETDEWEB)

    D’Addato, S., E-mail: sergio.daddato@unimore.it [CNR-NANO, S3, via G. Campi 213/a, Modena (Italy); Dipartimento FIM, Università di Modena e Reggio Emilia, via G. Campi 213/a, Modena (Italy); Spadaro, M.C. [CNR-NANO, S3, via G. Campi 213/a, Modena (Italy); Dipartimento FIM, Università di Modena e Reggio Emilia, via G. Campi 213/a, Modena (Italy); Luches, P. [CNR-NANO, S3, via G. Campi 213/a, Modena (Italy); Grillo, V. [CNR-NANO, S3, via G. Campi 213/a, Modena (Italy); CNR-IMEM, Parco Area delle Scienze 37/A, 43100 Parma (Italy); Frabboni, S.; Valeri, S. [CNR-NANO, S3, via G. Campi 213/a, Modena (Italy); Dipartimento FIM, Università di Modena e Reggio Emilia, via G. Campi 213/a, Modena (Italy); Ferretti, A.M.; Capetti, E.; Ponti, A. [CNR-ISTM, Laboratorio di Nanotecnologie, via G. Fantoli 16/15, 20138 Milano (Italy)

    2014-07-01

    We performed a detailed study of Ni/NiO core–shell nanoparticles (NP) obtained with a gas aggregation source. The NP oxide shells were produced by oxidizing the NP with different procedures: deposition in oxygen atmosphere, post-annealing in air, sequential deposition of (a) first NiO layer, (b) Ni NP and (c) third NiO Layer. X-ray photoelectron spectroscopy from Ni 2p core-level gave information about the chemical state of Ni in the core and in the oxide shell, while scanning electron microscopy was used for investigation of the NP morphology. High quality scanning transmission electron microscopy in high angle annular dark field mode data demonstrated core–shell structure also for NiO/Ni NP/NiO samples. Field-cooled/zero-field-cooled magnetization curves and field-cooled isothermal hysteresis cycles at T = 5 K were recorded by a SQUID magnetometer. In this way, the relation between magnetic properties and oxide shell structure was assessed, showing the role played by the control of the formation of oxide on the exchange bias and interparticle magnetic interaction.

  18. Controlled growth of Ni/NiO core–shell nanoparticles: Structure, morphology and tuning of magnetic properties

    International Nuclear Information System (INIS)

    D’Addato, S.; Spadaro, M.C.; Luches, P.; Grillo, V.; Frabboni, S.; Valeri, S.; Ferretti, A.M.; Capetti, E.; Ponti, A.

    2014-01-01

    We performed a detailed study of Ni/NiO core–shell nanoparticles (NP) obtained with a gas aggregation source. The NP oxide shells were produced by oxidizing the NP with different procedures: deposition in oxygen atmosphere, post-annealing in air, sequential deposition of (a) first NiO layer, (b) Ni NP and (c) third NiO Layer. X-ray photoelectron spectroscopy from Ni 2p core-level gave information about the chemical state of Ni in the core and in the oxide shell, while scanning electron microscopy was used for investigation of the NP morphology. High quality scanning transmission electron microscopy in high angle annular dark field mode data demonstrated core–shell structure also for NiO/Ni NP/NiO samples. Field-cooled/zero-field-cooled magnetization curves and field-cooled isothermal hysteresis cycles at T = 5 K were recorded by a SQUID magnetometer. In this way, the relation between magnetic properties and oxide shell structure was assessed, showing the role played by the control of the formation of oxide on the exchange bias and interparticle magnetic interaction.

  19. The large magnetoelectric effect in Ni-lead zirconium titanate-Ni trilayers derived by electroless deposition

    International Nuclear Information System (INIS)

    Bi, K; Wang, Y G; Wu, W; Pan, D A

    2010-01-01

    Magnetoelectric (ME) Ni-lead zirconium titanate-Ni trilayers with neither electrodes nor bonding layers have been derived by electroless deposition. The structure and magnetic properties of the electroless deposited Ni layers with different pH values are characterized by x-ray diffraction and vibrating sample magnetometer. The influence of the bias magnetic field and the magnetic field frequency (f) on ME coupling is discussed. It is seen that α E,31 depends strongly on H dc and f. The value of the ME coefficient increases as the thickness of the Ni layer and the pH of the bath increase. A maximum of the ME voltage coefficient α E,31 = 5.77 V cm -1 Oe -1 at resonance frequency with a deposited Ni layer thickness t Ni = 302 μm is obtained. The large ME coefficient makes these Ni-PZT-Ni trilayers suitable for applications in sensors, actuators and transducers. (fast track communication)

  20. Electrochemical Properties of Hydrogen-Storage Alloys ZrMn{sub 2}Ni{sub x} and ZrMnNi{sub 1+x} for Ni-MH Secondary Battery

    Energy Technology Data Exchange (ETDEWEB)

    Park, Hye Ryoung [Faculty of Applied Chemistry, Chonnam National University, Kwangju (Korea); Kwon, Ik Hyun [Automobile High-Technology Research Institute, Division of Advanced Materials Engineering, Chonbuk National University, Chonju (Korea)

    2001-04-01

    In order to improve the performance of AB{sub 2}-type hydrogen-storage alloys for Ni-MH secondary battery, AB{sub 2}-type alloys, ZrMn{sub 2}Ni{sub x}(x=0.0, 0.3, 0.6, 0.9 and 1.2) and ZrMnNi{sub 1+x}(x=0.0, 0.1, 0.2, 0.3 and 0.4) were prepared as the Zr-Mn-Ni three component alloys. The hydrogen-storage and the electrochemical properties were investigated. The C14 Laves phase formed in all alloys of ZrMn{sub 2}Ni{sub x}(x=0.0 {approx} 1.2). The equilibrium plateau pressure of the alloy, ZrMn{sub 2}Ni{sub 0.6}-H{sub 2} system, was about 0.5 atm at 30 degree C. Among these alloys, ZrMn{sub 2}Ni{sub 0.6} was the easiest to activate, and it had the largest discharge capacity as well as the best cycling performance. The C14 Laves phase also formed in all alloys of ZrMnNi{sub 1+x}(x=0.0 {approx} 0.4). The equilibrium plateau pressure of the alloy, ZrMnNi{sub 1.0}-H{sub 2} system, was about 0.45 atm at 30 degree C. Among these alloys, ZrMnNi{sub 1.0} was the easiest to activate, taking only 3 charge-discharge cycles, and it had the largest discharge capacity of 42 mAh/g. Among these alloys, ZrMn{sub 2}Ni{sub x}(x=0.0 {approx} 1.2) and ZrMnNi{sub 1+x}(x=0.0 {approx} 0.4), ZrMnNi{sub 1.0} had the largest discharge capacity (maximum value of 42 mAh/g), and it showed the fastest activation and good cycling performance. 23 refs., 4 figs., 2 tabs.

  1. Cavitation resistance of surface composition "Steel-Ni-TiNi-TiNiZr-cBNCo", formed by High-Velocity Oxygen-Fuel spraying

    Science.gov (United States)

    Blednova, Zh. M.; Dmitrenko, D. V.; Balaev, E. U. O.

    2018-01-01

    The object of the study is a multilayered surface composition "Steel - a Multicomponent material with Shape Memory Effect - a wear-resistant layer" under conditions of cavitation effects in sea water. Multicomponent TiNi-based coatings with addition of alloying elements such as Zr in an amount up to 10% mass, allow to create a composite material with a gradient of properties at the interface of layers, which gives new properties to coatings and improves their performance significantly. The use of materials with shape memory effect (SME) as surface layers or in the composition of surface layered compositions allows to provide an effective reaction of materials to the influence of external factors and adaptation to external influences. The surface composite layer cBN-10%Co has high hardness and strength, which ensures its resistance to shock cyclic influences of collapsing caverns. The increased roughness of the surface of a solid surface composite in the form of strong columnar structures ensures the crushing of vacuum voids, redistributing their effect on the entire surface, and not concentrating them in certain zones. In addition, the gradient structure of the multilayer composite coating TiNi-Ti33Ni49Zr18-cBN-10%Co Co makes it possible to create conditions for the relaxation of stresses created by the variable impact load of cavitation caverns and the manifestation of compensating internal forces due to thermo-elastic martensitic transformations of SME materials. The cavitation resistance of the coating TiNi-Ti33Ni49Zr18-cBN-10%Co according to the criterion of mass wear is 15-20 times higher than that of the base material without coating and 10-12 times higher than that of the TiNi-TiNiZr coating. The proposed architecture of the multifunctional gradient composition, "steel-Ni-TiNi- Ti33Ni49Zr18-cBN-10%Co", each layer of which has its functional purpose, allows to increase the service life of parts operating under conditions of cavitation-fatigue loading in

  2. Decay of 57Ni

    International Nuclear Information System (INIS)

    Santos Scardino, A.M. dos.

    1987-01-01

    The decay of 57 Ni to 57 Co was studied by gamma ray spectroscopy using both singles and coincidence spectra. The sources were obtained with the 58 Ni (Y,n) 57 Ni reaction. Natural metallic nickel was irradiated in the bremsstrahluhng beam of the linear accelerator of the Instituto de Fisica da Universidade de Sao Paulo with 30 MeV electrons. The singles espectra were taken with 104 cc HPGe detector and the coincidences espectra with 27 and 53cc Ge(Li) and 104 cc. HPGe detectors. The energies of transitions that follow the 57 Ni decay were measured using 56 Co as standard (which was obtained by (Y,np) reaction in 58 Ni) and taking into account the cascade cross-over relations. (author) [pt

  3. Development of small-scale electroplating system for Ni-63 electroplating onto Ni foil

    International Nuclear Information System (INIS)

    Kim, Jin Joo; Choi, Sang Mu; Son, Kwang Jae; Hong, Jintae

    2016-01-01

    Betavoltaic battery is a device that converts the decay energy of beta-emitting radioisotopes into electric energy. Ni-63 is pure betaemitter with a low energy spectrum and significantly long half-life of 100.1 years and thus is widely used as the power source of betavoltaic battery. There are several methods for the formation of a Ni deposit onto a semiconductor such as electroplating, electroless plating, and chemical vapor deposition. In this study, small-scale radioisotope electroplating system was designed and fabricated to perform electroplating with a small amount of plating buffer and minimum exposure of radioactive materials. These procedures and the manufactured electroplating device can be applied to radioactive Ni-63 electroplating for the fabrication of a betavoltaic battery. In this study, an electroplating system for small-scale Ni electroplating was designed and manufactured. The process for the fabrication of a Ni-63 foil as the energy source of a betavoltaic battery was developed using the minimum concentration of Ni. These procedures and the manufactured electroplating device can be applied to radioactive Ni-63 electroplating for the fabrication of a betavoltaic battery

  4. Development of small-scale electroplating system for Ni-63 electroplating onto Ni foil

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin Joo; Choi, Sang Mu; Son, Kwang Jae; Hong, Jintae [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    Betavoltaic battery is a device that converts the decay energy of beta-emitting radioisotopes into electric energy. Ni-63 is pure betaemitter with a low energy spectrum and significantly long half-life of 100.1 years and thus is widely used as the power source of betavoltaic battery. There are several methods for the formation of a Ni deposit onto a semiconductor such as electroplating, electroless plating, and chemical vapor deposition. In this study, small-scale radioisotope electroplating system was designed and fabricated to perform electroplating with a small amount of plating buffer and minimum exposure of radioactive materials. These procedures and the manufactured electroplating device can be applied to radioactive Ni-63 electroplating for the fabrication of a betavoltaic battery. In this study, an electroplating system for small-scale Ni electroplating was designed and manufactured. The process for the fabrication of a Ni-63 foil as the energy source of a betavoltaic battery was developed using the minimum concentration of Ni. These procedures and the manufactured electroplating device can be applied to radioactive Ni-63 electroplating for the fabrication of a betavoltaic battery.

  5. Layering and temperature-dependent magnetization and anisotropy of naturally produced Ni/NiO multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Pappas, S. D.; Trachylis, D.; Velgakis, M. J. [Laboratory of High-Tech Materials, School of Engineering, University of Patras, 26504 Patras (Greece); Kapaklis, V.; Joensson, P. E.; Papaioannou, E. Th. [Department of Physics and Astronomy, Uppsala University, Box 516, SE-751 20 Uppsala (Sweden); Delimitis, A. [Chemical Process Engineering Research Institute (CPERI), Centre for Research and Technology Hellas (CERTH), 57001 Thermi, Thessaloniki (Greece); Poulopoulos, P. [Laboratory of High-Tech Materials, School of Engineering, University of Patras, 26504 Patras (Greece); Institut fuer Experimentalphysik, Freie Universitaet Berlin, Arnimallee 14, D-14195 Berlin-Dahlem (Germany); Materials Science Department, University of Patras, 26504 Patras (Greece); Fumagalli, P. [Institut fuer Experimentalphysik, Freie Universitaet Berlin, Arnimallee 14, D-14195 Berlin-Dahlem (Germany); Politis, C. [Laboratory of High-Tech Materials, School of Engineering, University of Patras, 26504 Patras (Greece); Department of Materials Science and Engineering, University of Texas at Arlington, Arlington, Texas 76019 (United States)

    2012-09-01

    Ni/NiO multilayers were grown by magnetron sputtering at room temperature, with the aid of the natural oxidation procedure. That is, at the end of the deposition of each single Ni layer, air is let to flow into the vacuum chamber through a leak valve. Then, a very thin NiO layer ({approx}1.2 nm) is formed. Simulated x-ray reflectivity patterns reveal that layering is excellent for individual Ni-layer thickness larger than 2.5 nm, which is attributed to the intercalation of amorphous NiO between the polycrystalline Ni layers. The magnetization of the films, measured at temperatures 5-300 K, has almost bulk-like value, whereas the films exhibit a trend to perpendicular magnetic anisotropy (PMA) with an unusual significant positive interface anisotropy contribution, which presents a weak temperature dependence. The power-law behavior of the multilayers indicates a non-negligible contribution of higher order anisotropies in the uniaxial anisotropy. Bloch-law fittings for the temperature dependence of the magnetization in the spin-wave regime show that the magnetization in the multilayers decreases faster as a function of temperature than the one of bulk Ni. Finally, when the individual Ni-layer thickness decreases below 2 nm, the multilayer stacking vanishes, resulting in a dramatic decrease of the interface magnetic anisotropy and consequently in a decrease of the perpendicular magnetic anisotropy.

  6. Ni4Ti3 precipitate structures in Ni-rich NiTi shape memory alloys

    Czech Academy of Sciences Publication Activity Database

    Holec, David; Bojda, Ondřej; Dlouhý, Antonín

    2008-01-01

    Roč. 481, Sp. Iss. (2008), s. 462-465 ISSN 0921-5093. [ESOMAT 2006. Bochum, 10.09.2006-15.09.2006] R&D Projects: GA ČR(CZ) GA106/05/0918 Institutional research plan: CEZ:AV0Z20410507 Keywords : NiTi shape memory alloys * Ni4Ti3 precipitates * Multi-step martensitic transformations Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.806, year: 2008

  7. Photoelectrochemical Water Splitting Properties of Ti-Ni-Si-O Nanostructures on Ti-Ni-Si Alloy

    Directory of Open Access Journals (Sweden)

    Ting Li

    2017-10-01

    Full Text Available Ti-Ni-Si-O nanostructures were successfully prepared on Ti-1Ni-5Si alloy foils via electrochemical anodization in ethylene glycol/glycerol solutions containing a small amount of water. The Ti-Ni-Si-O nanostructures were characterized by field-emission scanning electron microscopy (FE-SEM, energy dispersive spectroscopy (EDS, X-ray diffraction (XRD, and diffuse reflectance absorption spectra. Furthermore, the photoelectrochemical water splitting properties of the Ti-Ni-Si-O nanostructure films were investigated. It was found that, after anodization, three different kinds of Ti-Ni-Si-O nanostructures formed in the α-Ti phase region, Ti2Ni phase region, and Ti5Si3 phase region of the alloy surface. Both the anatase and rutile phases of Ti-Ni-Si-O oxide appeared after annealing at 500 °C for 2 h. The photocurrent density obtained from the Ti-Ni-Si-O nanostructure photoanodes was 0.45 mA/cm2 at 0 V (vs. Ag/AgCl in 1 M KOH solution. The above findings make it feasible to further explore excellent photoelectrochemical properties of the nanostructure-modified surface of Ti-Ni-Si ternary alloys.

  8. Photoelectrochemical Water Splitting Properties of Ti-Ni-Si-O Nanostructures on Ti-Ni-Si Alloy.

    Science.gov (United States)

    Li, Ting; Ding, Dongyan; Dong, Zhenbiao; Ning, Congqin

    2017-10-31

    Ti-Ni-Si-O nanostructures were successfully prepared on Ti-1Ni-5Si alloy foils via electrochemical anodization in ethylene glycol/glycerol solutions containing a small amount of water. The Ti-Ni-Si-O nanostructures were characterized by field-emission scanning electron microscopy (FE-SEM), energy dispersive spectroscopy (EDS), X-ray diffraction (XRD), and diffuse reflectance absorption spectra. Furthermore, the photoelectrochemical water splitting properties of the Ti-Ni-Si-O nanostructure films were investigated. It was found that, after anodization, three different kinds of Ti-Ni-Si-O nanostructures formed in the α-Ti phase region, Ti₂Ni phase region, and Ti₅Si₃ phase region of the alloy surface. Both the anatase and rutile phases of Ti-Ni-Si-O oxide appeared after annealing at 500 °C for 2 h. The photocurrent density obtained from the Ti-Ni-Si-O nanostructure photoanodes was 0.45 mA/cm² at 0 V (vs. Ag/AgCl) in 1 M KOH solution. The above findings make it feasible to further explore excellent photoelectrochemical properties of the nanostructure-modified surface of Ti-Ni-Si ternary alloys.

  9. Nanostructure analysis of friction welded Pd-Ni-P/Pd-Cu-Ni-P metallic glass interface

    International Nuclear Information System (INIS)

    Ohkubo, T.; Shoji, S.; Kawamura, Y.; Hono, K.

    2005-01-01

    Friction welded Pd 40 Ni 40 P 20 /Pd 40 Cu 30 Ni 10 P 20 metallic glass interface has been characterized by energy filtering transmission electron microscopy. The interface is fully amorphous with a gradual compositional change of Cu and Ni in the range of 30 nm. By annealing above T g , the interdiffusion of Cu and Ni progressed in the supercooled liquid region, and the crystallization occurred from the Pd 40 Ni 40 P 20 glass

  10. Ni3d-Gd4f correlation effects on the magnetic behaviour of GdNi

    Energy Technology Data Exchange (ETDEWEB)

    Paulose, P L [Tata Inst. of Fundamental Research, Bombay (India); Patil, Sujata [Tata Inst. of Fundamental Research, Bombay (India); Mallik, R [Tata Inst. of Fundamental Research, Bombay (India); Sampathkumaran, E V [Tata Inst. of Fundamental Research, Bombay (India); Nagarajan, V [Tata Inst. of Fundamental Research, Bombay (India)

    1996-07-01

    The results of magnetization and heat-capacity measurements on the alloys, Gd{sub 1-x}Y{sub x}Ni (x=0.0, 0.25, 0.5, 0.75 and 0.9) are reported. The data suggest that there is a Gd induced magnetic moment on Ni, which may in turn enhance Gd-Gd exchange interaction strength in GdNi. The induced moment (on Ni) apparently exhibits itinerant ferromagnetism in the magnetically ordered state of GdNi. (orig.).

  11. Ni-Ni ion pair excitation transfer in D sub(3h) symmetry

    International Nuclear Information System (INIS)

    Terrile, M.C.

    1990-01-01

    The mechanisms contributing to excitation transfer are examined for Ni-Ni ion pairs in order to explain the delocalized character of electronic excitations observed in CsNiF sub(3). Using both first-and second-order perturbation theory and from symmetry arguments, the kind of interactions giving matrix elements between states connecting different sites for the position of the excitation are discussed. (author)

  12. Study of the magnetic anisotropy in Ni/Cu and Ni/glass thin films

    International Nuclear Information System (INIS)

    Cherif, S.-M.; Layadi, A.; Ben Youssef, J.; Nacereddine, C.; Roussigne, Y.

    2007-01-01

    The magnetic properties of evaporated Ni/Cu and Ni/glass thin films have been investigated by means of the vibrating sample magnetometer (VSM), the Brillouin light scattering (BLS) and magnetic force microscopy (MFM). The Ni thickness, t, ranges from 31 to 165 nm. The second- and fourth-order magnetic anisotropy constants, K 1 and K 2 , have been included; for the Ni/Cu series, K 1 was found to decrease from 1.0x10 6 to 0.18x10 6 erg/cm 3 as t increases from 31 to 165 nm, while K 2 increased from 0.24x10 6 to 0.8x10 6 erg/cm 3 . Over all the thickness range, the magnetization easy axis is in plane. For thinner films, there is a good agreement between anisotropy constant values inferred from VSM and BLS. Stripe domains were observed for t≥165 nm in Ni/glass and t≥90 nm in Ni/Cu

  13. Continuum mechanics simulations of NiO/Ni-YSZ composites during reduction and re-oxidation

    DEFF Research Database (Denmark)

    Pihlatie, Mikko; Frandsen, Henrik Lund; Kaiser, Andreas

    2010-01-01

    for the dimensional change arises from the volumetric change related to the phase change NiO ↔ Ni. The measurable change in bulk length is given by the ceramic YSZ backbone as a response to the stress created by the chemical strain. The different subprocesses described in the model for YSZ were elastic and anelastic...... expansion, diffusional creep, grain boundary sliding (GBS) and microcracking due to excessive stress. In the Ni/NiO phase, nonelastic strains in terms of diffusional and power law creep were implemented, and additionally for NiO deformation due to microcracking and/or pseudoplasticity. Semi...

  14. NiCo-lead zirconium titanate-NiCo trilayered magnetoelectric composites prepared by electroless deposition

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, M. H.; Wang, Y. G.; Bi, K., E-mail: bike@bupt.edu.cn [State Key Laboratory of Information Photonics and Optical Communications and School of Science, Beijing University of Posts and Telecommunications, Beijing 100876 (China); Fan, H. P. [School of Mechanical and Electrical Engineering, Qingdao Technological University Qindao College, Qingdao 266106 (China); Zhao, Z. S. [Shandong Engineering Consulting Institute, Jinan 250013 (China)

    2015-04-15

    The NiCo layers with various Ni/Co atomic ratio have been successfully electroless deposited on PZT layers by varying the bath composition. As the cobalt atomic ratio in the deposited layer increases from 17.2 to 54.8 wt%, the magnetostrictive coefficient decreases. The magnetoelectric effect depends strongly on the magnetostrictive properties of magnetostrictive phase. The magnetoelectric coefficient of NiCo/PZT/NiCo trilayers increases with Ni/Co atomic ratio of the deposited NiCo layers increasing from 45:55 to 83:17. A maximum ME voltage coefficient of α{sub E,31} = 2.8 V ⋅ cm{sup −1} ⋅ Oe{sup −1} is obtained at a frequency of about 88 kHz, which makes these trilayers suitable for applications in actuators, transducers and sensors.

  15. Microstructural evolution of Ni40Zr60 alloy during early stage of mechanical alloying of intermetallic compounds NiZr2 and Ni11Zr9

    International Nuclear Information System (INIS)

    Lee Peeyew; Koch, C.C.

    1994-01-01

    The microstructural change of Ni 40 Zr 60 alloy during mechanical alloying of mixtures of the intermetallic compounds NiZr 2 and Ni 11 Zr 9 has been studied by transmission electron microscopy. A specific ''cauliflower'' phase was formed during early stage of mechanical alloying process. It is suggested that the solid state reaction between intermetallic compounds NiZr 2 and Ni 11 Zr 9 is not the only origin for the formation of the ''cauliflower'' phase. ((orig.))

  16. Impact of Interstitial Ni on the Thermoelectric Properties of the Half-Heusler TiNiSn

    Directory of Open Access Journals (Sweden)

    Sonia A. Barczak

    2018-03-01

    Full Text Available TiNiSn is an intensively studied half-Heusler alloy that shows great potential for waste heat recovery. Here, we report on the structures and thermoelectric properties of a series of metal-rich TiNi1+ySn compositions prepared via solid-state reactions and hot pressing. A general relation between the amount of interstitial Ni and lattice parameter is determined from neutron powder diffraction. High-resolution synchrotron X-ray powder diffraction reveals the occurrence of strain broadening upon hot pressing, which is attributed to the metastable arrangement of interstitial Ni. Hall measurements confirm that interstitial Ni causes weak n-type doping and a reduction in carrier mobility, which limits the power factor to 2.5–3 mW m−1 K−2 for these samples. The thermal conductivity was modelled within the Callaway approximation and is quantitively linked to the amount of interstitial Ni, resulting in a predicted value of 12.7 W m−1 K−1 at 323 K for stoichiometric TiNiSn. Interstitial Ni leads to a reduction of the thermal band gap and moves the peak ZT = 0.4 to lower temperatures, thus offering the possibility to engineer a broad ZT plateau. This work adds further insight into the impact of small amounts of interstitial Ni on the thermal and electrical transport of TiNiSn.

  17. Synthesis of microporous Ni/NiO nanoparticles with enhanced microwave absorption properties

    International Nuclear Information System (INIS)

    Liu, Tong; Pang, Yu; Xie, Xiubo; Qi, Wen; Wu, Ying; Kobayashi, Satoru; Zheng, Jie; Li, Xingguo

    2016-01-01

    The fabrication of microporous metal materials with many potential applications is challenging due to their high chemical activities and the difficulty in controlling the pore size. By adjusting the reaction condition and the composition of the Ni–Al nanoparticle precursor, we have successfully produced the microporous Ni nanoparticles (NPs) of 22 nm by chemical dealloying method. During the passivation process, the microporous Ni NPs covered with NiO shell are generated as the result of surface oxidation. The micropores range from 0.6 to 1.2 nm in diameter with a large surface area of 68.9 m"2/g. Due to the elimination of Al atoms during dealloying process, the crystalline size of the microporous Ni NPs is sharply decreased to 2–5 nm. The specific architecture offers the microporous Ni/NiO NPs a small microwave reflection coefficient (RC) and a wide absorption bandwidth (RC ≤ −10 dB) of −49.1 dB and 5.8 GHz, much better than the nonporous counterpart of −24.1 dB and 3.7 GHz. The enhanced microwave absorption performance has been interpreted in terms of the micropore structure, core/shell structure and nanostructure effects. - Highlights: • Microporous Ni/NiO nanoparticles are prepared by chemical dealloying method. • They possess micropores of 0.6–1.2 nm with a surface area of 68.9 m"2/g. • They show minimum microwave reflection coefficient of −49.1 dB and bandwidth of 5.8 GHz. • Microwave absorption mechanism is explained by micropore and core/shell structures.

  18. Synthesis of microporous Ni/NiO nanoparticles with enhanced microwave absorption properties

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Tong, E-mail: tongliu@buaa.edu.cn [Key Laboratory of Aerospace Materials and Performance (Ministry of Education), School of Materials Science and Engineering, Beihang University, No.37 Xueyuan Road, Beijing, 100191 (China); Pang, Yu; Xie, Xiubo [Key Laboratory of Aerospace Materials and Performance (Ministry of Education), School of Materials Science and Engineering, Beihang University, No.37 Xueyuan Road, Beijing, 100191 (China); Qi, Wen; Wu, Ying [China Iron & Steel Research Institute Group, Advanced Technology & Materials Co., Ltd, No.76 Xueyuannanlu, Haidian District, Beijing, 100081 (China); Kobayashi, Satoru [Faculty of Engineering, Iwate University, Ueda, Morioka, 020-8551 (Japan); Zheng, Jie; Li, Xingguo [Beijing National Laboratory for Molecular Sciences (BNLMS), The State Key Laboratory of Rare Earth Materials Chemistry and Applications, College of Chemistry and Molecular Engineering, Peking University, Beijing, 100871 (China)

    2016-05-15

    The fabrication of microporous metal materials with many potential applications is challenging due to their high chemical activities and the difficulty in controlling the pore size. By adjusting the reaction condition and the composition of the Ni–Al nanoparticle precursor, we have successfully produced the microporous Ni nanoparticles (NPs) of 22 nm by chemical dealloying method. During the passivation process, the microporous Ni NPs covered with NiO shell are generated as the result of surface oxidation. The micropores range from 0.6 to 1.2 nm in diameter with a large surface area of 68.9 m{sup 2}/g. Due to the elimination of Al atoms during dealloying process, the crystalline size of the microporous Ni NPs is sharply decreased to 2–5 nm. The specific architecture offers the microporous Ni/NiO NPs a small microwave reflection coefficient (RC) and a wide absorption bandwidth (RC ≤ −10 dB) of −49.1 dB and 5.8 GHz, much better than the nonporous counterpart of −24.1 dB and 3.7 GHz. The enhanced microwave absorption performance has been interpreted in terms of the micropore structure, core/shell structure and nanostructure effects. - Highlights: • Microporous Ni/NiO nanoparticles are prepared by chemical dealloying method. • They possess micropores of 0.6–1.2 nm with a surface area of 68.9 m{sup 2}/g. • They show minimum microwave reflection coefficient of −49.1 dB and bandwidth of 5.8 GHz. • Microwave absorption mechanism is explained by micropore and core/shell structures.

  19. Effect of Ni content on the morphological evolution of Ni-YSZ solid oxide fuel cell electrodes

    Science.gov (United States)

    Chen-Wiegart, Yu-chen Karen; Kennouche, David; Scott Cronin, J.; Barnett, Scott A.; Wang, Jun

    2016-02-01

    The coarsening of Ni in Ni-yttria-stabilized zirconia (YSZ) anodes is a potential cause of long term solid oxide fuel cells (SOFC) performance degradation. The specifics of the Ni-YSZ structure—including Ni/YSZ ratio, porosity, and particle size distributions—are normally selected to minimize anode polarization resistance, but they also impact long-term stability. A better understanding of how these factors influence long-term stability is important for designing more durable anodes. The effect of structural details, e.g., Ni-YSZ ratio, on Ni coarsening has not been quantified. Furthermore, prior measurements have been done by comparing evolved structures with control samples, such that sample-to-sample variations introduce errors. Here, we report a four dimensional (three spatial dimensions and time) study of Ni coarsening in Ni-YSZ anode functional layers with different Ni/YSZ ratios, using synchrotron x-ray nano-tomography. The continuous structural evolution was observed and analyzed at sub-100 nm resolution. It is shown quantitatively that increasing the Ni/YSZ ratio increases the Ni coarsening rate. This is due to both increased pore volume and a decrease in the YSZ volume fraction, such that there is more free volume and a less obtrusive YSZ network, both of which allow greater Ni coarsening. The results are shown to be in good agreement with a power-law coarsening model. The finding is critical for informing the design of SOFC electrode microstructures that limit coarsening and performance degradation.

  20. Effects of Bond Coating on NiCrBSi-Mo Composite Functional Coating Properties in Plasma Spraying NiCrBSi-Mo/Ni Coating

    OpenAIRE

    DU Ji-yu; LI Fang-yi; LU Hai-yang; SHANG Jian-tong; LI Zhen

    2017-01-01

    Nickel-based bond coating and composite functional coating were sprayed on leaf blade steel material FV520B successively by using air plasma spraying system. NiCrBSi-Mo powder deposition rate, coating porosity, bonding strength and surface hardness were tested. The results indicate that, for the NiCrBSi-Mo/Ni coating, bond coating with 180-220μm thickness can improve NiCrBSi-Mo powder deposition rate while the surface coating with lower porosity, higher bonding strength and high hardness is p...

  1. A Study on Production of Carbon Nanotubes by CH4 Decomposition over LaNiO3, La4Ni3O10, La3Ni2O7 and La2NiO4

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Carbon nanotubes (CNTs) of narrow size distribution can be abundantly produced in the catalytic decomposition of CH4 over pre-reduced LaNiO3, La4Ni3O10, La3Ni2O7 and La2NiO4.The CNTs obtained were characterized by means of transmission electron microscopy (TEM).Thermal oxidation of CNTs in air was monitored thermogravimetrically (TG). The resultsrevealed that a lower La/Ni ratio of the catalysts would lead to a wider diameter distribution and a higher degree of graphitic nature.

  2. Effect of Ni Core Structure on the Electrocatalytic Activity of Pt-Ni/C in Methanol Oxidation

    Directory of Open Access Journals (Sweden)

    Vladimir Linkov

    2013-07-01

    Full Text Available Methanol oxidation catalysts comprising an outer Pt-shell with an inner Ni-core supported on carbon, (Pt-Ni/C, were prepared with either crystalline or amorphous Ni core structures. Structural comparisons of the two forms of catalyst were made using transmission electron microscopy (TEM, X-ray diffraction (XRD and X-ray photoelectron spectroscopy (XPS, and methanol oxidation activity compared using CV and chronoamperometry (CA. While both the amorphous Ni core and crystalline Ni core structures were covered by similar Pt shell thickness and structure, the Pt-Ni(amorphous/C catalyst had higher methanol oxidation activity. The amorphous Ni core thus offers improved Pt usage efficiency in direct methanol fuel cells.

  3. Hard X-ray MCD in GdNi/sub 5/ and TbNi/sub 5/ single crystals

    CERN Document Server

    Galera, R M

    1999-01-01

    XMCD experiments have been performed at the R L/sub 2,3/ and Ni K- edges on magnetically saturated single crystals of GdNi/sub 5/ and Tb Ni/sub 5/ ferromagnetic compounds. The spectra present huge and well structured dichroic $9 signals at both the R L/sub 2,3/ and the Ni K- edges. Structures from the quadrupolar (2p to 4f) transitions are clearly observed at the R L/sub 2,3/-edges. Though Ni is not magnetic, large intensities, up to 0.4, are measured at the $9 Ni K- edge. The Ni K-edge XMCD shows a three-peak structure which intensities dependent on the rare earth. (7 refs).

  4. Lamellar-crossing-structured Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposite for electrochemical supercapacitor materials

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Qingnan [Department of Chemistry, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, Shanghai 200092 (China); Wen, Ming, E-mail: m_wen@tongji.edu.cn [Department of Chemistry, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, Shanghai 200092 (China); Shanghai Key Lab of Chemical Assessment and Sustainability, Tongji University, Shanghai 200092 (China); Chen, Shipei [Department of Chemistry, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, Shanghai 200092 (China); Wu, Qingsheng [Department of Chemistry, State Key Laboratory of Pollution Control and Resource Reuse, Tongji University, Shanghai 200092 (China); Shanghai Key Lab of Chemical Assessment and Sustainability, Tongji University, Shanghai 200092 (China)

    2015-10-15

    Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} lamellar-crossing-nanostructure with a single lamellar spacing of ∼5 nm was effectively constructed through two-phase-interface reaction process followed by the CNTs crossed among the lamellar-nanostructured Ni(OH){sub 2}. The resultant nanocomposite can offer large active surface areas and short diffusion paths for electrons and ions, and is investigated as a potential pseudocapacitor electrode material for electrochemical energy storage applications. Electrochemical data demonstrate that the as-prepared nanocomposite exhibits a high specific capacitance of ∼1600 F g{sup −1} at the scan rate of 1 mV s{sup −1} in 6 M KOH solution at normal pressure and temperature, which is great higher than Ni(OH){sub 2} (∼1200 F g{sup −1}). Furthermore, Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposite shows a higher energy density (∼125 Wh kg{sup −1}, 2 A g{sup −1}) and has a slightly decrease of 5% in specific capacitance after 1000 continuous charge/discharge cycles. - Graphical abstract: As-constructed Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} lamellar-crossing-nanostructure exhibits remarkable enhancement in electrochemical stability and high specific capacity of ∼1600 F g{sup −1} at a scan rate of 1 mV s{sup −1}, suggesting promising potential for supercapacitor applications. - Highlights: • New designed lamellar-crossing-structured Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposites have been firstly reported in this work. • Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} lamellar-crossing-nanostructures show firm nanostructure and excellent electrochemical stability. • Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposites exhibit excellent specific capacitance. • Ni(OH){sub 2}/CNTs/Ni(OH){sub 2} nanocomposites have the potential application in electrochemical energy storage applications.

  5. Comparative study of NiW, NiMo and MoW prepared by mechanical alloying

    International Nuclear Information System (INIS)

    Gonzalez, G.; Sagarzazu, A.; Villalba, R.; Ochoa, J.

    2007-01-01

    The present work concern the amorphisation process induced by mechanical alloying in the NiW, NiMo and MoW systems. The alloys chosen combine a group of transition elements varying from very similar atomic radius and electronic valences (MoW) to different ones (NiW and NiMo). The three systems achieved an amorphous state after 50 h of milling. The mechanism of amorphisation proposed for NiW and NiMo was the combined effect of an excess concentration of the solute atoms entering into the structure of one of the elements and a critical concentration of defects. Continuous formation of an amorphous phase at the interface of the crystalline phase was observed during the process. MoW seems to amorphize by continuous reduction of grain size down to a critical value where the amorphisation takes place

  6. Fe-solubility of Ni7S6 and Ni9S8: Thermodynamic analysis

    International Nuclear Information System (INIS)

    Waldner, P.

    2011-01-01

    Experimental data on phase equilibria have been used for thermodynamic analysis of the iron solubility of the nickel sulfides Ni 7 S 6 and Ni 9 S 8 . For both compounds, a two-sublattice approach within the framework of the compound energy formalism has been applied to perform Gibbs free energy modelling at 0.1 MPa total pressure consistently embedded in recent thermodynamic assessment studies of other iron-nickel-sulfides. The predicted maxima of iron solubility around 3 at% of Ni 7 S 6 and 5.5 at% of Ni 9 S 8 are confirmed by experimental data. The calculations of complex ternary phase relations with Fe-bearing Ni 7 S 6 and Ni 9 S 8 gain further improvement. The first internally consistent description of all thermodynamically stable phases known in the literature for the iron-nickel-sulfur system is completed.

  7. Flexible bottom-emitting white organic light-emitting diodes with semitransparent Ni/Ag/Ni anode.

    Science.gov (United States)

    Koo, Ja-Ryong; Lee, Seok Jae; Lee, Ho Won; Lee, Dong Hyung; Yang, Hyung Jin; Kim, Woo Young; Kim, Young Kwan

    2013-05-06

    We fabricated a flexible bottom-emitting white organic light-emitting diode (BEWOLED) with a structure of PET/Ni/Ag/Ni (3/6/3 nm)/ NPB (50 nm)/mCP (10 nm)/7% FIrpic:mCP (10 nm)/3% Ir(pq)(2) acac:TPBi (5 nm)/7% FIrpic:TPBi (5 nm)/TPBi (10 nm)/Liq (2 nm)/ Al (100 nm). To improve the performance of the BEWOLED, a multilayered metal stack anode of Ni/Ag/Ni treated with oxygen plasma for 60 sec was introduced into the OLED devices. The Ni/Ag/Ni anode effectively enhanced the probability of hole-electron recombination due to an efficient hole injection into and charge balance in an emitting layer. By comparing with a reference WOLED using ITO on glass, it is verified that the flexible BEWOLED showed a similar or better electroluminescence (EL) performance.

  8. Corrosive sliding wear behavior of laser clad Mo2Ni3Si/NiSi intermetallic coating

    International Nuclear Information System (INIS)

    Lu, X.D.; Wang, H.M.

    2005-01-01

    Many ternary metal silicides such as W 2 Ni 3 Si, Ti 2 Ni 3 Si and Mo 2 Ni 3 Si with the topologically closed-packed (TCP) hP12 MgZn 2 type Laves phase crystal structure are expected to have outstanding wear and corrosion resistance due to their inherent high hardness and sluggish temperature dependence and strong atomic bonds. In this paper, Mo 2 Ni 3 Si/NiSi intermetallic coating was fabricated on substrate of an austenitic stainless steel AISI321 by laser cladding using Ni-Mo-Si elemental alloy powders. Microstructure of the coating was characterized by optical microscopy (OM), scanning electron microscopy (SEM), X-ray diffraction (XRD) and energy dispersive X-ray analysis (EDS). Wear resistance of the coating is evaluated under corrosive sliding wear test condition. Influence of corrosion solutions on the wear resistance of the coating was studied and the wear mechanism was discussed based on observations of worn surface morphology. Results showed that the laser clad Mo 2 Ni 3 Si/NiSi composite coating have a fine microstructure of Mo 2 Ni 3 Si primary dendrites and the interdendritic Mo 2 Ni 3 Si/NiSi eutectics. The coating has excellent corrosive wear resistance compared with austenitic stainless steel AISI321 under acid, alkaline and saline corrosive environments

  9. Modeling and simulation of NiO dissolution and Ni deposition in molten carbonate fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Nam, Suk Woo; Choi, Hyung-Joon; Lim, Tae Hoon [Korea Institute of Science & Technology, Seoul (Korea, Republic of)] [and others

    1996-12-31

    Dissolution of NiO cathode into the electrolyte matrix is an important phenomena limiting the lifetime of molten carbonate fuel cell (MCFC). The dissolved nickel diffuses into the matrix and is reduced by dissolved hydrogen leading to the formation of metallic nickel films in the pores of the matrix. The growth of Ni films in the electrolyte matrix during the continuous cell operation results eventually in shorting between cathode and anode. Various mathematical and empirical models have been developed to describe the NiO dissolution and Ni deposition processes, and these models have some success in estimating the lifetime of MCFC by correlating the amount of Ni deposited in the matrix with shorting time. Since the exact mechanism of Ni deposition was not well understood, deposition reaction was assumed to be very fast in most of the models and the Ni deposition region was limited around a point in the matrix. In fact, formation of Ni films takes place in a rather broad region in the matrix, the location and thickness of the film depending on operating conditions as well as matrix properties. In this study, we assumed simple reaction kinetics for Ni deposition and developed a mathematical model to get the distribution of nickel in the matrix.

  10. Study on the time-domain electromagnetic responses; TDEM ho ni okeru denji oto ni tsuite

    Energy Technology Data Exchange (ETDEWEB)

    Noguchi, K; Endo, M [Waseda University, Tokyo (Japan). School of Science and Engineering

    1997-05-27

    With an objective to perform three-dimensional analysis with high accuracy in using the electromagnetic exploration method, characteristics in electromagnetic response were analyzed, and conditions for acquiring necessary data were discussed. The discussion defined a parameter called `response anomaly` which uses response from media to standardize response only from substances with abnormal resistivity. The receivers were located uniformly on the same plane, and the response anomaly was derived from electromagnetic response from each of the three horizontal and vertical components at each receiving point, which was expressed as a contour map. The parameter for the abnormal body was consisted of location and resistivity contrast with media. Discussions using the contour map were given on the response when these factors for the parameter were varied. As a result, it was found that the response anomaly appears in the form that reflects the abnormal body, and the response anomaly of the horizontal component is superior in terms of being large. It was also referred that, as a requirement for the abnormal body which gives larger impact from the electromagnetic response, the abnormal body should have lower resistivity than that in the media, and resistivity contrast with the media should be greater. 2 refs., 7 figs., 1 tab.

  11. Reduction mechanism of Ni2+ into Ni nanoparticles prepared from ...

    Indian Academy of Sciences (India)

    journal of. March 2009 physics pp. 577–586. Reduction mechanism of Ni2+ into Ni ..... and at high field, no domain wall is available and hence, the system becomes a .... [23] J Ding, T Tsuzuki, P G McCormick and R Street, J. Phys. D: Appl.

  12. Nickel distribution and isotopic fractionation in a Brazilian lateritic regolith: Coupling Ni isotopes and Ni K-edge XANES

    Science.gov (United States)

    Ratié, G.; Garnier, J.; Calmels, D.; Vantelon, D.; Guimarães, E.; Monvoisin, G.; Nouet, J.; Ponzevera, E.; Quantin, C.

    2018-06-01

    Ultramafic (UM) rocks are known to be nickel (Ni) rich and to weather quickly, which makes them a good candidate to look at the Ni isotope systematics during weathering processes at the Earth's surface. The present study aims at identifying the Ni solid speciation and discussing the weathering processes that produce Ni isotope fractionation in two deep laterite profiles under tropical conditions (Barro Alto, Goiás State, Brazil). While phyllosilicates and to a lower extent goethite are the main Ni-bearing phases in the saprolitic part of the profile, iron (Fe) oxides dominate the Ni budget in the lateritic unit. Nickel isotopic composition (δ60Ni values) has been measured in each unit of the regolith, i.e., rock, saprock, saprolite and laterite (n = 52). δ60Ni varies widely within the two laterite profiles, from -0.10 ± 0.05‰ to 1.43 ± 0.05‰, showing that significant Ni isotope fractionation occurs during the weathering of UM rocks. Overall, our results show that during weathering, the solid phase is depleted in heavy Ni isotopes due to the preferential sorption and incorporation of light Ni isotopes into Fe oxides; the same mechanisms likely apply to the incorporation of Ni into phyllosilicates (type 2:1). However, an isotopically heavy Ni pool is observed in the solid phase at the bottom of the saprolitic unit. This feature can be explained by two hypotheses that are not mutually exclusive: (i) a depletion in light Ni isotopes during the first stage of weathering due to the preferential dissolution of light Ni-containing minerals, and (ii) the sorption or incorporation of isotopically heavy Ni carried by percolating waters (groundwater samples have δ60Ni of 2.20 and 2.27‰), that were enriched in heavy Ni isotopes due to successive weathering processes in the overlying soil and laterite units.

  13. Probing the semi-magicity of $^{68}$Ni via the $^{3}$H($^{66}$Ni,$^{68}$Ni)p two-neutron transfer reaction in inverse kinematics

    CERN Multimedia

    Reiter, P; Blazhev, A A; Kruecken, R; Franchoo, S; Mertzimekis, T; Darby, I G; Van de walle, J; Raabe, R; Elseviers, J; Gernhaeuser, R A; Sorlin, O H; Georgiev, G P; Bree, N C F; Habs, D; Chapman, R; Gaudefroy, L; Diriken, J V J; Jenkins, D G; Kroell, T; Axiotis, M; Huyse, M L; Patronis, N

    We propose to perform the two-neutron transfer reaction $^{3}$H($^{66}$Ni, $^{68}$Ni)$p$ using the ISOLDE radioactive ion beam at 2.7 $A$ MeV and the MINIBALL + T-REX setup to characterize the 0$^{+}$ and 2$^{+}$ states in $^{68}$Ni.

  14. Sputtering Yields of Si and Ni from the Ni1-xSix System Studied by Rutherford Backscattering Spectrometry

    Science.gov (United States)

    Kim, Su Chol; Yamaguchi, Satoru; Kataoka, Yoshihide; Iwami, Motohiro; Hiraki, Akio; Satou, Mamoru; Fujimoto, Fuminori

    1982-01-01

    Sputtering yields of Si and Ni from thin layer films of Ni-Si compounds (Ni1-xSix), including the pure materials (Ni and Si), caused by 5 keV Ar+ ion bombardment were investigated using backscattering spectrometry. The sputtering yield for Si from Ni1-xSix increased with increasing Si concentration. However, there is an abrupt decrease in the yield for Si concentrations above NiSi2 to pure Si. This is in clear contrast to the sputtering yield of Ni from Ni1-xSix which increased with increasing Ni concentration monotonously. These results are discussed on the basis of both the difference in the atomic density and the electronic state of the alloy.

  15. Effect of Ni4Ti3 precipitation on martensitic transformation in Ti-Ni

    International Nuclear Information System (INIS)

    Zhou, N.; Shen, C.; Wagner, M.F.-X.; Eggeler, G.; Mills, M.J.; Wang, Y.

    2010-01-01

    Precipitation of Ni 4 Ti 3 plays a critical role in determining the martensitic transformation path and temperature in Ni-Ti shape memory alloys. In this study, the equilibrium shape of a coherent Ni 4 Ti 3 precipitate and the concentration and stress fields around it are determined quantitatively using the phase field method. Most recent experimental data on lattice parameters, elastic constants, precipitate-matrix orientation relationship and thermodynamic database are used as model inputs. The effects of the concentration and stress fields on subsequent martensitic transformations are analyzed through interaction energy between a nucleating martensitic particle and the existing microstructure. Results indicate that R-phase formation prior to B19' phase could be attributed to both direct elastic interaction and stress-induced spatial variation in concentration near Ni 4 Ti 3 precipitates. The preferred nucleation sites for the R-phase are close to the broad side of the lenticular-shaped Ni 4 Ti 3 precipitates, where tension normal to the habit plane is highest, and Ni concentration is lowest.

  16. Study of the magnetic anisotropy in Ni/Cu and Ni/glass thin films

    Energy Technology Data Exchange (ETDEWEB)

    Cherif, S.-M. [Laboratoire PMTM, Institut Galilee, Univeriste Paris 13, Villetaneuse, 93340 (France); Layadi, A. [Departement de Physique, Universite Ferhat Abbas, Setif 19000 (Algeria)]. E-mail: a_layadi@yahoo.fr; Ben Youssef, J. [Laboratoire de Magnetisme de Bretagne, U.B.O., Brest 29238 (France); Nacereddine, C. [Departement de Physique, Universite Ferhat Abbas, Setif 19000 (Algeria); Roussigne, Y. [Laboratoire PMTM, Institut Galilee, Univeriste Paris 13, Villetaneuse, 93340 (France)

    2007-01-01

    The magnetic properties of evaporated Ni/Cu and Ni/glass thin films have been investigated by means of the vibrating sample magnetometer (VSM), the Brillouin light scattering (BLS) and magnetic force microscopy (MFM). The Ni thickness, t, ranges from 31 to 165 nm. The second- and fourth-order magnetic anisotropy constants, K {sub 1} and K {sub 2}, have been included; for the Ni/Cu series, K {sub 1} was found to decrease from 1.0x10{sup 6} to 0.18x10{sup 6} erg/cm{sup 3} as t increases from 31 to 165 nm, while K {sub 2} increased from 0.24x10{sup 6} to 0.8x10{sup 6} erg/cm{sup 3}. Over all the thickness range, the magnetization easy axis is in plane. For thinner films, there is a good agreement between anisotropy constant values inferred from VSM and BLS. Stripe domains were observed for t{>=}165 nm in Ni/glass and t{>=}90 nm in Ni/Cu.

  17. Electrochemical preparation and characteristics of Ni-Co-LaNi{sub 5} composite coatings as electrode materials for hydrogen evolution

    Energy Technology Data Exchange (ETDEWEB)

    Wu Gang; Li Ning; Dai Changsong; Zhou Derui

    2004-02-15

    Electrocatalytic activity for the hydrogen evolution reaction on Ni-Co-LaNi{sub 5} composite electrodes prepared by electrochemical codeposition technique was evaluated. The relationship between the current density for hydrogen evolution reaction and the amount of LaNi{sub 5} particles in Ni-Co baths is like the well-known 'volcano plot'. The Surface morphology and microstructure of Ni-Co-LaNi{sub 5} coatings were determined by means of scanning electron microscopy (SEM) and X-ray diffraction (XRD). The kinetic parameters were determined from electrochemical steady-state Tafel polarization and electrochemical impedance spectroscopy technology in 1 M NaOH solution. The values obtained for the apparent energies of activation are 32.48, 46.29 and 57.03 kJ mol{sup -1} for the Ni-Co-LaNi{sub 5}, Ni-Co and Ni electrodes, respectively. The hydrogen evolution reaction on Ni-Co-LaNi{sub 5} proceeds via Volmer-Tafel reaction route with the mixed rate determining characteristics. The composite coating Ni-Co-LaNi{sub 5} is catalytically more active than Ni and Ni-Co electrodes due to the increase in its real surface areas and the decrease in the apparent free energy of activation caused by the electrocatalytic synergistic effect of the Ni-Co alloys and the hydrogen storage intermetallic particles on the electrode surface.

  18. Compositional and structural characterisation of Ni-phyllosilicates in hydrous silicate type Ni-laterite deposits

    OpenAIRE

    Villanova de Benavent, Cristina

    2015-01-01

    Ni-bearing Mg-phyllosilicates (commonly known as garnierites) are significant ore minerals in many Ni-laterite deposits worldwide. However, the characterisation of these mineral phases is complex, as well as their classification and nomenclature, due to their fine-grained nature, low crystallinity and frequent occurrence as mixtures. The aim of this study is to shed some light to the nature of the Ni-bearing Mg-phyllosilicates occurring at the Falcondo Ni-laterite. In this deposit, these ...

  19. Influence of Ni Solute segregation on the intrinsic growth stresses in Cu(Ni) thin films

    International Nuclear Information System (INIS)

    Kaub, T.M.; Felfer, P.; Cairney, J.M.; Thompson, G.B.

    2016-01-01

    Using intrinsic solute segregation in alloys, the compressive stress in a series of Cu(Ni) thin films has been studied. The highest compressive stress was noted in the 5 at.% Ni alloy, with increasing Ni concentration resulting in a subsequent reduction of stress. Atom probe tomography quantified Ni's Gibbsian interfacial excess in the grain boundaries and confirmed that once grain boundary saturation is achieved, the compressive stress was reduced. This letter provides experimental support in elucidating how interfacial segregation of excess adatoms contributes to the post-coalescence compressive stress generation mechanism in thin films. - Graphical abstract: Cu(Ni) film stress relationship with Ni additions. Atom probe characterization confirms solute enrichment in the boundaries, which was linked to stress response.

  20. Phase Equilibria of the Sn-Ni-Si Ternary System and Interfacial Reactions in Sn-(Cu)/Ni-Si Couples

    Science.gov (United States)

    Fang, Gu; Chen, Chih-chi

    2015-07-01

    Interfacial reactions in Sn/Ni-4.5 wt.%Si and Sn-Cu/Ni-4.5 wt.%Si couples at 250°C, and Sn-Ni-Si ternary phase equilibria at 250°C were investigated in this study. Ni-Si alloys, which are nonmagnetic, can be regarded as a diffusion barrier layer material in flip chip packaging. Solder/Ni-4.5 wt.%Si interfacial reactions are crucial to the reliability of soldered joints. Phase equilibria information is essential for development of solder/Ni-Si materials. No ternary compound is present in the Sn-Ni-Si ternary system at 250°C. Extended solubility of Si in the phases Ni3Sn2 and Ni3Sn is 3.8 and 6.1 at.%, respectively. As more Si dissolves in these phases their lattice constants decrease. No noticeable ternary solubility is observed for the other intermetallics. Interfacial reactions in solder/Ni-4.5 wt.%Si are similar to those for solder/Ni. Si does not alter the reaction phases. No Si solubility in the reaction phases was detected, although rates of growth of the reaction phases were reduced. Because the alloy Ni-4.5 wt.%Si reacts more slowly with solders than pure Ni, the Ni-4.5 wt.%Si alloy could be a potential new diffusion barrier layer material for flip chip packaging.

  1. Exchange bias coupling in NiO/Ni bilayer tubular nanostructures synthetized by electrodeposition and thermal oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Yu, T., E-mail: work_tian@scu.edu.cn [College of Physical Science and Technology, Sichuan University, Chengdu 610064 (China); Zhang, Z.W.; Xu, Y.H. [College of Physical Science and Technology, Sichuan University, Chengdu 610064 (China); Liu, Y. [Analytical & Testing Center, Sichuan University, Chengdu 610064 (China); Li, W.J. [Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, University of Chinese Academy of Sciences, Chinese Academy of Sciences, Beijing 100190 (China); Nie, Y.; Zhang, X. [College of Physical Science and Technology, Sichuan University, Chengdu 610064 (China); Xiang, G., E-mail: gxiang@scu.edu.cn [College of Physical Science and Technology, Sichuan University, Chengdu 610064 (China)

    2017-05-01

    In this paper, we reported the synthesis of NiO/Ni bilayer nanotubes by electrodeposition and thermal oxidation using anodic aluminum oxide templates. The morphology, structure, chemical composition and magnetic properties, especially magnetic exchange bias induced by subsequent magnetic field cooling, in this one-dimensional antiferromagnetic/ferromagnetic hybrid system were investigated. It was found that the effect of the annealing temperature, which mainly dominated the thickness of the NiO layer, and the annealing time, which mainly dominated the grain size of the NiO, on the exchange bias field showed competitive relationship. The optimized exchange bias field was achieved by the combination of the shorter annealing time and higher annealing temperature. - Highlights: • NiO-Ni bilayer tubular nanotubes were fabricated by electrodeposition and thermal oxidation. • The exchange bias effect in NiO-Ni nanotubes was induced by magnetic field cooling. • The competitive effect of annealing temperature and annealing time on the exchange bias coupling was analyzed.

  2. Effects of phase transformation and interdiffusion on the exchange bias of NiFe/NiMn

    International Nuclear Information System (INIS)

    Lai, Chih-Huang; Lien, W. C.; Chen, F. R.; Kai, J. J.; Mao, S.

    2001-01-01

    The correlation between the exchange field of NiFe/NiMn and the phase transformation of NiMn was investigated. Transmission electron microscopy (TEM) dark-field images, contributed by the order phase of NiMn, were used to identify the location and volume fraction of the order phase. TEM selected area diffraction patterns showed the (110) superlattice diffraction rings of NiMn, verifying the existence of the order phase in the annealed samples. The order volume fraction can be calculated by the dark field image contributed by the (110) diffraction. The exchange field increased almost linearly with increasing order volume fraction. Energy dispersive x-ray spectroscopy attached to TEM indicated that Mn diffused into NiFe for annealing at 280 degreeC, leading to a larger coercivity and small coercivity squareness. Part of the NiMn still maintains the paramagnetic phase even after annealing at 280 degreeC. [copyright] 2001 American Institute of Physics

  3. Radioactive 63Ni in biological research

    International Nuclear Information System (INIS)

    Kasprzak, K.S.; Sunderman, F.W. Jr.

    1979-01-01

    Applications of 63 Ni in biological research are reviewed, with emphasis upon recent investigations of nickel metabolism and toxicology in experimental animals. The radiochemistry of 63 Ni is summarized, including consideration of the preparation of certain 63 Ni compounds (e.g. 63 Ni(CO) 4 and 63 Ni 3 S 2 ) that are of current interest in toxicology, teratology and cancer research. Practical guidance is given regarding the detection and determination of 63 Ni in biological materials by autoradiography and liquid scintillation spectrometry. (author)

  4. Effect of Ni content on the morphological evolution of Ni-YSZ solid oxide fuel cell electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Chen-Wiegart, Yu-chen Karen; Kennouche, David; Scott Cronin, J.; Barnett, Scott A.; Wang, Jun

    2016-02-22

    The coarsening of Ni in Ni–yttria-stabilized zirconia (YSZ) anodes is a potential cause of long term solid oxide fuel cells (SOFC) performance degradation. The specifics of the Ni-YSZ structure—including Ni/YSZ ratio, porosity, and particle size distributions—are normally selected to minimize anode polarization resistance, but they also impact long-term stability. A better understanding of how these factors influence long-term stability is important for designing more durable anodes. The effect of structural details, e.g., Ni-YSZ ratio, on Ni coarsening has not been quantified. Furthermore, prior measurements have been done by comparing evolved structures with control samples, such that sample-to-sample variations introduce errors. Here, we report a four dimensional (three spatial dimensions and time) study of Ni coarsening in Ni-YSZ anode functional layers with different Ni/YSZ ratios, using synchrotron x-ray nano-tomography. The continuous structural evolution was observed and analyzed at sub-100 nm resolution. It is shown quantitatively that increasing the Ni/YSZ ratio increases the Ni coarsening rate. This is due to both increased pore volume and a decrease in the YSZ volume fraction, such that there is more free volume and a less obtrusive YSZ network, both of which allow greater Ni coarsening. The results are shown to be in good agreement with a power-law coarsening model. The finding is critical for informing the design of SOFC electrode microstructures that limit coarsening and performance degradation.

  5. Neutron enrichment at midrapidity in 58Ni + 58Ni at 52 MeV/u

    International Nuclear Information System (INIS)

    Theriault, D.; Vallee, A.; Gingras, L.; Larochelle, Y.; Roy, R.; April, A.; Beaulieu, L.; Grenier, F.; Lemieux, F.; Moisan, J.; Samri, M.; Saint-Pierre, C.; Turbide, S.; Yennello, S.J.; Martin, E.; Winchester, E.

    2003-01-01

    By combining data from a charged particle 58 Ni + 58 Ni experiment at 52 MeV/u with an 36 Ar + 58 Ni experiment at 50 MeV/u for which free neutrons have been detected, an increase in the neutron to proton ratio of the whole nuclear material at midrapidity has been experimentally observed in the reaction 58 Ni + 58 Ni at 52 MeV/u. The neutron to proton ratio is measured above the initial neutron to proton ratio of the system. Neutron to proton ratio of the quasi-projectile emission is analysed for the same reactions and is seen to decrease below the ratio of the initial system. (authors)

  6. XRD studies on solid state amorphisation in electroless Ni/P and Ni/B deposits

    International Nuclear Information System (INIS)

    Sampath Kumar, P.; Kesavan Nair, P.

    1996-01-01

    The decomposition of electroless Ni-P and Ni-B deposits on annealing at various temperature is studied using x-ray diffraction techniques employing profile deconvolution and line profile analysis. It appears that solid state amorphisation takes place in the Ni-B deposits in a narrow temperature range just prior to the onset of crystallization of amorphous phase. In the case of Ni-P deposits no evidence for solid state amorphisation could be obtained. Thermodynamic and kinetic considerations also support such a conclusion

  7. Study on the optimal control of the ground thermal storage system in the greenhouse. Part 4; Onshitsu ni okeru taiyo energy dochu chikunetsu system ni okeru saiteki seigyo ni kansuru kenkyu

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, M [Sanko Air Conditioning Co. Ltd., Osaka (Japan); Nakahara, N [Kanagawa University, Yokohama (Japan)

    1996-10-27

    Three types of weight in both energy saving and optimum room temperature environment were changed to obtain the optimal control solution of the ground thermal storage system in a greenhouse. The relation diagram between the optimal solution of a performance function, and the state constraints and control function constraints was created in consideration of the energy term in a control function value area and the room temperature environment. As a result, the whole image of the performance function could be grasped in consideration of the energy term with inequality constraints and the room temperature environmental term in this study. The rate of a weighting factor in the performance function significantly influences the optimal solution. The influence on the optimal solution also changes when the optimal room temperature schedule differs. The influence that three types of rising algorithm exert on the convergence and converging speed was investigated. Superiority or inferiority occurs according to the space properties of a performance function. A zigzag method is most disadvantageous. The constraints can be converged to the optimal solution using an SUMT outer point method irrespective of the initial value. 6 refs., 6 figs., 4 tabs.

  8. Electrochemically induced transformation of NiS nanoparticles into Ni(OH)2 in KOH aqueous solution toward electrochemical capacitors

    International Nuclear Information System (INIS)

    Hou Linrui; Yuan Changzhou; Li Diankai; Yang Long; Shen Laifa; Zhang Fang; Zhang Xiaogang

    2011-01-01

    Highlights: → NiS is synthesized by means of the H 2 O/CS 2 interface under hydrothermal treatment. → NiS itself owns poor electrochemical capacitance in 2 M KOH solution. → NiS is electrochemically induced and transformed into electroactive Ni(OH) 2 . → Ni(OH) 2 is responsible for good energy storage of the NiS in the KOH solution. → The new formed Ni(OH) 2 delivers large energy density at high rates. - Abstract: Nickel sulfide nanoparticles (NPs) are first synthesized by virtue of a unique H 2 O/CS 2 interface under mild hydrothermal treatment. Electrochemical data reveals that the as-synthesized NiS NPs themselves own poor supercapacitive behavior at initial cyclic voltammetry (CV) cycles in 2 M KOH solution, while a specific capacitance of 893 F g -1 can be surprisingly obtained at a current density of 5 A g -1 just after continuous 320 CV cycles. X-ray diffraction and Fourier transform infrared techniques demonstrate that what is really responsible for the good electrochemical capacitance in the KOH aqueous solution is the new electrochemically formed Ni(OH) 2 phase, rather than NiS NPs themselves. The Ni(OH) 2 is slowly formed during the continuous CV cycling process, in which the electrochemically induced phase transformation from NiS to Ni(OH) 2 phase takes place. Furthermore, the new Ni(OH) 2 phase demonstrates the great ability of delivering large specific capacitance at high rates.

  9. Effect of amorphous Mg50Ni50 on hydriding and dehydriding behavior of Mg2Ni alloy

    International Nuclear Information System (INIS)

    Guzman, D.; Ordonez, S.; Fernandez, J.F.; Sanchez, C.; Serafini, D.; Rojas, P.A.; Aguilar, C.; Tapia, P.

    2011-01-01

    Composite Mg 2 Ni (25 wt.%) amorphous Mg 50 Ni 50 was prepared by mechanical milling starting with nanocrystalline Mg 2 Ni and amorphous Mg 50 Ni 50 powders, by using a SPEX 8000 D mill. The morphological and microstructural characterization of the powders was performed via scanning electron microscopy and X-ray diffraction. The hydriding characterization of the composite was performed via a solid gas reaction method in a Sievert's-type apparatus at 363 K under an initial hydrogen pressure of 2 MPa. The dehydriding behavior was studied by differential thermogravimetry. On the basis of the results, it is possible to conclude that amorphous Mg 50 Ni 50 improved the hydriding and dehydriding kinetics of Mg 2 Ni alloy upon cycling. A tentative rationalization of experimental observations is proposed. - Research Highlights: → First study of the hydriding behavior of composite Mg 2 Ni (25 wt.%) amorphous Mg 50 Ni 50 . → Microstructural characterization of composite material using XRD and SEM was obtained. → An improved effect of Mg 50 Ni 50 on the Mg 2 Ni hydriding behavior was verified. → The apparent activation energy for the hydrogen desorption of composite was obtained.

  10. Microstructure and electrochemical characterization of laser melt-deposited Ti2Ni3Si/NiTi intermetallic alloys

    International Nuclear Information System (INIS)

    Dong Lixin; Wang Huaming

    2008-01-01

    Corrosion and wear resistant Ti 2 Ni 3 Si/NiTi intermetallic alloys with Ti 2 Ni 3 Si as the reinforcing phase and the ductile NiTi as the toughening phase were designed and fabricated by the laser melt-deposition manufacturing process. Electrochemical behavior of the alloys was investigated using potentiodynamic polarization testing and electrochemical impedance spectroscopy in an NaOH solution. The results showed that the alloys have outstanding corrosion resistance due to the formation of a protective passive surface film of Ni(OH) 2 as well as the high chemical stability and strong inter-atomic bonds inherent to Ti 2 Ni 3 Si and NiTi intermetallics. The Ti 2 Ni 3 Si content has a significant influence on the microstructure of the alloys but only a slight effect on electrochemical corrosion properties

  11. Precipitation of Ni4Ti3-variants in a polycrystalline Ni-rich NiTi shape memory alloy

    Czech Academy of Sciences Publication Activity Database

    Bojda, Ondřej; Eggeler, G.; Dlouhý, Antonín

    2005-01-01

    Roč. 53, č. 1 (2005), s. 99-104 ISSN 1359-6462 R&D Projects: GA ČR(CZ) GA106/05/0918 Institutional research plan: CEZ:AV0Z20410507 Keywords : NiTi shape memory alloys * Ni4Ti3 precipitation * Transmission electron microscopy Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.228, year: 2005

  12. Rapid synthesis of binary α-NiS–β-NiS by microwave autoclave for rechargeable lithium batteries

    International Nuclear Information System (INIS)

    Idris, Nurul Hayati; Rahman, Md Mokhlesur; Chou, Shu-Lei; Wang Jiazhao; Wexler, David; Liu, Hua-Kun

    2011-01-01

    Highlights: ► NiS has been synthesized by a rapid, one-pot, hydrothermal microwave autoclave method. ► The α-NiS–β-NiS sample synthesized at 160 °C yielded good electrochemical performance in terms of high reversible capacity (320 mAh g −1 at 0.1C up to 100 cycles). ► At high rates, the sample operated at a good fraction of its capacity. - Abstract: To reduce the reaction time, electrical energy consumption, and cost, binary α-NiS–β-NiS has been synthesized by a rapid, one-pot, hydrothermal autoclave microwave method within 15 min at temperatures of 160–180 °C. The microstructure and morphology of the α-NiS–β-NiS products were characterized by means of X-ray diffraction (XRD), field emission scanning electron microscopy (FE-SEM), and transmission electron microscopy (TEM). At 140 °C, pure hexagonal NiAs-type α-NiS phase was identified from the XRD patterns. With increasing reaction temperature (160–180 °C), the XRD evidence indicates that an increasing fraction of rhombohedral millerite-like β-NiS is formed as a secondary phase. The α-NiS–β-NiS sample synthesized at 160 °C yielded good electrochemical performance in term of high reversible capacity (320 mAh g −1 at 0.1C up to 100 cycles). Even at high rates, the sample operated at a good fraction of its capacity. The likely contributing factor to the superior electrochemical performance of the α-NiS–β-NiS sample could be related to the improved morphology. TEM imaging confirmed that needle-like protrusions connect the clusters of α-NiS particles, and the individual protrusions indicated a very high surface area including folded sheet morphology, which helps to dissipate the surface accumulation of Li + ions and facilitate rapid mobility. These factors help to enhance the amount of lithium intercalated within the material.

  13. Effect of amount of glycine as fuel in obtaining nanocomposite Ni/NiO

    International Nuclear Information System (INIS)

    Simoes, A.N.; Simoes, V.N.; Neiva, L.S.; Quirino, M.R.; Vieira, D.A.; Gama, L.

    2010-01-01

    This paper proposes to investigate the effect of the amount of glycine in obtaining nanocomposite Ni/NiO synthesized by combustion reaction technique. The amount of glycine used was calculated on the stoichiometric composition of 50% and 100%. Characterizations by X-ray diffraction (XRD), N2 adsorption by the BET method and scanning electron microscopy (SEM) were performed with powder of Ni/NiO result. The analysis of X-ray diffraction showed the presence of crystalline NiO phase in the presence of nickel as a secondary phase, whose amount increased with the amount of glycine. Increasing the concentration of glycine also caused an increase in surface area, which ranged from 1.1 to 1.4 m 2 /g. The micrographs revealed the formation of soft agglomerates with porous appearance and easy dispersions. It can be concluded that the synthesis is effective to obtain nanosized powders. (author)

  14. Effect of solute atoms on swelling in Ni alloys and pure Ni under He + ion irradiation

    Science.gov (United States)

    Wakai, E.; Ezawa, T.; Imamura, J.; Takenaka, T.; Tanabe, T.; Oshima, R.

    2002-12-01

    The effects of solute atoms on microstructural evolutions have been investigated using Ni alloys under 25 keV He + irradiation at 500 °C. The specimens used were pure Ni, Ni-Si, Ni-Co, Ni-Cu, Ni-Mn and Ni-Pd alloys with different volume size factors. The high number densities of dislocation loops about 1.5×10 22 m -3 were formed in the specimens irradiated to 1×10 19 ions/m 2, and they were approximately equivalent, except for Ni-Si. The mean size of loops tended to increase with the volume size factor of solute atoms. In a dose of 4×10 20 ions/m 2, the swelling was changed from 0.2% to 4.5%, depending on the volume size factors. The number densities of bubbles tended to increase with the absolute values of the volume size factor, and the swelling increased with the volume size factors. This suggests that the mobility of helium and vacancy atoms may be influenced by the interaction of solute atoms with them.

  15. Effect of NiO inserted layer on spin-Hall magnetoresistance in Pt/NiO/YIG heterostructures

    International Nuclear Information System (INIS)

    Shang, T.; Zhan, Q. F.; Yang, H. L.; Zuo, Z. H.; Xie, Y. L.; Liu, L. P.; Zhang, S. L.; Zhang, Y.; Li, H. H.; Wang, B. M.; Li, Run-Wei; Wu, Y. H.; Zhang, S.

    2016-01-01

    We investigate spin-current transport with an antiferromagnetic insulator NiO thin layer by means of the spin-Hall magnetoresistance (SMR) over a wide range of temperature in Pt/NiO/Y_3Fe_5O_1_2 (Pt/NiO/YIG) heterostructures. The SMR signal is comparable to that without the NiO layer as long as the temperature is near or above the blocking temperature of the NiO, indicating that the magnetic fluctuation of the insulating NiO is essential for transmitting the spin current from the Pt to YIG layer. On the other hand, the SMR signal becomes negligibly small at low temperature, and both conventional anisotropic magnetoresistance and the anomalous Hall resistance are extremely small at any temperature, implying that the insertion of the NiO has completely suppressed the Pt magnetization induced by the YIG magnetic proximity effect (MPE). The dual roles of the thin NiO layer are, to suppress the magnetic interaction or MPE between Pt and YIG, and to maintain efficient spin current transmission at high temperature.

  16. Chemical vapor deposition of NiSi using Ni(PF3)4 and Si3H8

    International Nuclear Information System (INIS)

    Ishikawa, M.; Muramoto, I.; Machida, H.; Imai, S.; Ogura, A.; Ohshita, Y.

    2007-01-01

    NiSi x films were deposited using chemical vapor deposition (CVD) with a Ni(PF 3 ) 4 and Si 3 H 8 /H 2 gas system. The step coverage quality of deposited NiSi x was investigated using a horizontal type of hot-wall low pressure CVD reactor, which maintained a constant temperature throughout the deposition area. The step coverage quality improved as a function of the position of the gas flow direction, where PF 3 gas from decomposition of Ni(PF 3 ) 4 increased. By injecting PF 3 gas into the Ni(PF 3 ) 4 and Si 3 H 8 /H 2 gas system, the step coverage quality markedly improved. This improvement in step coverage quality naturally occurred when PF 3 gas was present, indicating a strong relationship. The Si/Ni deposit ratio at 250 deg. C is larger than at 180 deg. C. It caused a decreasing relative deposition rate of Ni to Si. PF 3 molecules appear to be adsorbed on the surface of the deposited film and interfere with faster deposition of active Ni deposition species

  17. Tracer diffusion of 60Co and 63Ni in amorphous NiZr alloy

    International Nuclear Information System (INIS)

    Hoshino, K.; Averback, R.S.; Hahn, H.; Rothman, S.J.

    1987-01-01

    Tracer diffusion of 60 Co and 63 Ni in equiatomic amorphous NiZr alloy in the temperature range between 486 and 641 0 K can be described by: D/sub Co/sup */ = 3.7 x 10 -7 exp[-(135 +- 14) kJ mole -1 /RT] m 2 /sec and D/sub Ni//sup */ = 1.7 x 10 -7 exp[-(140 +- 9) kJ mole -1 /RT] m 2 /sec. The values of D/sub Ni//sup */ are in reasonable agreement with those measured by the Rutherford backscattering technique. The measured diffusivities were independent of time, indicating that no relaxation took place during diffusion. 27 refs., 2 tabs

  18. Electroplated Ni on the PN Junction Semiconductor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jin Joo; Uhm, Young Rang; Son, Kwang Jae; Kim, Jong Bum; Choi, Sang Moo; Park, Jong Han; Hong, Jintae [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    Nickel (Ni) electroplating was implemented by using a metal Ni powder in order to establish a Ni-63 plating condition on the PN junction semiconductor needed for production of betavoltaic battery. PN junction semiconductors with a Ni seed layer of 500 and 1000 A were coated with Ni at current density from 10 to 50 mA cm{sup 2}. The surface roughness and average grain size of Ni deposits were investigated by XRD and SEM techniques. The roughness of Ni deposit was increased as the current density was increased, and decreased as the thickness of Ni seed layer was increased.

  19. Electroplated Ni on the PN Junction Semiconductor

    International Nuclear Information System (INIS)

    Kim, Jin Joo; Uhm, Young Rang; Son, Kwang Jae; Kim, Jong Bum; Choi, Sang Moo; Park, Jong Han; Hong, Jintae

    2015-01-01

    Nickel (Ni) electroplating was implemented by using a metal Ni powder in order to establish a Ni-63 plating condition on the PN junction semiconductor needed for production of betavoltaic battery. PN junction semiconductors with a Ni seed layer of 500 and 1000 A were coated with Ni at current density from 10 to 50 mA cm 2 . The surface roughness and average grain size of Ni deposits were investigated by XRD and SEM techniques. The roughness of Ni deposit was increased as the current density was increased, and decreased as the thickness of Ni seed layer was increased

  20. Characterization and electrochemical properties of Ni(Si)/Ni5Si2 multiphase coatings prepared by HVOF spraying

    Science.gov (United States)

    Verdian, M. M.; Raeissi, K.; Salehi, M.

    2012-11-01

    Ni(Si)/Ni5Si2 powders were produced by mechanical alloying (MA) of Ni-25 at.% Si powder mixture. Then, the as-milled powders were sprayed onto copper substrate using high velocity oxy-fuel (HVOF) process. The phase composition and microstructure of the coatings were examined by X-ray diffractometry and scanning electron microscopy. Polarization tests and electrochemical impedance spectroscopy (EIS) measurements were also employed to study corrosion performance of the coatings in 3.5% NaCl solution. The results showed that although single phase Ni3Si was formed during annealing of Ni(Si)/Ni5Si2 powders, but, only Ni(Si) and Ni5Si2 are present in HVOF coatings and no new phase has been formed during spraying. The coatings had microhardness up to 746 HV0.05. Further investigations showed the corrosion performance of multiphase coatings in 3.5% NaCl solution was better than that of copper substrate. The phase transitions during MA, HVOF and annealing processes were discussed in association with Ni-Si phase diagram and nature of each process.

  1. Amorphous NiFe-OH/NiFeP Electrocatalyst Fabricated at Low Temperature for Water Oxidation Applications

    KAUST Repository

    Liang, Hanfeng

    2017-04-11

    Water splitting driven by electricity or sunlight is one of the most promising ways to address the global terawatt energy needs of future societies; however, its large-scale application is limited by the sluggish kinetics of the oxygen evolution reaction (OER). NiFe-based compounds, mainly oxides and hydroxides, are well-known OER catalysts and have been intensively studied; however, the utilization of the synergistic effect between two different NiFe-based materials to further boost the OER performance has not been achieved to date. Here, we report the rapid conversion of NiFe double hydroxide into metallic NiFeP using PH3 plasma treatment and further construction of amorphous NiFe hydroxide/NiFeP/Ni foam as efficient and stable oxygen-evolving anodes. The strong electronic interactions between NiFe hydroxide and NiFeP significantly lower the adsorption energy of H2O on the hybrid and thus lead to enhanced OER performance. As a result, the hybrid catalyst can deliver a geometrical current density of 300 mA cm–2 at an extremely low overpotential (258 mV, after ohmic-drop correction), along with a small Tafel slope of 39 mV decade–1 and outstanding long-term durability in alkaline media.

  2. One-step facile synthesis of Ni2P/C as cathode material for Ni/Zn aqueous secondary battery

    Science.gov (United States)

    Li, JiLan; Chen, ChangGuo

    2018-01-01

    Nickel phosphides/carbon(Ni2P/C) composites have been successfully synthesized via a simple one-pot hydrothermal method using glucose as carbon source for the first time. By contrast, the pure Ni2P was prepared under the same conditions without glucose. The results show that glucose not only provide the carbon source, but also prevent the aggregation of Ni2P particles. The as-obtained Ni2P/C composites and pure Ni2P were used as cathode material for alkaline Ni/Zn battery. Owing to unique Ni2P/C composites and loose, Ultra thin flower-like shape the synthesized Ni2P/C material delivers high capacity of 176 mAh g-1 at 1 A g-1 and 82 mAh g-1 at 5 A g-1 current density in Ni2P/C-Zn battery. Moreover, it shows a good cycling life that capacity fading only about 6.2% after 1500 cycles. All of these indicate that the prepared Ni2P/C composites may be a new promising cathode material for Ni-Zn rechargeable battery.

  3. Solution growth of NiO nanosheets supported on Ni foam as high-performance electrodes for supercapacitors

    Science.gov (United States)

    Yan, Hailong; Zhang, Deyang; Xu, Jinyou; Lu, Yang; Liu, Yunxin; Qiu, Kangwen; Zhang, Yihe; Luo, Yongsong

    2014-08-01

    Well-aligned nickel oxide (NiO) nanosheets with the thickness of a few nanometers supported on a flexible substrate (Ni foam) have been fabricated by a hydrothermal approach together with a post-annealing treatment. The three-dimensional NiO nanosheets were further used as electrode materials to fabricate supercapacitors, with high specific capacitance of 943.5, 791.2, 613.5, 480, and 457.5 F g-1 at current densities of 5, 10, 15, 20, and 25 A g-1, respectively. The NiO nanosheets combined well with the substrate. When the electrode material was bended, it can still retain 91.1% of the initial capacitance after 1,200 charging/discharging cycles. Compared with Co3O4 and NiO nanostructures, the specific capacitance of NiO nanosheets is much better. These characteristics suggest that NiO nanosheet electrodes are promising for energy storage application with high power demands.

  4. Solution growth of NiO nanosheets supported on Ni foam as high-performance electrodes for supercapacitors.

    Science.gov (United States)

    Yan, Hailong; Zhang, Deyang; Xu, Jinyou; Lu, Yang; Liu, Yunxin; Qiu, Kangwen; Zhang, Yihe; Luo, Yongsong

    2014-01-01

    Well-aligned nickel oxide (NiO) nanosheets with the thickness of a few nanometers supported on a flexible substrate (Ni foam) have been fabricated by a hydrothermal approach together with a post-annealing treatment. The three-dimensional NiO nanosheets were further used as electrode materials to fabricate supercapacitors, with high specific capacitance of 943.5, 791.2, 613.5, 480, and 457.5 F g(-1) at current densities of 5, 10, 15, 20, and 25 A g(-1), respectively. The NiO nanosheets combined well with the substrate. When the electrode material was bended, it can still retain 91.1% of the initial capacitance after 1,200 charging/discharging cycles. Compared with Co3O4 and NiO nanostructures, the specific capacitance of NiO nanosheets is much better. These characteristics suggest that NiO nanosheet electrodes are promising for energy storage application with high power demands.

  5. Microstructural characterisation of Ni75Al25 and Ni31.5Al68.5 powder particles produced by gas atomisation

    International Nuclear Information System (INIS)

    García-Escorial, A.; Lieblich, M.

    2014-01-01

    Highlight: ► Successful production of gas atomised Ni75Al25 and Ni31.5Al68.5 powder particles. ► Characterization of the as-solidified microstructure of 75 Al 25 and Ni 31.5 Al 68.5 at.% powder particles below 100 μm in size have been studied. The gas atomised Ni 75 Al 25 powder particles are mainly spherical. The solidification of this alloy is very fast, and its microstructure consists of a dendrite and lamellar structure of partially ordered γ-(Ni), γ′-Ni 3 Al L1 2 phase, and β-NiAl phase. The order increases with the powder particle size. The gas atomised Ni 31.5 Al 68.5 powder particles are also spherical in shape. The microstructure consists of Ni 2 Al 3 dendrites with interdendritic peritectic NiAl 3 and eutectic NiAl 3 + α-Al. The amount of the Ni 2 Al 3 increases as the cooling rate increases. NiAl phase is absent in the gas atomised Ni 31.5 Al 68.5 powder

  6. Low-field spin dynamics of Cr7Ni and Cr7Ni-Cu-Cr7Ni molecular rings as detected by μsR

    OpenAIRE

    Sanna, S.; Arosio, P.; Bordonali, L.; Adelnia, F.; Mariani, M.; Garlatti, E.; Baines, C.; Amato, A.; Sabareesh, K. P.V.; Timco, G.; Winpenny, R. E.P.; Blundell, S. J.; Lascialfari, A.

    2017-01-01

    Muon spin rotation measurements were used to investigate the spin dynamics of heterometallic Cr7Ni and Cr7Ni-Cu-Cr7Ni molecular clusters. In Cr7Ni the magnetic ions are arranged in a quasiplanar ring and interact via an antiferromagnetic exchange coupling constant J, while Cr7Ni-Cu-Cr7Ni is composed of two Cr7Ni linked by a bridging moiety containing one Cu ion, that induces an inter-ring ferromagnetic interaction J ≪ J. The longitudinal muon relaxation rate λ collected at low magnetic fields...

  7. The study of quasi-projectiles produced in Ni+Ni and Ni+Au collisions: excitation energy and spin; Etude des quasi-projectiles produits dans les collisions Ni+Ni et Ni+Au: energie d'excitation et spin

    Energy Technology Data Exchange (ETDEWEB)

    Buta, A

    2003-02-01

    During the collision between the projectile and the target nuclei in the intermediate energy regime (E < 100 MeV/nucleon) two excited nuclei are mainly observed in the exit channel, the quasi projectile (QP) and the quasi target. They disintegrate by particle emission. However, this binary picture is perturbed by the emission of particles and light fragments with velocities intermediate between the projectile velocity and the target one, all along the interaction (midrapidity component). This work aim to determine the excitation energy and the intrinsic angular momentum (or spin) of quasi-projectiles produced in the Ni+Ni and Ni+Au collisions at 52 and 90 MeV/nucleon. The excitation energy is deduced from the kinematical characteristics of particles emitted by the quasi-projectile. They have to be separated from midrapidity particles. Three different scenarios have been used for this purpose. The spin of the quasi-projectile has been extracted from the experimental data by mean of proton and alpha particles multiplicities emitted by the QP in the Ni+Au at 52 MeV/nucleon reaction. The results have been compared to the predictions of a theoretical model based on nucleon transfers. Their evolution is qualitatively reproduced as a function of the violence of the collision. (author)

  8. Enhanced optical and electrical properties of Ni inserted ITO/Ni/AZO tri-layer structure for photoelectric applications

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, M. Melvin David; Kim, Hyunki [Department of Electrical Engineering, Incheon National University, Incheon 406772 (Korea, Republic of); Park, Yun Chang [Measurement and Analysis Division, National Nanofab Center (NNFC), Daejeon 305-806 (Korea, Republic of); Kim, Joondong, E-mail: joonkim@incheon.ac.kr [Department of Electrical Engineering, Incheon National University, Incheon 406772 (Korea, Republic of)

    2015-05-15

    Highlights: • Ni-embedding transparent conductor effectively reduces the resistivity. • Ni insertion improves the carrier mobility and collection efficiencies. • ITO/Ni/AZO is effective to improve photo-responses compared to ITO/AZO. - Abstract: A thin Ni layer of 5 nm thickness was deposited in between indium-tin-oxide (ITO) and aluminum-doped-zinc oxide (AZO) layers of 50 nm thickness each. The Ni inserting tri-layer structure (ITO/Ni/AZO) showed lower resistivity of 5.51 × 10{sup −4} Ωcm which is nearly 20 times lesser than 97.9 × 10{sup −4} Ωcm of bilayer structure (ITO/AZO). A thin Ni layer in between ITO and AZO enhanced the carrier concentration, mobility and photoresponse behaviors so that figure of merit (FOM) value of ITO/Ni/AZO device was greater than that of ITO/AZO device. ITO/Ni/AZO structure showed improved quantum efficiencies over a broad range of wavelengths (∼350–950 nm) compared to that of ITO/AZO bilayer structure, resulting in enhanced photoresponses. These results show that the optical, electrical and photoresponse properties of ITO/AZO structure could be enhanced by inserting Ni layer of 5 nm thickness in between ITO and AZO layers.

  9. Heterobimetallic [NiFe] Complexes Containing Mixed CO/CN- Ligands: Analogs of the Active Site of the [NiFe] Hydrogenases.

    Science.gov (United States)

    Perotto, Carlo U; Sodipo, Charlene L; Jones, Graham J; Tidey, Jeremiah P; Blake, Alexander J; Lewis, William; Davies, E Stephen; McMaster, Jonathan; Schröder, Martin

    2018-03-05

    The development of synthetic analogs of the active sites of [NiFe] hydrogenases remains challenging, and, in spite of the number of complexes featuring a [NiFe] center, those featuring CO and CN - ligands at the Fe center are under-represented. We report herein the synthesis of three bimetallic [NiFe] complexes [Ni( N 2 S 2 )Fe(CO) 2 (CN) 2 ], [Ni( S 4 )Fe(CO) 2 (CN) 2 ], and [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] that each contain a Ni center that bridges through two thiolato S donors to a {Fe(CO) 2 (CN) 2 } unit. X-ray crystallographic studies on [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ], supported by DFT calculations, are consistent with a solid-state structure containing distinct molecules in the singlet ( S = 0) and triplet ( S = 1) states. Each cluster exhibits irreversible reduction processes between -1.45 and -1.67 V vs Fc + /Fc and [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] possesses a reversible oxidation process at 0.17 V vs Fc + /Fc. Spectroelectrochemical infrared (IR) and electron paramagnetic resonance (EPR) studies, supported by density functional theory (DFT) calculations, are consistent with a Ni III Fe II formulation for [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] + . The singly occupied molecular orbital (SOMO) in [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] + is based on Ni 3d z 2 and 3p S with the S contributions deriving principally from the apical S-donor. The nature of the SOMO corresponds to that proposed for the Ni-C state of the [NiFe] hydrogenases for which a Ni III Fe II formulation has also been proposed. A comparison of the experimental structures, and the electrochemical and spectroscopic properties of [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] and its [Ni( N 2 S 3 )] precursor, together with calculations on the oxidized [Ni( N 2 S 3 )Fe(CO) 2 (CN) 2 ] + and [Ni( N 2 S 3 )] + forms suggests that the binding of the {Fe(CO)(CN) 2 } unit to the {Ni(CysS) 4 } center at the active site of the [NiFe] hydrogenases suppresses thiolate-based oxidative chemistry involving the bridging thiolate S donors

  10. Structure-activity relations for Ni-containing zeolites during NO reduction. II. Role of the chemical state of Ni

    NARCIS (Netherlands)

    Mosqueda Jimenez, B.I.; Jentys, A.; Seshan, Kulathuiyer; Lercher, J.A.

    2003-01-01

    The influence of the metal in Ni-containing zeolites used as catalysts for the reduction of NO with propane and propene was studied. In the fresh catalysts, Ni is located in ion exchange positions for Ni/MOR, Ni/ZSM-5, and Ni/MCM-22. The formation of carbonaceous deposits, the removal of Al from

  11. Performance of the PdNi and PdNiSe as cathodes in PEM fuel cells; Desempeno de PdNi y PdNiSe como catodos en celdas de combustible tipo PEM

    Energy Technology Data Exchange (ETDEWEB)

    Santana, A.; Ramos-Sanchez, G.; Vazquez, G.; Solorza-Feria, O. [Centro de Investigaciones y de Estudios Avanzados del IPN, Mexico D.F. (Mexico)]. E-mail: gramos@cinvestav.mx

    2009-09-15

    The search for new materials capable of catalyzing oxygen reactions in low temperature fuel cells continues to be one of the key issues in the development of a hydrogen economy. Electrochemical and physical characterization studies have demonstrated that the PdNi and PdNiSe catalysts have adequate properties for use as cathodes in fuel cells. Nevertheless, the performance of the materials in proton exchange membrane (PEM) fuel cells depends not only on the catalytic properties but also on the adequate preparation of the electrocatalyst membrane interface (EMI). This work presents the results of the search for optimal conditions to prepare the EMIs with PdNi and PdNiSe cathodes. There are many variables for handling the preparation of the interfaces, nevertheless our search focuses on two: catalyst ratio/Vulcan Carbon® and the catalyst amount. Interfaces were prepared with an active area of 5 cm{sup 2} with PdNi and PdNiSe cathodes and carbon fabric anode with Pt E-tek®. These interfaces were tested with an ElectroChem model under different gas pressure and temperature conditions. The optimization method was carried out using a simplex method with the variables mentioned above and power density per unit mass and catalyst area as response variables. [Spanish] La busqueda de nuevos materiales capaces de catalizar la Reaccion de Oxigeno (RRO) en celdas de combustible de baja temperatura, sigue siendo uno de los temas clave para el desarrollo de una Economia del Hidrogeno. Estudios electroquimicos y de caracterizacion fisica han demostrado que los catalizadores PdNi y PdNiSe, tienen las propiedades adecuadas para poder ser utilizados como catodos en celdas de combustible; sin embargo el desempeno de los materiales en celdas de combustible de membrana de intercambio protonico (PEM), no solo depende de las propiedades del catalizador, sino tambien de la preparacion adecuada del Ensamble Membrana Electrocatalizador (EME). En este trabajo se presentan los resultados de la

  12. Participar como niña o niño en el mundo social

    Directory of Open Access Journals (Sweden)

    Silvia Paulina Díaz

    2010-01-01

    Full Text Available En este artículo presento la participación como resultado de un trabajo investigativo realizado durante el año 2007, con niños y niñas escolarizados habitantes de la ciudad de Medellín, Colombia, cuyo objetivo fue analizar las representaciones sociales que ellos y ellas comparten sobre el ejercicio ciudadano. El análisis de la información tiene como ejes fundamentales, la salud colectiva, la sociología de la infancia y la participación en la niñez, en una aproximación que se realiza desde un enfoque cualitativo y etnográfico. En los hallazgos, sobresale cómo las niñas y niños se muestran preparados para ejercer su derecho a la participación como aspecto de sus vidas que se haría posible dentro del marco normativo existente, pero que aún no es asumido en prácticas sociales que los incluyan.

  13. Participar como niña o niño en el mundo social

    Directory of Open Access Journals (Sweden)

    Silvia Paulina Díaz

    2010-10-01

    Full Text Available En este artículo presento la participación como resultado de un trabajo investigativo realizado durante el año 2007, con niños y niñas escolarizados habitantes de la ciudad de Medellín, Colombia, cuyo objetivo fue analizar las representaciones sociales que ellos y ellas comparten sobre el ejercicio ciudadano. El análisis de la información tiene como ejes fundamentales, la salud colectiva, la sociología de la infancia y la participación en la niñez, en una aproximación que se realiza desde un enfoque cualitativo y etnográfico. En los hallazgos, sobresale cómo las niñas y niños se muestran preparados para ejercer su derecho a la participación como aspecto de sus vidas que se haría posible dentro del marco normativo existente, pero que aún no es asumido en prácticas sociales que los incluyan.

  14. Fe-Ni-bearing serpentines from the saprolite horizon of Caribbean Ni-laterite deposits: new insights from thermodynamic calculations

    Science.gov (United States)

    Villanova-de-Benavent, Cristina; Domènech, Cristina; Tauler, Esperança; Galí, Salvador; Tassara, Santiago; Proenza, Joaquín A.

    2017-10-01

    Fe-Ni-bearing serpentine from the saprolite horizon is the main Ni ores in hydrous silicate-type Ni laterites and formed by chemical weathering of partially serpentinized ultramafic rocks under tropical conditions. During lateritization, Mg, Si, and Ni are leached from the surface and transported downwards. Fe2+ is oxidized to Fe3+ and fixed as insoluble Fe-oxyhydroxides (mostly goethite) that incorporate Ni. This Ni is later leached from goethite and incorporated in secondary serpentine and garnierite. As a result, a serpentine-dominated saprolite horizon forms over the ultramafic protolith, overlapped by a Fe-oxyhydroxide-dominated limonite horizon. The serpentine from the protolith (serpentine I) is of hydrothermal origin and yields similar Ni (0.10-0.62 wt.% NiO) and lower Fe (mostly 1.37-5.81 wt.% FeO) concentrations than the primary olivine. In contrast, Fe-Ni-bearing serpentine from the saprolite (serpentine II) shows significantly higher and variable Fe and Ni contents, typically ranging from 2.23 to 15.59 wt.% Fe2O3 and from 1.30 to 7.67 wt.% NiO, suggesting that serpentine get enriched in Fe and Ni under supergene conditions. This study presents detailed mineralogical, textural, and chemical data on this serpentine II, as well as new insights by thermodynamic calculations assuming ideal solution between Fe-, Ni- and Mg-pure serpentines. The aim is to assess if at atmospheric pressure and temperature Fe-Ni-bearing serpentine can be formed by precipitation. Results indicate that the formation of serpentine II under atmospheric pressure and temperature is thermodynamically supported, and pH, Eh, and the equilibrium constant of the reaction are the parameters that affect the results more significantly.

  15. OpenNI cookbook

    CERN Document Server

    Falahati, Soroush

    2013-01-01

    This is a Cookbook with plenty of practical recipes enriched with explained code and relevant screenshots to ease your learning curve. If you are a beginner or a professional in NIUI and want to write serious applications or games, then this book is for you. Even OpenNI 1 and OpenNI 1.x programmers who want to move to new versions of OpenNI can use this book as a starting point. This book uses C++ as the primary language but there are some examples in C# and Java too, so you need to have about a basic working knowledge of C or C++ for most cases.

  16. Electrical Conductivity of Ni-YSZ Anode for SOFCs According to the Ni Powder Size Variations in Core-shell Structure

    International Nuclear Information System (INIS)

    Kang, Young Jin; Jung, Sung-Hun; An, Yong-Tae; Choi, Byung-Hyun; Ji, Mi-Jung

    2015-01-01

    Ni-YSZ (Y_2O_3-stabilized ZrO_2) core-shell structures were prepared by a high-speed mixing method, starting from Ni particles of three different average sizes of 0.2, 0.4, and 1.8 μm. The Ni-YSZ core-shell structures prepared using Ni particles of size 0.2, 0.4, and 1.8 μm exhibited dense core, porous core, and random-morphology core, respectively. Subsequently, nano structured cermet anodes were fabricated using the prepared Ni-YSZ core-shell powders. During the formation of cermet, the heat treatment of Ni-YSZ core-shell powder results in the eruption of Ni core out of the YSZ shell layers, thereby facilitating the formation of nano structured Ni-YSZ cermet. Systematic studies indicated that the morphology and electrical conductivity of the prepared Ni-YSZ core-shell powders and the cermet anode varied, depending on the initial particle size of the Ni particles. Of the different samples prepared in this study, the Ni-YSZ cermet prepared using Ni particles of size 0.4 μm showed the highest electrical conductivity at 750 ℃.

  17. Electrical Conductivity of Ni-YSZ Anode for SOFCs According to the Ni Powder Size Variations in Core-shell Structure

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Young Jin; Jung, Sung-Hun; An, Yong-Tae; Choi, Byung-Hyun; Ji, Mi-Jung [Korea Institute of Ceramic Engineering and Technology (KICET), Seoul (Korea, Republic of)

    2015-04-15

    Ni-YSZ (Y{sub 2}O{sub 3}-stabilized ZrO{sub 2}) core-shell structures were prepared by a high-speed mixing method, starting from Ni particles of three different average sizes of 0.2, 0.4, and 1.8 μm. The Ni-YSZ core-shell structures prepared using Ni particles of size 0.2, 0.4, and 1.8 μm exhibited dense core, porous core, and random-morphology core, respectively. Subsequently, nano structured cermet anodes were fabricated using the prepared Ni-YSZ core-shell powders. During the formation of cermet, the heat treatment of Ni-YSZ core-shell powder results in the eruption of Ni core out of the YSZ shell layers, thereby facilitating the formation of nano structured Ni-YSZ cermet. Systematic studies indicated that the morphology and electrical conductivity of the prepared Ni-YSZ core-shell powders and the cermet anode varied, depending on the initial particle size of the Ni particles. Of the different samples prepared in this study, the Ni-YSZ cermet prepared using Ni particles of size 0.4 μm showed the highest electrical conductivity at 750 ℃.

  18. Ni adsorption and Ni-Al LDH precipitation in a sandy aquifer: An experimental and mechanistic modeling study

    NARCIS (Netherlands)

    Regelink, I.C.; Temminghoff, E.J.M.

    2011-01-01

    Mining activities and industries have created nickel (Ni) contaminations in many parts of the world. The objective of this study is to increase our understanding of Ni adsorption and Nickel-Aluminium Layered Double Hydroxide (Ni-Al LDH) precipitation to reduce Ni mobility in a sandy soil aquifer. At

  19. Hydrogen absorption kinetics and structural properties of Mg85Ni10Ca5 and Mg90Ni10

    International Nuclear Information System (INIS)

    Aoki, Masakazu; Saito, Katsushi; Towata, Shin-ichi

    2005-01-01

    Mg 85 Ni 10 Ca 5 and Mg 90 Ni 10 were prepared by melting mixtures of the elements in mild steel crucibles and pouring them into copper molds. Hydrogen absorption kinetics and structural properties of the alloys were characterized by the volumetric method using a Sievert's apparatus, X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The crystallite size of Mg in Mg 85 Ni 10 Ca 5 , which is evaluated by XRD peak broadening, is about 50% smaller than that in Mg 90 Ni 10 . In addition, the nanometer-scale structure composed of Mg, Mg 2 Ni, Mg 2 Ca was observed in Mg 85 Ni 10 Ca 5 . Mg 85 Ni 10 Ca 5 shows better hydrogen absorption kinetics than Mg 90 Ni 10 in the temperature range of room temperature to 573 K. The better absorption kinetics of Mg 85 Ni 10 Ca 5 is mainly attributed to the nanometer-scale structure

  20. Soft magnetic properties of hybrid ferromagnetic films with CoFe, NiFe, and NiFeCuMo layers

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Jong-Gu [Eastern-western Biomedical Engineering, Sangji University, Wonju 220-702 (Korea, Republic of); Hwang, Do-Guwn [Dept. of Oriental Biomedical Engineering, Sangji University, Wonju 220-702 (Korea, Republic of); Rhee, Jang-Roh [Dept. of Physics, Sookmyung Women' s University, Seoul 140-742 (Korea, Republic of); Lee, Sang-Suk, E-mail: sslee@sangji.ac.kr [Dept. of Oriental Biomedical Engineering, Sangji University, Wonju 220-702 (Korea, Republic of)

    2011-09-30

    Two-layered ferromagnetic alloy films (NiFe and CoFe) with intermediate NiFeCuMo soft magnetic layers of different thicknesses were investigated to understand the relationship between coercivity and magnetization process by taking into account the strength of hard-axis saturation field. The thickness dependence of H{sub EC} (easy-axis coercivity), H{sub HS} (hard-axis saturation field), and {chi} (susceptibility) of the NiFeCuMo thin films in glass/Ta(5 nm)/[CoFe or NiFe(5 nm-t/2)]/NiFeCuMo(t = 0, 4, 6, 8, 10 nm)/[CoFe or NiFe(5 nm-t/2)]/Ta(5 nm) films prepared using the ion beam deposition method was determined. The magnetic properties (H{sub EC}, H{sub HS}, and {chi}) of the ferromagnetic CoFe, NiFe three-layers with an intermediate NiFeCuMo super-soft magnetic layer were strongly dependent on the thickness of the NiFeCuMo layer.

  1. Effects of Ni content on nanocrystalline Fe–Co–Ni ternary alloys synthesized by a chemical reduction method

    Energy Technology Data Exchange (ETDEWEB)

    Chokprasombat, Komkrich, E-mail: komkrich28@gmail.com [Department of Physics, Faculty of Science, Thaksin University, Phatthalung 93210 Thailand (Thailand); Pinitsoontorn, Supree [Integrated Nanotechnology Research Center, Department of Physics, Faculty of Science, Khon Kaen University, Khon Kaen 40002 Thailand (Thailand); Maensiri, Santi [School of Physics, Institute of Science, Suranaree University of Technology, Nakhon Ratchasima 30000 Thailand (Thailand)

    2016-05-01

    Magnetic properties of Fe–Co–Ni ternary alloys could be altered by changing of the particle size, elemental compositions, and crystalline structures. In this work, Fe{sub 50}Co{sub 50−x}Ni{sub x} nanoparticles (x=10, 20, 40, and 50) were prepared by the novel chemical reduction process. Hydrazine monohydrate was used as a reducing agent under the concentrated basic condition with the presence of poly(vinylpyrrolidone). We found that the nanoparticles were composed of Fe, Co and Ni with compositions according to the molar ratio of the metal sources. Interestingly, the particles were well-crystalline at the as-prepared state without post-annealing at high temperature. Increasing Ni content resulted in phase transformation from body centered cubic (bcc) to face centered cubic (fcc). For the fcc phase, the average particle size decreased when increased the Ni content; the Fe{sub 50}Ni{sub 50} nanoparticles had the smallest average size with the narrowest size distribution. In additions, the particles exhibited ferromagnetic properties at room temperature with the coercivities higher than 300 Oe, and the saturation magnetiation decreased with increasing Ni content. These results suggest that the structural and magnetic properties of Fe–Co–Ni alloys could be adjusted by varying the Ni content. - Highlights: • We prepared nanocrystalline Fe–Co–Ni alloys by a novel chemical reduction process. • Elemental compositions could be well controlled by the molar ratio of metal sources. • Particle size and magnetic properties clearly depended on the Ni contents. • Fe{sub 50}Co{sub 10}Ni{sub 40} exhibited high saturation magnetization of 126.3 emu/g.

  2. Coarsening of Ni-Ge solid-solution precipitates in 'inverse' Ni{sub 3}Ge alloys

    Energy Technology Data Exchange (ETDEWEB)

    Ardell, Alan J., E-mail: alan.ardell@gmail.com [National Science Foundation, 4201 Wilson Boulevard, Arlington, VA 22230 (United States); Ma Yong [Aquatic Sensor Network Technology LLC, Storrs, CT 06268 (United States)

    2012-07-30

    Highlights: Black-Right-Pointing-Pointer We report microstructural evolution of disordered Ni-Ge precipitates in Ni{sub 3}Ge alloys. Black-Right-Pointing-Pointer Coarsening kinetics and particle size distributions are presented. Black-Right-Pointing-Pointer Data are analyzed quantitatively using the MSLW theory, but agreement is only fair. Black-Right-Pointing-Pointer The shapes of large precipitates are unusual, with discus or boomerang cross-sections. Black-Right-Pointing-Pointer Results are compared with morphology, kinetics of Ni-Al in inverse Ni{sub 3}Al alloys. - Abstract: The morphological evolution and coarsening kinetics of Ni-Ge solid solution precipitates from supersaturated solutions of hypostoichiometric Ni{sub 3}Ge were investigated in alloys containing from 22.48 to 23.50 at.% Ge at 600, 650 and 700 Degree-Sign C. The particles evolve from spheres to cuboids, though the flat portions of the interfaces are small. At larger sizes the precipitates coalesce into discus shapes, and are sometimes boomerang-shaped in cross section after intersection. The rate constant for coarsening increases strongly with equilibrium volume fraction, much more so than predicted by current theories; this is very different from the coarsening behavior of Ni{sub 3}Ge precipitates in normal Ni-Ge alloys and of Ni-Al precipitates in inverse Ni{sub 3}Al alloys. The activation energy for coarsening, 275.86 {+-} 24.17 kJ/mol, is somewhat larger than the result from conventional diffusion experiments, though within the limits of experimental error. Quantitative agreement between theory and experiment, estimated using available data on tracer diffusion coefficients in Ni{sub 3}Ge, is fair, the calculated rate constants exceeding measured ones by a factor of about 15. The particle size distributions are not in very good agreement with the predictions of any theory. These results are discussed in the context of recent theories and observations.

  3. Electrochemical kinetic performances of electroplating Co–Ni on La–Mg–Ni-based hydrogen storage alloys

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yuan; Tao, Yang; Ke, Dandan; Ma, Yufei [Hebei Key Laboratory of Applied Chemistry, School of Environmental and Chemical Engineering, Yanshan University, Qinhuangdao 066004 (China); Han, Shumin, E-mail: hanshm@ysu.edu.cn [Hebei Key Laboratory of Applied Chemistry, School of Environmental and Chemical Engineering, Yanshan University, Qinhuangdao 066004 (China); State Key Laboratory of Metastable Materials Science and Technology, Yanshan University, Qinhuangdao 066004 (China)

    2015-12-01

    Graphical abstract: - Highlights: • The Co–Ni composite coating was prepared by electroplating. • The alloy treated at 10 mA/cm{sup 2} has superior kinetic performances. • The Co–Ni layer accelerates the charge transfer rate on the surface of the alloy. - Abstract: Electroplating Co–Ni treatment was applied to the surface of the La{sub 0.75}Mg{sub 0.25}Ni{sub 3.48} alloy electrodes in order to improve the electrochemical and kinetic performances. The Scanning electron microscope-Energy dispersive spectroscopy and X-ray diffraction results showed that the electrodes were plated with a homogeneous Co–Ni alloy film. The alloy coating significantly improved the high rate dischargeability of the alloy electrode, and the HRD value increased to 57.5% at discharge current density 1875 mA/g after the Co–Ni-coating. The exchange current density I{sub 0}, the limiting current density I{sub L} and the oxidation peak current also increased for the coated alloy. The improvement of overall electrode performances was attributed to an enhancement in electro-catalytic activity and conductivity at the alloy surface, owing to the precipitation of the Co–Ni layer.

  4. Resonant Ni and Fe KLL Auger spectra photoexcited from NiFe alloys

    International Nuclear Information System (INIS)

    Koever, L.; Cserny, I.; Berenyi, Z.; Egri, S.; Novak, M.

    2005-01-01

    Complete text of publication follows. KLL Auger spectra of 3d transition metal atoms in solid environment, measured using high energy resolution, give an insight into the details of the local electronic structure surrounding the particular atoms emitting the signal Auger electrons. Fine tuning the energy of the exciting monochromatic photons across the K-absorption edge, features characteristic to resonant phenomena can be identified in the spectra. The shapes of the resonantly photoexcited KLL Auger spectra induced from 3d transition metals and alloys are well interpreted by the single step model of the Auger process, based on the resonant scattering theory. The peak shapes are strongly influenced by the 4p partial density of unoccupied electronic states around the excited atom. High energy resolution studies of KLL Auger spectra of 3d transition metals using laboratory X-ray sources, however, request very demanding experiments and yield spectra of limited statistical quality making the evaluation of the fine details in the spectra difficult. The Tunable High Energy XPS (THE- XPS) instrument at BW2 offers optimum photon x and energy resolution for spectroscopy of deep core Auger transitions. For the present measurements high purity polycrystalline Ni and Fe sheets as well as NiFe alloy samples of different compositions (Ni 80 Fe 20 , Ni 50 Fe 50 , Ni 20 Fe 80 ) were used. The surfaces of the samples were cleaned by in-situ argon ion sputtering. The measurements of the Ni and Fe KL 23 L 23 Auger spectra of the metal and alloy samples were performed with the THE-XPS instrument using high electron energy resolution (0.2 eV). In Fig.1, the measured Fe KL 23 L 23 spectrum, photoexcited at the Fe K absorption edge from Fe metal, is compared with the respective spectrum excited from a Ni 50 Fe 50 alloy. A significant broadening of the 1 D 2 peak and an enhancement of the spectral intensity at the low energy loss part of this peak observed in the alloy sample, while the

  5. The fabrication of foam-like 3D mesoporous NiO-Ni as anode for high performance Li-ion batteries

    International Nuclear Information System (INIS)

    Huang, Peng; Zhang, Xin; Wei, Jumeng; Pan, Jiaqi; Sheng, Yingzhou; Feng, Boxue

    2015-01-01

    Graphical abstract: Foam-like 3 dimensional (3D) mesoporous NiO on 3D micro-porous Ni was fabricated. - Highlights: • We prepare NiO-Ni foam composite via hydrothermal etching and subsequent annealing. • The NiO exhibits novel foam-like 3D mesoporous architecture. • The NiO-Ni anode shows good cycle stability. - Abstract: Foam-like three dimensional mesoporous NiO on Ni foam was fabricated via facile hydrothermal etching and subsequent annealing treatment. The porous NiO consists of a large number of nanosheets with mean thickness about 50 nm, among which a large number of mesoscopic pores with size ranges from 100 nm to 1 μm distribute. The electrochemical performance of the as-prepared NiO-Ni as anode for lithium ion battery was studied by conventional charge/discharge test, which shows excellent cycle stability and rate capability. It exhibits initial discharge and charge capacities of 979 and 707 mA h g −1 at a charge/discharge rate of 0.7 C, which maintain of 747 and 738 mA h g −1 after 100 cycles. Even after 60 cycles at various rates from 0.06 to 14 C, the 10th discharge and charge capacities of the NiO-Ni electrode can revert to 699 and 683 mA h g −1 when lowering the charge/discharge rate to 0.06 C

  6. Radiation damage buildup and dislocation evolution in Ni and equiatomic multicomponent Ni-based alloys

    Energy Technology Data Exchange (ETDEWEB)

    Levo, E. [Department of Physics, P.O. Box 43, FIN-00014, University of Helsinki (Finland); Granberg, F., E-mail: fredric.granberg@helsinki.fi [Department of Physics, P.O. Box 43, FIN-00014, University of Helsinki (Finland); Fridlund, C.; Nordlund, K. [Department of Physics, P.O. Box 43, FIN-00014, University of Helsinki (Finland); Djurabekova, F. [Department of Physics, P.O. Box 43, FIN-00014, University of Helsinki (Finland); Helsinki Institute of Physics, P.O. Box 43, FIN-00014, University of Helsinki (Finland)

    2017-07-15

    Single-phase multicomponent alloys of equal atomic concentrations (“equiatomic”) have proven to exhibit promising mechanical and corrosion resistance properties, that are sought after in materials intended for use in hazardous environments like next-generation nuclear reactors. In this article, we investigate the damage production and dislocation mobility by simulating irradiation of elemental Ni and the alloys NiCo, NiCoCr, NiCoFe and NiFe, to assess the effect of elemental composition. We compare the defect production and the evolution of dislocation networks in the simulation cells of two different sizes, for all five studied materials. We find that the trends in defect evolution are in good agreement between the different cell sizes. The damage is generally reduced with increased alloy complexity, and the dislocation evolution is specific to each material, depending on its complexity. We show that increasing complexity of the alloys does not always lead to decreased susceptibility to damage accumulation under irradiation. We show that, for instance, the NiCo alloy behaves very similarly to Ni, while presence of Fe or Cr in the alloy even as a third component reduces the saturated level of damage substantially. Moreover, we linked the defect evolution with the dislocation transformations in the alloys. Sudden drops in defect number and large defect fluctuations from the continuous irradiation can be explained from the dislocation activity.

  7. Corrosion behaviour of electrodeposited nanocrystalline Ni-W and Ni-Fe-W alloys

    International Nuclear Information System (INIS)

    Sriraman, K.R.; Ganesh Sundara Raman, S.; Seshadri, S.K.

    2007-01-01

    The present work deals with evaluation of corrosion behaviour of electrodeposited nanocrystalline Ni-W and Ni-Fe-W alloys. Corrosion behaviour of the coatings deposited on steel substrates was studied using polarization and electrochemical impedance spectroscopy techniques in 3.5% NaCl solution while their passivation behaviour was studied in 1N sulphuric acid solution. The corrosion resistance of Ni-W alloys increased with tungsten content up to 7.54 at.% and then decreased. In case of Ni-Fe-W alloys it increased with tungsten content up to 9.20 at.% and then decreased. The ternary alloy coatings exhibited poor corrosion resistance compared to binary alloy coatings due to preferential dissolution of iron from the matrix. Regardless of composition all the alloys exhibited passivation behaviour over a wide range of potentials due to the formation of tungsten rich film on the surface

  8. Low energy structure of even-even Ni isotopes close to 78Ni

    International Nuclear Information System (INIS)

    Rykaczewski, Krzysztof Piotr; Mazzocchi, C.; Grzywacz, Robert Kazimierz; Batchelder, J.C.; Bingham, Carrol R.; Fong, D.; Hamilton, J.H.; Hwang, J.K.; Karny, M.; Krolas, W.; Liddick, S.N.; Lisetskiy, A. F.; Morton, N.H.; Mantica, P.F.; Mueller, W.F.; Steiner, M.; Stolz, A.; Winger, J.A.

    2005-01-01

    The structure of magic neutron-rich nickel isotopes produced in the fragmentation of a 140 A MeV 86 Kr beam was investigated. For the first time four gamma transitions were assigned to the decay of the I π =8 + , T 1/2 = 590 +180 -110 isomer, thus establishing the 0 + -2 + -4 + -6 + -8 + ground-state band in 76 Ni. The previously unknown 2 + and 4 + levels belonging to the ground-state band in 74 Ni were identified in the β decay of 74 Co (T 1/2 =30(3) ms). The decay properties of 72 Co → 72 Ni were verified and confirmed on the basis of γ-γ coincidence data. The relevance of the measured level properties for the magicity of 78 Ni is analyzed with the help of advanced shell-model predictions

  9. Competencia social y status sociométrico escolar en niños y niñas con TDAH

    Directory of Open Access Journals (Sweden)

    Daiana Russo, Argentina

    2015-07-01

    Full Text Available (analítico: Objetivo: Establecer relaciones entre la autopercepción de la competencia social en niños y niñas con TDAH y el status sociométrico escolar. Alcance: Los resultados obtenidos permitirán elaborar estrategias de intervención psicológica como también diseñar abordajes educativos en el aula que fortalezcan la interacción social de estos niños y niñas. Metodología: Estudio descriptivo correlacional con un diseño ex post facto retrospectivo (Montero & León, 2007. La muestra estuvo compuesta por 157 niños y niñas con edades comprendidas entre 8 y 12 años. Conformamos dos grupos, clínico (n=5 y control (n=152, pareados por edad. Administramos el cuestionario Messy (Matson, Rotatori & Helsel, 1983 y el Test sociométrico (Moreno, 1962. Resultados: Los niños y niñas con TDAH son menos asertivos que los niños y niñas del grupo control. La mayoría presenta una posición aislada con respecto a su grupo de pares. Conclusiones: Estos niños y niñas presentan dificultad para establecer relaciones vinculares con sus compañeros y compañeras. No obstante, la autopercepción de sus competencias sociales no coincide en todos los casos con su status sociométrico escolar.

  10. One-pot fabrication of NiFe2O4 nanoparticles on α-Ni(OH)2 nanosheet for enhanced water oxidation

    Science.gov (United States)

    Chen, Hong; Yan, Junqing; Wu, Huan; Zhang, Yunxia; Liu, Shengzhong (Frank)

    2016-08-01

    Water splitting has been intensively investigated as a promising solution to resolve the future environmental and energy crises. The oxygen evolution reaction (OER) of the photo- and electric field-induced water splitting limits the development of other reactions, including hydrogen evolution reaction (HER). Fe, Ni and NiFe (hydro) oxide-based catalysts are generally acknowledged among the best candidates of OER catalysts for water splitting. Herein, we developed a one-pot simple hydrothermal process to assemble NiFe2O4 nanoparticles onto the α-Ni(OH)2 nanosheets. The first formed NiFe2O4 under high temperature and pressure environment induces and assists the α-Ni(OH)2 formation without any further additives, because the distance between the neighboring Ni atoms in the cubic NiFe2O4 is similar to that in the α-Ni(OH)2 {003} facets. We have synthesized a series of NiFe2O4/α-Ni(OH)2 compounds and find that the overpotential decreases with the increase of Ni(OH)2 content while the OER kinetics stays unchanged, suggesting that Ni(OH)2 plays a major role in overpotential while NiFe2O4 mainly affects the OER kinetics. The obtained NiFe2O4/α-Ni(OH)2 compounds is also found to be a promising co-catalyst for the photocatalytic water oxidation. In fact, it is even more active than the noble PtOx with acceptable stability for the oxygen generation.

  11. Bonding Strength of Ni/Ni3Al Interface with Different Lattice Misfit

    Institute of Scientific and Technical Information of China (English)

    Ping PENG; Caixing ZHENG; Shaochang HAN; Zhaohui JIN; Rui YANG; Zhuangqi HU

    2003-01-01

    The interfacial binding covalent bond density (CBD) and the local environmental total bond order (LTBO) of the Ni/Ni3Alinterface with different lattice misfits (δ) were calculated by using first-principles discrete variation Xα method. It was foundthat

  12. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动

    Institute of Scientific and Technical Information of China (English)

    李秋菊

    2017-01-01

    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  13. Synergetic interface between NiO/Ni3S2 nanosheets and carbon nanofiber as binder-free anode for highly reversible lithium storage

    Science.gov (United States)

    Jiang, Jialin; Ma, Chao; Yang, Yinbo; Ding, Jingjing; Ji, Hongmei; Shi, Shaojun; Yang, Gang

    2018-05-01

    A novel heterostructure of NiO/Ni3S2 nanoflake is synthesized and composited with carbon nanofibers (CNF) membrane. NiO/Ni3S2 nanoflakes are homogeneously dispersed in CNF network, herein, NiO/Ni3S2 like leaf and CNF like branch. Carbon nanofibers network efficiently prevents the pulverization and buffers the volume changes of NiO/Ni3S2, meanwhile, NiO/Ni3S2 nanoflakes through the conductive channels of carbon nanofibers own improved Li+ diffusion ability and structural stability. The capacity of NiO/Ni3S2/CNF reaches to 519.2 mA g-1 after 200 cycles at the current density of 0.5 A g-1 while NiO/Ni3S2 fades to 71 mAh g-1 after 40 cycles. Owing to the synergetic structure, the resultant binder-free electrode NiO/Ni3S2/carbon nanofibers shows an excellent reversible lithium storage capability.

  14. NiTiCu/AlN/NiTiCu shape memory thin film heterostructures for vibration damping in MEMS

    Energy Technology Data Exchange (ETDEWEB)

    Kaur, Navjot; Kaur, Davinder, E-mail: dkaurfph@iitr.ernet.in

    2014-03-25

    Highlights: • Fabrication of NiTiCu/AlN/NiTiCu heterostructure using dc/rf magnetron sputtering. • Exhibits highest hardness (38 GPa) and elastic modulus (187 GPa). • Enhanced dissipation of mechanical energy (E{sub d} = 5.7 N J). • High damping capacity (0.052) and figure of merit (∼0.62). • Can be applied for vibration damping in MEMS. -- Abstract: Shape memory alloy (NiTiCu) thin films coupled with piezoelectric AlN layer produce an intelligent material for vibration damping. In the present study pure NiTiCu, NiTiCu/AlN and NiTiCu/AlN/NiTiCu heterostructures have been deposited on Si substrate using magnetron sputtering technique. By the use of the interfaces and shape memory effect provided by NiTiCu layers, the damping capacity can be increased along with increase in stiffness and mechanical hardness. The heterostructures were characterized in terms of structural, electrical, morphological and mechanical properties by X-ray diffraction (XRD), four probe resistivity method, atomic force microscopy, field emission scanning electron microscopy, and nanoindentation. The NiTiCu/AlN/NiTiCu heterostructure exhibit enhanced mechanical and damping properties as compared to NiTiCu/AlN and pure NiTiCu. This enhancement in hardness and damping of the heterostructure could be attributed to the shape memory effect of NiTiCu, intrinsic piezoelectricity of AlN and increased number of interfaces in heterostructure that help in dissipation of mechanical vibrations. The findings of this work provide additional impetus for the application of these heterostructures in emerging fields of nanotechnology and microelectro mechanical (MEMS) devices.

  15. NiTiCu/AlN/NiTiCu shape memory thin film heterostructures for vibration damping in MEMS

    International Nuclear Information System (INIS)

    Kaur, Navjot; Kaur, Davinder

    2014-01-01

    Highlights: • Fabrication of NiTiCu/AlN/NiTiCu heterostructure using dc/rf magnetron sputtering. • Exhibits highest hardness (38 GPa) and elastic modulus (187 GPa). • Enhanced dissipation of mechanical energy (E d = 5.7 N J). • High damping capacity (0.052) and figure of merit (∼0.62). • Can be applied for vibration damping in MEMS. -- Abstract: Shape memory alloy (NiTiCu) thin films coupled with piezoelectric AlN layer produce an intelligent material for vibration damping. In the present study pure NiTiCu, NiTiCu/AlN and NiTiCu/AlN/NiTiCu heterostructures have been deposited on Si substrate using magnetron sputtering technique. By the use of the interfaces and shape memory effect provided by NiTiCu layers, the damping capacity can be increased along with increase in stiffness and mechanical hardness. The heterostructures were characterized in terms of structural, electrical, morphological and mechanical properties by X-ray diffraction (XRD), four probe resistivity method, atomic force microscopy, field emission scanning electron microscopy, and nanoindentation. The NiTiCu/AlN/NiTiCu heterostructure exhibit enhanced mechanical and damping properties as compared to NiTiCu/AlN and pure NiTiCu. This enhancement in hardness and damping of the heterostructure could be attributed to the shape memory effect of NiTiCu, intrinsic piezoelectricity of AlN and increased number of interfaces in heterostructure that help in dissipation of mechanical vibrations. The findings of this work provide additional impetus for the application of these heterostructures in emerging fields of nanotechnology and microelectro mechanical (MEMS) devices

  16. The role of Ni in sulfided carbon-supported Ni-Mo hydrodesulfurization catalysts

    NARCIS (Netherlands)

    Bouwens, S.M.A.M.; Barthe-Zahir, N.; Beer, de V.H.J.; Prins, R.

    1991-01-01

    The thiophene hydrodesulfurization activities of Ni and Ni---Mo sulfide catalysts supported on activated carbon were measured at atmospheric pressure and the catalyst structures were studied by means of X-ray photoelectron spectroscopy, dynamic oxygen chemisorption, and chemical sulfur analysis. The

  17. Controlled synthesis of mesoporous β-Ni(OH)2 and NiO nanospheres with enhanced electrochemical performance

    International Nuclear Information System (INIS)

    Xing, Shengtao; Wang, Qian; Ma, Zichuan; Wu, Yinsu; Gao, Yuanzhe

    2012-01-01

    Highlights: ► Uniform mesoporous β-Ni(OH) 2 and NiO nanospheres with hierarchical structures were synthesized by a simple complexation–precipitation method. ► Both ammonia and citrate played an important role for the formation of mesoporous nanospheres. ► β-Ni(OH) 2 and NiO nanospheres showed excellent capacitive properties due to their mesoporous structures and larger surface areas. -- Abstract: Uniform mesoporous β-Ni(OH) 2 and NiO nanospheres with hierarchical structures were synthesized by a facile complexation–precipitation method. The effects of ammonia and citrate on the structure and morphology of the products were thoroughly investigated by X-ray powder diffraction, scanning electron microscopy, transmission electron microscopy and nitrogen adsorption–desorption measurements. The results indicated that ammonia played an important role for the formation of flowerlike spheres assembled from nanosheets. The addition of citrate could remarkably reduce the particle sizes and increase the specific surface areas of flowerlike spheres. A possible formation mechanism based on the experimental results was proposed to understand their growing procedures. β-Ni(OH) 2 and NiO nanospheres prepared with the addition of citrate showed excellent capacitive properties due to their mesoporous structures and large surface areas, suggesting the importance of controlled synthesis of hierarchical nanostructures for their applications.

  18. Improvement of thermoelectric properties for half-Heusler TiNiSn by interstitial Ni defects

    International Nuclear Information System (INIS)

    Hazama, Hirofumi; Matsubara, Masato; Asahi, Ryoji; Takeuchi, Tsunehiro

    2011-01-01

    We have synthesized off-stoichiometric Ti-Ni-Sn half-Heusler thermoelectrics in order to investigate the relation between randomly distributed defects and thermoelectric properties. A small change in the composition of Ti-Ni-Sn causes a remarkable change in the thermal conductivity. An excess content of Ni realizes a low thermal conductivity of 2.93 W/mK at room temperature while keeping a high power factor. The low thermal conductivity originates in the defects generated by an excess content of Ni. To investigate the detailed defect structure, we have performed first-principles calculations and compared with x ray photoemission spectroscopy measurement. Based on these analyses, we conclude that the excess Ni atoms randomly occupy the vacant sites in the half-Heusler structure, which play as phonon scattering centers, resulting in significant improvement of the figure of merit without any substitutions of expensive heavy elements, such as Zr and Hf.

  19. Preparation of one-step NiO/Ni-CGO composites using factorial design; Efeitos do processamento e do teor de formador de poros na microestrutura de cermets Ni-CGO

    Energy Technology Data Exchange (ETDEWEB)

    Araujo, A.J.M. de; Sousa, A R.O. de; Camposa, L.F.A.; Macedo, D.A. [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil); Loureiro, F. J.A.; Fagg, D.P., E-mail: allanjp1993@hotmail.com [Universidade de Aveiro (Portugal)

    2016-07-01

    This work deals with the synthesis, processing and characterization of NiO/Ni- CGO composite materials as potential solid oxide fuel cell (SOFC) anodes. The particulate materials were obtained by a one-step synthesis method and characterized by thermal analysis (prior to calcination) and X-ray diffraction (calcined powder). The ceramic processing of samples containing from 30 to 70 wt.% NiO was carried out by factorial design. Besides the NiO content controlled during the chemical synthesis, the impacts of the pore-former content (citric acid, used in proportions of 0, 7.5 and 15 wt.%) and the sintering temperature (1300, 1350 and 1400 °C) were also investigated. The open porosity of NiO-CGO composites and reduced Ni-CGO cermets was modeled as a function of factors (NiO content, citric acid content and sintering temperature) and interaction of factors. (author)

  20. Probing the semi-magicity of $^{68}$Ni via the $^{66}$Ni(t,p)$^{68}$Ni two-neutron transfer reaction in inverse kinematics

    CERN Document Server

    AUTHOR|(CDS)2079390; Van Duppen, Piet

    The region around the nucleus $^{68}$Ni, with a shell closure for its protons at Z=28 and a harmonic oscillator shell gap for its neutrons at N=40, has drawn considerable interest over the past decades. $^{68}$Ni has properties that are typical for a doubly-magic nucleus, such as a high excitation energy and low B($E2:2^{+} \\rightarrow 0^{+}$) transition probability for the first excited 2$^{+}$ level and a 0$^{+}$ level as the first excited state. However, it has been suggested that the magic properties of $^{68}$Ni arise due to the fact that the N=40 separates the negative parity $pf$-shell from the positive parity 1$g_{9/2}$ orbital, and indeed, recent mass measurements have not revealed a clear N = 40 energy gap. Despite all additional information that was acquired over the last decade the specific role of the N=40 is not yet understood and a new experimental approach to study $^{68}$Ni was proposed. Namely, a two-neutron transfer reaction on $^{66}$Ni to characterize and disentangle the structure of the ...

  1. Determination of standard Ghibbs free energy of formation of NiW sub 2 B sub 2 and activity of Ni-W binary system by EMF measurement. Kidenryokuho ni yoru NiW sub 2 B sub 2 no hyojun seisei Gibbs jiyu energy to Ni-W 2 seibunkei no katsuryo no sokutei

    Energy Technology Data Exchange (ETDEWEB)

    Kayama, Koichiro; Hashimoto, Yasuhiko; Suzuki, Kenji; Matsuo, Hideki (Himeji Inst. of Tech., Hyogo (Japan) Fukushin Electric Co., Ltd., Hyogo (Japan))

    1989-12-25

    NiW {sub 2} B {sub 2} (M phase), existing in trinary Ni-W-B system, was measured in standard Gibbs free energy (GF) of formation in the temperature range from 1273K to 1423K by an electromotive force method (EMF) with use of solid oxide electrolyte. First, oxide phase in equilibrium with three-phase M-W-Ni solid solution region was confirmed to be B {sub 2} O {sub 3}. Binary Ni-W system solid solution in equilibrium with M phase and W phase is constant in composition with Ni-16.4mo1%W in the above temperature range. WO {sub 2} and WO {sub 2.72} were actually measured in GF. As Ni-W solid solution is in equilibrium with WO {sub 2} and WO {sub 2.72}, binary Ni-W system was measured in activity by the EMF, and Ni-16.4mo1%W solid solution was calculated in GF of mixing by use of the above measured GF of WO {sub 2} and WO {sub 2.72}. Finally with use of sample in M-W-Ni solid solution region, M phase was calculated in GF by the EMF. The result of those calculations were expressed with experimental formulas. 19 refs., 10 figs., 3 tabs.

  2. Ni3Si2 nanowires grown in situ on Ni foam for high-performance supercapacitors

    Science.gov (United States)

    Jiang, Yizhe; Li, Zhihui; Li, Beibei; Zhang, Jinying; Niu, Chunming

    2016-07-01

    Ni3Si2 nanowires and nanoawls have grown in situ on the surface of Ni foams by a controlled low pressure chemical vapor deposition process. Structural characterization shows that the individual Ni3Si2 nanowire is single crystal covered with a thin layer (1-2 nm) of SiO2 with a diameter of ∼20-30 nm and length of ten's micrometers. Individual nanoawl with a circular cone shape is polycrystalline. Both Ni3Si2 nanowire and nanoawl samples are evaluated as potential electrode materials for supercapacitors. The nanowire electrode delivers a very high specific capacitance and excellent rate capability. A specific capacitance of 760 F g-1 is measured at current density of 0.5 A g-1, which decreases to 518 F g-1 when the current density increases to 10 A g-1. The capacitance is dominated by pseudocapacitance with a mechanism similar to that of NiO or Ni(OH)2 widely studied in the literature. An asymmetric supercapacitor fabricated by pairing Ni3Si2 nanowire electrode with an activated carbon electrode exhibits energy densities of 17.5 Wh kg-1 and 8.8 Wh kg-1 at power densites of 301 W kg-1 and 3000 W kg-1.

  3. Fluorescence x-ray absorption fine structure studies of Fe-Ni-S and Fe-Ni-Si melts to 1600 K

    Science.gov (United States)

    Manghnani, M. H.; Hong, X.; Balogh, J.; Amulele, G.; Sekar, M.; Newville, M.

    2008-04-01

    We report NiK -edge fluorescence x-ray absorption fine structure spectra (XAFS) for Fe0.75Ni0.05S0.20 and Fe0.75Ni0.05Si0.20 ternary alloys from room temperature up to 1600 K. A high-temperature furnace designed for these studies incorporates two x-ray transparent windows and enables both a vertical orientation of the molten sample and a wide opening angle, so that XAFS can be measured in the fluorescence mode with a detector at 90° with respect to the incident x-ray beam. An analysis of the Ni XAFS data for these two alloys indicates different local structural environments for Ni in Fe0.75Ni0.05S0.20 and Fe0.75Ni0.05Si0.20 melts, with more Ni-Si coordination than Ni-S coordination persisting from room temperature through melting. These results suggest that light elements such as S and Si may impact the structural and chemical properties of Fe-Ni alloys with a composition similar to the earth’s core.

  4. Bio-desulfurization technology in Japan; Wagakuni ni okeru baio datsuryu gijutsu

    Energy Technology Data Exchange (ETDEWEB)

    Maruhashi, K. [Petroleum Energy Center, Tokyo (Japan)

    2000-05-01

    A bio-reaction of microbes (catalytic reaction by an enzyme) is characterized in that the reaction is carried out at a normal temperature and under a normal pressure and has particularly high specificity with respect to substrate (reactant). It is considered that a low loading process of environment harmony type can be constructed by applying the bio-reaction in petroleum refinery process. CO{sub 2} exhaust and energy consumption in the bio-desulfurization (BDS) is estimated to be 70 to 80% lower than those in hydrodesulfurization (HDS). The bio-technologies that can be applied to the petroleum refinery process include, for example, desulfurization, demetallation, dewaxing, denitration, cracking and so on. In this paper, the present state of bio-desulphurization technology is introduced. Particularly, as the research results in Japan, acquirement of mesophile R.erythropolis KA2-5-1 strain, thermophile Paenibacillus sp. A11-2 strain whose optimum temperature is 50 degrees C, BT degradation fungus Rhodococcus sp. T09 and the like are introduced. (NEDO)

  5. Nipah Virus (NiV)

    Science.gov (United States)

    ... Form Controls Cancel Submit Search the CDC Nipah Virus (NiV) Note: Javascript is disabled or is not ... gov . Recommend on Facebook Tweet Share Compartir Nipah virus (NiV) is a member of the family Paramyxoviridae , ...

  6. Thermal stability of electrodeposited Ni and Ni-Co layers; an EBSD-study

    DEFF Research Database (Denmark)

    Rasmussen, Anette Alsted; Gholinia, A.; Trimby, P.W.

    2004-01-01

    The influence of heat treatment on the microstructure and the microtexture of electrodeposited Ni and Ni-Co layers was investigated with Electron Backscatter Diffraction (EBSD) with high resolution. Samples were annealed for 1 hour at 523 K and 673 K, the temperature region wherein...

  7. Structure characterization of Ni/NiO and Ti/TiO2 interfaces

    International Nuclear Information System (INIS)

    Lamine, Brahim

    1983-01-01

    This research thesis reports the structure characterization of Ni-NiO and Ti-TiO 2 interfaces through an in-situ investigation of thin blade oxidation, of oxide germination and growth, and through a determination of mutual metal/oxide orientation relationships. Thin films of TiO 2 have also been characterized and the study of the influence of vacuum annealing on TiO 2 layer structure and morphology has been attempted. The examination of metal-oxide interface reveals a duplex structure of NiO and TiO 2 layers, and a preferential grain boundary oxidation of the underlying metal [fr

  8. The study of quasi-projectiles produced in Ni+Ni and Ni+Au collisions: excitation energy and spin

    International Nuclear Information System (INIS)

    Buta, A.

    2003-02-01

    During the collision between the projectile and the target nuclei in the intermediate energy regime (E < 100 MeV/nucleon) two excited nuclei are mainly observed in the exit channel, the quasi projectile (QP) and the quasi target. They disintegrate by particle emission. However, this binary picture is perturbed by the emission of particles and light fragments with velocities intermediate between the projectile velocity and the target one, all along the interaction (midrapidity component). This work aim to determine the excitation energy and the intrinsic angular momentum (or spin) of quasi-projectiles produced in the Ni+Ni and Ni+Au collisions at 52 and 90 MeV/nucleon. The excitation energy is deduced from the kinematical characteristics of particles emitted by the quasi-projectile. They have to be separated from midrapidity particles. Three different scenarios have been used for this purpose. The spin of the quasi-projectile has been extracted from the experimental data by mean of proton and alpha particles multiplicities emitted by the QP in the Ni+Au at 52 MeV/nucleon reaction. The results have been compared to the predictions of a theoretical model based on nucleon transfers. Their evolution is qualitatively reproduced as a function of the violence of the collision. (author)

  9. Bulk-compositional changes of Ni2Al3 and NiAl3 during ion etching

    International Nuclear Information System (INIS)

    Chen Houwen; Wang Rong

    2008-01-01

    Bulk-compositional changes of Ni 2 Al 3 and NiAl 3 in a Ni-50 wt% Al alloy during ion etching have been investigated by transmission electron microscopy and energy dispersive X-ray spectroscopic analyses. After etching with 7, 5 and 3 keV Ar + ions for 15, 24 and 100 h nickel contents in both Ni 2 Al 3 and NiAl 3 exceeded greatly those in the initial compounds and increased with the decrement of the sputtering energy. After 100 h etching with 3 keV Ar + ions the compositions of these two compounds reached a similar value, about Ni 80-83 Al 12-15 Fe 3-4 Cr 1-2 (at%). A synergistic action of preferential sputtering, radiation-induced segregation and radiation-enhanced diffusion enables the altered-layers at the top and bottom of the film extend through the whole film. The bulk-compositional changes are proposed to occur in the unsteady-state sputtering regime of ion etching and caused by an insufficient supply of matter in a thin film

  10. Fragmentation of neutron-hole strengths in 59Ni observed in the 60Ni(p, d) 59Ni reaction at 65 MeV

    International Nuclear Information System (INIS)

    Matoba, M.; Ohgaki, H.; Kugimiya, H.; Ijiri, H.; Maki, T.; Nakano, M.

    1995-01-01

    The 60 Ni(p, d) 59 Ni reaction has been studied with 65 MeV polarized protons. Angular distributions of the differential cross section and analyzing power have been measured for neutron hole states in 59 Ni up to the excitation energies of 7 MeV. The data analysis with a standard distorted-wave Born approximation theory provides transferred angular momenta l, j and spectroscopic factors for thirty-nine transitions. The nuclear damping mechanism of the single hole states is discussed. ((orig.))

  11. Impact of La Niña and La Niña Modoki on Indonesia rainfall variability

    Science.gov (United States)

    Hidayat, R.; Juniarti, MD; Ma’rufah, U.

    2018-05-01

    La Niña events are indicated by cooling SST in central and eastern equatorial Pacific. While La Niña Modoki occurrences are indicated by cooling SST in central Pacific and warming SST in western and eastern equatorial Pacific. These two events are influencing rainfall variability in several regions including Indonesia. The objective of this study is to analyse the impact of La Niña and La Niña Modoki on Indonesian rainfall variability. We found the Nino 3.4 index is highly correlated (r = -0.95) with Indonesian rainfall. Positive rainfall anomalies up to 200 mm/month occurred mostly in Indonesian region during La Niña events, but in DJF several areas of Sumatera, Kalimantan and eastern Indonesia tend to have negative rainfall. During La Niña Modoki events, positive rainfall anomaly (up to 50 mm/month) occurred in Sumatera Island, Kalimantan, Java and eastern Indonesia in DJF and up to 175 mm/month occurred only in Java Island in MAM season. La Niña events have strong cooling SST in central and eastern equatorial Pacific (-1.5°C) in DJF. While La Niña Modoki events warming SST occurred in western and eastern equatorial Pacific (0.75°C) and cooling SST in central Pacific (- 0.75°C) in DJF and MAM. Walker circulation in La Niña Modoki events (on DJF and MAM) showed strong convergence in eastern Pacific, and weak convergence in western Pacific (Indonesia).

  12. Influence of Ni/Co molar ratio on electromagnetic properties and microwave absorption performances for Ni/Co paraffin composites

    Energy Technology Data Exchange (ETDEWEB)

    Yan, S.J., E-mail: shaojiuyan@126.com [Department of Structural Steel, Functional Materials and Heat Treatment Processing, AVIC Beijing Institute of Aeronautical Materials, Beijing 100095 (China); Aviation Key Laboratory of Science and Technology on Stealth Materials, Beijing 100095 (China); Dai, S.L. [The Office of AVIC Beijing Institute of Aeronautical Materials, Beijing 100095 (China); Ding, H.Y.; Wang, Z.Y. [Aviation Key Laboratory of Science and Technology on Stealth Materials, Beijing 100095 (China); Liu, D.B [Department of Structural Steel, Functional Materials and Heat Treatment Processing, AVIC Beijing Institute of Aeronautical Materials, Beijing 100095 (China)

    2014-05-01

    Ni and Co metallic microparticles with submicron size were synthesized with a simple wet chemical reduction method at a relatively low temperature. Then their morphologies and structures were characterized by SEM and XRD. Ni metallic microparticles have spherical-shape morphology with fcc crystalline structure, however, Co has a distinct leaf-like morphology with the fcc and hcp mixed phases crystalline structures. For the characterization of their electromagnetic properties, paraffin matrix composites containing different molar ratio Ni and Co mixture powder as fillers were prepared. It was found that both the electromagnetic properties and electromagnetic microwave absorption performances of absorber layer were remarkably influenced by Ni/Co molar ratio. The electromagnetic microwave absorption performances were significantly improved by blending Ni and Co metallic microparticles into paraffin matrix with changing Ni/Co molar ratio, and enhanced mechanism were discussed. - Highlights: • Ni and Co microparticles were synthesized by a wet chemical reduction method. • EM properties of absorber were remarkably influenced by Ni/Co molar ratio. • EMA performances can be adjusted by artificially changing Co/Ni molar ratio. • Enhanced EMA performances result from multiple EM attenuation mechanisms.

  13. Neutron enrichment at midrapidity in {sup 58}Ni + {sup 58}Ni at 52 MeV/u

    Energy Technology Data Exchange (ETDEWEB)

    Theriault, D; Vallee, A; Gingras, L; Larochelle, Y; Roy, R; April, A; Beaulieu, L; Grenier, F; Lemieux, F; Moisan, J; Samri, M; Saint-Pierre, C; Turbide, S [Laval Univ., Lab. de Physique Nucleaire, Dept. de Physique, Quebec City, PQ (Canada); Yennello, S J; Martin, E; Winchester, E [Texas A and M Univ., College Station, TX (United States). Cyclotron Inst.

    2003-07-01

    By combining data from a charged particle {sup 58}Ni + {sup 58}Ni experiment at 52 MeV/u with an {sup 36}Ar + {sup 58}Ni experiment at 50 MeV/u for which free neutrons have been detected, an increase in the neutron to proton ratio of the whole nuclear material at midrapidity has been experimentally observed in the reaction {sup 58}Ni + {sup 58}Ni at 52 MeV/u. The neutron to proton ratio is measured above the initial neutron to proton ratio of the system. Neutron to proton ratio of the quasi-projectile emission is analysed for the same reactions and is seen to decrease below the ratio of the initial system. (authors)

  14. Superstructure of NiAs

    International Nuclear Information System (INIS)

    Nozue, Tatsuhiro; Kobayashi, Hisao; Kamimura, Takashi; Yamaguchi, Yasuo

    2001-01-01

    The structural transition in NiAs was studied by neutron diffraction on the single crystalline sample. The crystal structure of NiAs has been reported to be bottom-centered orthorhombic with Cmc2 1 symmetry (niccolite-type). The measurement of temperature dependence of the powder X-ray diffraction revealed that NiAs undergoes a structural transition to the NiAs-type at T t =335 K. In present neutron diffraction experiment at room temperature, we observed the reflections indexed on the basis of the orthorhombic unit cell. The intensities of these reflections are qualitatively explained in terms of the niccolite-type structure with taking account of three domain structures, except for the weak reflections indexed as (001), (003) and (012). Then, the intensities of (001), (002) and (004) reflections were measured in temperature range of 20 to 420 K. The temperature dependences of (002) and (004) reflections qualitatively agree with those of the calculated intensities using the atomic positions of niccolite-type structure. However, the temperature dependence of (001) reflection shows the anomaly around T t , which suggests the symmetry of crystal structure of NiAs is not the Cmc2 1 symmetry. (author)

  15. Hierarchical NiCo2 O4 nanosheets grown on Ni nanofoam as high-performance electrodes for supercapacitors.

    Science.gov (United States)

    Gao, Guoxin; Wu, Hao Bin; Ding, Shujiang; Liu, Li-Min; Lou, Xiong Wen David

    2015-02-18

    A high-performance electrode for supercapacitors is designed and synthesized by growing electroactive NiCo2 O4 nanosheets on conductive Ni nanofoam. Because of the structural advantages, the as-prepared Ni@NiCo2 O4 hybrid nanostructure exhibits significantly improved electrochemical performance with high capacitance, excellent rate capability, and good cycling stability. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Ni(salen): a system that forms many solvates with interacting Ni atoms

    NARCIS (Netherlands)

    Siegler, M.A.M.; Lutz, M.

    2009-01-01

    Recrystallization of [N,N’-Ethylene-bis(salicylideneiminato)]-nickel(II) [Ni(salen)] has been carried out from a large selection of solvents. Crystals can be either solvent free or solvates. This study is based on X-ray crystal structure determinations, which include the redetermination of Ni(salen)

  17. The Ce-Ni-Si system as a representative of the rare earth-Ni-Si family: Isothermal section and new rare-earth nickel silicides

    Energy Technology Data Exchange (ETDEWEB)

    Morozkin, A.V., E-mail: morozkin@tech.chem.msu.ru [Department of Chemistry, Moscow State University, Leninskie Gory, House 1, Building 3, Moscow, GSP-1, 119991 (Russian Federation); Knotko, A.V.; Garshev, A.V. [Department of Chemistry, Moscow State University, Leninskie Gory, House 1, Building 3, Moscow, GSP-1, 119991 (Russian Federation); Faculty of Materials Science, Moscow State University, Leninskie Gory, House 1, Building 73, Moscow, GSP-1, 119991 (Russian Federation); Yapaskurt, V.O. [Department of Petrology, Geological Faculty Moscow State University, Leninskie Gory, Moscow 119991 (Russian Federation); Nirmala, R. [Indian Institute of Technology Madras, Chennai 600036 (India); Quezado, S.; Malik, S.K. [Departamento de Física Teórica e Experimental, Universidade Federal do Rio Grande do Norte, Natal, 59082-970 (Brazil)

    2016-11-15

    The Ce-Ni-Si system has been investigated at 870/1070 K by X-ray and microprobe analyses. The existence of the known compounds, i.e.: Ce{sub 2}Ni{sub 15.8}Si{sub 1.2} (Th{sub 2}Ni{sub 17}-type), Ce{sub 2}Ni{sub 15-14}Si{sub 2-3} (Th{sub 2}Zn{sub 17}-type), CeNi{sub 8.6}Si{sub 2.4} (BaCd{sub 11}-type), CeNi{sub 8.8}Si{sub 4.2} (LaCo{sub 9}Si{sub 4}-type), CeNi{sub 6}Si{sub 6} (CeNi{sub 6}Si{sub 6}-type), CeNi{sub 5}Si{sub 1-0.3} (TbCu{sub 7}-type), CeNi{sub 4}Si (YNi{sub 4}Si-type), CeNi{sub 2}Si{sub 2} (CeGa{sub 2}Al{sub 2}-type), Ce{sub 2}Ni{sub 3}Si{sub 5} (U{sub 2}Co{sub 3}Si{sub 5}-type), Ce{sub 3}Ni{sub 6}Si{sub 2} (Ce{sub 3}Ni{sub 6}Si{sub 2}-type), Ce{sub 3}Ni{sub 4}Si{sub 4} (U{sub 3}Ni{sub 4}Si{sub 4}-type), CeNiSi{sub 2} (CeNiSi{sub 2}-type), ~CeNi{sub 1.3}Si{sub 0.7} (unknown type structure), Ce{sub 6}Ni{sub 7}Si{sub 4} (Pr{sub 6}Ni{sub 7}Si{sub 4}-type), CeNiSi (LaPtSi-type), CeNi{sub 0.8-0.3}Si{sub 1.2-1.7} (AlB{sub 2}-type), ~Ce{sub 2}Ni{sub 2}Si (unknown type structure), ~Ce{sub 4.5}Ni{sub 3.5}Si{sub 2} (unknown type structure), Ce{sub 15}Ni{sub 7}Si{sub 10} (Pr{sub 15}Ni{sub 7}Si{sub 10}-type), Ce{sub 5}Ni{sub 1.85}Si{sub 3} (Ce{sub 5}Ni{sub 1.85}Si{sub 3}-type), Ce{sub 6}Ni{sub 1.4}Si{sub 3.4} (Ce{sub 6}Ni{sub 1.67}Si{sub 3}-type), Ce{sub 7}Ni{sub 2}Si{sub 5} (Ce{sub 7}Ni{sub 2}Si{sub 5}-type) and Ce{sub 3}NiSi{sub 3} (Y{sub 3}NiSi{sub 3}-type) has been confirmed in this section. Moreover, the type structure has been determined for ~Ce{sub 2}Ni{sub 2}Si (Mo{sub 2}NiB{sub 2}-type Ce{sub 2}Ni{sub 2.5}Si{sub 0.5}) and ~Ce{sub 4.5}Ni{sub 3.5}Si{sub 2} (W{sub 3}CoB{sub 3}-type Ce{sub 3}Ni{sub 3-2.7}Si{sub 1-1.3}) and new ternary phases Ce{sub 2}Ni{sub 6.25}Si{sub 0.75} (Gd{sub 2}Co{sub 7}-type), CeNi{sub 7-7.6}Si{sub 6-5.4} (GdNi{sub 7}Si{sub 6}-type) and ~Ce{sub 27}Ni{sub 42}Si{sub 31} (unknown type structure) have been identified in this system. Quasi-binary phases, solid solutions, were detected at 870/1070 K for CeNi{sub 5}, CeNi{sub 3} and Ce

  18. Density of Liquid Ni-Cr Alloy

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    The density of liquid Ni-Cr alloy was measured by a modified sessile drop method. The density of liquid Ni-Cr alloywas found to decrease with increasing temperature and Cr concentration in the alloy. The molar volume of liquidNi-Cr alloy increases with increasing the Cr concentration in the alloy. The molar volume of Ni-Cr alloy determinedin the present work shows a positive deviation from the linear molar volume.

  19. Tritium-tracer study of catalytic hydrogenation reaction of ethylene on Ni, Pt and Ni-Pt

    International Nuclear Information System (INIS)

    Matsuyama, M.; Yasuda, Y.; Takeuchi, T.

    1978-01-01

    The influence of the pressure of tritiated hydrogen on the rate of the formation of tritiated ethylene, X, and that of tritiated ethane, Z, in the hydrogenation reaction of ethylene on Ni, Pt and Ni-Pt (1:1) alloy catalysts was investigated. The ratio of the rate of the exchange to that of the hydrogenation, selectivity X/Z, decreased markedly with the increase in the pressure of the tritiated hydrogen and the order of X/Z was Ni>Ni-Pt>Pt. These results were interpreted in terms of the difference in the amount of chemisorbed tritium on each metal catalyst. (orig.) [de

  20. Densities of molten Ni-(Cr, Co, W) superalloys

    Institute of Scientific and Technical Information of China (English)

    XIAO Feng; YANG Ren-hui; FANG Liang; LIU Lan-xiao; ZHAO Hong-kai

    2008-01-01

    In order to obtain more accurate density for molten Ni-(Cr, Co, W) binary alloy, the densities of molten pure Ni and Ni-Cr, Ni-Co, Ni-W alloys were measured with a sessile drop method. It is found that the measured densities of molten pure Ni and Ni-Cr, Ni-Co, Ni-W alloys decrease with increasing temperature in the experimental temperature range. The density of alloys increases with increasing W and Co concentrations while it decreases with increasing Cr concentration in the alloy at 1 773-1 873 K. The molar volume of Ni-based alloys increases with increasing W concentration while it decreases with increasing Co concentration. The effect of Cr concentration on the molar volume of the alloy is little in the studied concentration range. The accommodation among atomic species was analyzed. The deviation of molar volume from ideal mixing shows an ideal mixing of Ni-(Cr, Co, W) binary alloys.

  1. Photochemical deposition of NiCoO x thin films from Ni/Co heteronuclear triketonate complexes

    International Nuclear Information System (INIS)

    Buono-Core, G.E.; Tejos, M.; Cabello, G.; Guzman, N.; Hill, R.H.

    2006-01-01

    UV light irradiation of thin films of a polyketonate Ni/Co heteronuclear complex, NiCo(DBA) 2 [DBA, dibenzoylacetone)], spin coated on Si(1 0 0) substrates produced NiCoO x mixed oxides as amorphous films. On annealing at 600 deg. C under air, the mixed oxide film decomposed to NiO and CoO as indicated by XRD measurements. The morphology of the as-deposited films was examined by AFM analysis showing a smooth surface with low rms roughness values. The ratio of Ni/Co (1.08) present in the film reflects the stoichiometry in the starting compound within the experimental error, as shown by XPS analysis. The large amount of carbon (20.8%) detected on the surface of the film may be due to the presence of phenyl rings in the precursor complex

  2. Improved ethanol electrooxidation performance by shortening Pd-Ni active site distance in Pd-Ni-P nanocatalysts

    Science.gov (United States)

    Chen, Lin; Lu, Lilin; Zhu, Hengli; Chen, Yueguang; Huang, Yu; Li, Yadong; Wang, Leyu

    2017-01-01

    Incorporating oxophilic metals into noble metal-based catalysts represents an emerging strategy to improve the catalytic performance of electrocatalysts in fuel cells. However, effects of the distance between the noble metal and oxophilic metal active sites on the catalytic performance have rarely been investigated. Herein, we report on ultrasmall (~5 nm) Pd-Ni-P ternary nanoparticles for ethanol electrooxidation. The activity is improved up to 4.95 A per mgPd, which is 6.88 times higher than commercial Pd/C (0.72 A per mgPd), by shortening the distance between Pd and Ni active sites, achieved through shape transformation from Pd/Ni-P heterodimers into Pd-Ni-P nanoparticles and tuning the Ni/Pd atomic ratio to 1:1. Density functional theory calculations reveal that the improved activity and stability stems from the promoted production of free OH radicals (on Ni active sites) which facilitate the oxidative removal of carbonaceous poison and combination with CH3CO radicals on adjacent Pd active sites.

  3. The constitution of the ternary system Ti-Ni-C; Die Konstitution des Dreistoffes Ti-Ni-C

    Energy Technology Data Exchange (ETDEWEB)

    Schuster, J.C.; Du, Y. [Technische Univ., Vienna (Austria). Inst. fuer Physikalische Chemie

    1998-12-31

    The system Ti-Ni-C was completely re-examined taking a new approach applying XRD, DTA, SEM-EDX and light microscopy, for elaboration of a complete thermodynamic description of the system. The carbon solubility in the binary Ti-Ni compounds is of significance only in the Ti{sub 2}Ni phase, and was found to be 4 at% at 900 C. The thermodynamic description thus achieved enables precise determination of the solubilities of Ti and C in solid or liquid nickel. (orig./CB) [Deutsch] Das System Ti-Ni-C wurde mittels XRD, DTA, SEM-EDX und Lichtmikroskopie umfassend neu untersucht mit dem Ziel, eine komplette thermodynamische Beschreibung zu ermoeglichen. Die Kohlenstoffloeslichkeit in den binaeren Ti-Ni Verbindungen ist nur fuer die Phase Ti{sub 2}Ni signifikant. Bei 900 C betrug sie 4 at% C. Die erarbeitete thermodynamische Beschreibung erlaubt eine praezise Darstellung der Ti- und C-Loeslichkeiten in festem und fluessigem Nickel. (orig.)

  4. Elevator group control during morning rush-hours; Erebeta gun kanri ni okeru shukkinji unten ni tsuite

    Energy Technology Data Exchange (ETDEWEB)

    Hikita, S. [Mitsubishi Electric Corp., Tokyo (Japan); Komaya, K. [Mitsubishi Electric Corp., Tokyo (Japan). Industrial Electronics and Systems Lab.

    1995-11-30

    In a high-rising building, a group control system is indispensable which controls elevators systematically in order to improve efficiency of transportation. The group control and supervision are divided into two kinds namely the allocated control and the operation control. The former is the control to determine the optimal elevator which is to respond to a call of an individual passenger and the latter is the control to determine the operational practice as an elevator group in response to changes of the macroscopic traffic flows which are repeated periodically like morning rush hours or a lunch time. In this article, the meaning of the operation during morning rush hours has been discussed, the effect of the operation during the rush hours has been verified through simulation, and as a result, it has been verified that the determination of number of elevator cages to be arranged by the number of passengers (in particular the number of passengers from the main floor) is not necessarily related to improvement of total transportation efficiency. Besides, after analyzing the behavior of the group of elevators under the morning rush hour operation, the new index for determination of the optimal number of elevator cages at the main floor has been established, a new practice for determining the number of cages to be arranged based on the above has been proposed, and its effect has been verified. 7 refs., 10 figs.

  5. Global environmental problems in the electric industry. Denki jigyo ni okeru chikyu kankyo mondai ni tsuite

    Energy Technology Data Exchange (ETDEWEB)

    Sugi, T [Tokyo Electric Power Co., Inc. (Japan)

    1992-09-30

    Since the electric industry has grappled with a prevention of the environmental pollution such as the air pollution and water contamination as a forerunner in case of construction and operation of the power facilities, and at the same time has conducted actively the environmental conservation countermeasures, it has consequently achieved the environmental conservation level as a top level in the world. On the other hand, as for the emission quantity of CO2 relating to the earth warming, the power field occupies about one fourth of total Japan. Therefore the electric industry should aim at the electric energy supply considering the influence on the environment, such as the power supply structure to restrain CO2 emission as less as possible, higher efficiency of equipments, higher efficiency of energy utilization by using the unused energy and so forth. In addition to it, the consumer side should aim at the social structure with a recycle type such as saving resources and saving energy, and aim at changeover of life style. It is hoped to conduct the overall measure including the items mentioned above. In this report, the recent trend of earth enviromental problems, grappling with the environmental problems as a forerunner such as the prevention measure of air pollution in the thermal power plant, etc., and the correspondence to the earth warming problems are outlined. 11 refs., 9 figs., 3 tabs.

  6. Hydrogen storage properties of LaMgNi3.6M0.4 (M = Ni, Co, Mn, Cu, Al) alloys

    International Nuclear Information System (INIS)

    Yang, Tai; Zhai, Tingting; Yuan, Zeming; Bu, Wengang; Xu, Sheng; Zhang, Yanghuan

    2014-01-01

    Highlights: • La–Mg–Ni system AB 2 -type alloys were prepared by induction melting. • Structures and lattice parameters were analysed by XRD. • Hydrogen absorption/desorption performances were studied. • Mechanisms of hydrogen absorption capacity fading were investigated. - Abstract: LaMgNi 3.6 M 0.4 (M = Ni, Co, Mn, Cu, Al) alloys were prepared through induction melting process. The phase compositions and crystal structures were characterised via X-ray diffraction (XRD). The hydrogen storage properties, including activation performance, hydrogen absorption capacity, cycle stability, alloy particle pulverisation and plateau pressure, were systemically investigated. Results show that Ni, Co, Mn and Cu substitution alloys exhibit multiphase structures comprising the main phase LaMgNi 4 and the secondary phase LaNi 5 . However, the secondary phase of the Al substitution alloy changes into LaAlNi 4 . The lattice parameters and cell volumes of the LaMgNi 4 phase follow the order Ni < Co < Al < Cu < Mn. Activation is simplified through partial substitution of Ni with Al, Cu and Co. The hydrogen absorption capacities of all of the alloys are approximately 1.7 wt.% at the first activation process; however, they rapidly decrease with increasing cycle number. In addition, the stabilities of hydriding and dehydriding cycles decrease in the order Al > Co > Ni > Cu > Mn. Hydriding processes result in numerous cracks and amorphisation of the LaMgNi 4 phase in the alloys. The p–c isotherms were determined by a Sieverts-type apparatus. Two plateaus were observed for the Ni, Co and Al substitution alloys, whereas only one plateau was found for Mn and Cu. This result was caused by the amorphisation of the LaMgNi 4 phase during the hydriding cycles. Reversible absorption and desorption of hydrogen are difficult to achieve. Substitutions of Ni with Co, Mn, Cu and Al significantly influence the reduction of hysteresis between hydriding and dehydriding

  7. Estilos de vida saludables de niños, niñas y adolescentes

    Directory of Open Access Journals (Sweden)

    Lilia Campo-Ternera

    2017-01-01

    Full Text Available Objetivo: Describir los estilos de vida saludables de niños, niñas y adolescentes de Barranquilla. Materiales y métodos: Estudio descriptivo de corte transversal en 991 niños, niñas y ado - lescentes. Se evaluó la actividad física mediante los cuestionarios de Actividad Física para Adolescentes y para niños escolares; se aplicó una encuesta que midió los conocimientos y prácticas de los escolares sobre salud bucal, lavado de manos, consumo de frutas y verduras y cuidado postural; la Lista de Chequeo “Mi Vida en la Escuela”, la cual evalúa los índices de “bullying” y agresión; y la inteligencia emocional a través dela escala TMMS -24. Resultados: El 65,4 % se categoriza como inactivos físicamente. Solo el 14,7% de los estudiantes reconoce que el peso máximo del bolso es el 10 % de su peso corporal; el 34,1 % cambia el cepillo de dientes cada 3 meses, como lo recomiendan los expertos, y 48,4 % se cepilla los dientes entre 2 y 3 veces al día. El 16,6 % no se lava las manos antes y después de ir al baño y 9,4 % no lo hace antes y después de las comidas; el 17,5 % no tiene un buen consumo de verduras y frutas; y se encontró un Índice de “bullying” en el 55,6 % de los participantes. Conclusión: Los anteriores resultados obligan a plantear intervenciones que incrementen las prácticas saludables en niños, niñas y adolescentes.

  8. Tungsten inert gas (TIG) welding of Ni-rich NiTi plates: functional behavior

    Science.gov (United States)

    Oliveira, J. P.; Barbosa, D.; Braz Fernandes, F. M.; Miranda, R. M.

    2016-03-01

    It is often reported that, to successfully join NiTi shape memory alloys, fusion-based processes with reduced thermal affected regions (as in laser welding) are required. This paper describes an experimental study performed on the tungsten inert gas (TIG) welding of 1.5 mm thick plates of Ni-rich NiTi. The functional behavior of the joints was assessed. The superelasticity was analyzed by cycling tests at maximum imposed strains of 4, 8 and 12% and for a total of 600 cycles, without rupture. The superelastic plateau was observed, in the stress-strain curves, 30 MPa below that of the base material. Shape-memory effect was evidenced by bending tests with full recovery of the initial shape of the welded joints. In parallel, uniaxial tensile tests of the joints showed a tensile strength of 700 MPa and an elongation to rupture of 20%. The elongation is the highest reported for fusion-welding of NiTi, including laser welding. These results can be of great interest for the wide-spread inclusion of NiTi in complex shaped components requiring welding, since TIG is not an expensive process and is simple to operate and implement in industrial environments.

  9. Niños y Violencia

    OpenAIRE

    International Child Development Centre

    1997-01-01

    Este Innocenti Digest explora la violencia de los niños y hacia los niños, usando el marco de la Convención de los Derechos del Niño de las Naciones Unidas. Se centra en la violencia interpersonal, tanto intrafamiliar como extrafamiliar. Se incluye el abuso sexual y la explotación ya que a pesar de no implicar obligatoriamente violencia o coerción, la mayor parte de la evidencia demuestra su efectos dañinos tanto físicos como psicológicos. También se discute la implicación de los niños en los...

  10. Precipitation-induced of partial annealing of Ni-rich NiTi shape memory alloy

    Science.gov (United States)

    Nashrudin, Muhammad Naqib; Mahmud, Abdus Samad; Mohamad, Hishamiakim

    2018-05-01

    NiTi shape memory alloy behavior is very sensitive to alloy composition and heat treatment processes. Thermomechanical behavior of near-equiatomic alloy is normally enhanced by partial anneal of a cold-worked specimen. The shape memory behavior of Ni-rich alloy can be enhanced by ageing precipitation. This work studied the effect of simultaneous partial annealing and ageing precipitation of a Ni-rich cold drawn Ti-50.9at%Ni wire towards martensite phase transformation behavior. Ageing treatment of a non-cold worked specimen was also done for comparison. It was found that the increase of heat treatment temperature caused the forward transformation stress to decrease for the cold worked and non-cold worked specimens. Strain recovery on the reverse transformation of the cold worked wire improved compared to the non-cold worked wire as the temperature increased.

  11. Facile in situ synthesis of hierarchical porous Ni/Ni(OH)₂ hybrid sponges with excellent electrochemical energy-storage performances for supercapacitors.

    Science.gov (United States)

    Wang, Wanren; Wang, Wenhua; Wang, Mengjiao; Guo, Xiaohui

    2014-09-01

    Herein, we report the in situ growth of single-crystalline Ni(OH)2 nanoflakes on a Ni support by using facile hydrothermal processes. The as-prepared Ni/Ni(OH)2 sponges were well-characterized by using X-ray diffraction (XRD), SEM, TEM, and X-ray photoelectron spectroscopy (XPS) techniques. The results revealed that the nickel-skeleton-supported Ni(OH)2 rope-like aggregates were composed of numerous intercrossed single-crystal Ni(OH)2 flake-like units. The Ni/Ni(OH)2 hybrid sponges served as electrodes and displayed ultrahigh specific capacitance (SC=3247 F g(-1)) and excellent rate-capability performance, likely owing to fast electron and ion transport, sufficient Faradic redox reaction, and robust structural integrity of the Ni/Ni(OH)2 hybrid electrode. These results support the promising application of Ni(OH)2 nanoflakes as advanced pseudocapacitor materials. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Enhanced photocatalytic efficiency in zirconia buffered n-NiO/p-NiO single crystalline heterostructures by nanosecond laser treatment

    Energy Technology Data Exchange (ETDEWEB)

    Molaei, R.; Bayati, M. R.; Alipour, H. M.; Nori, S.; Narayan, J. [Department of Materials Science and Engineering, NC State University, EB-1, Raleigh, North Carolina 27695-7907 (United States)

    2013-06-21

    We report the formation of NiO based single crystalline p-n junctions with enhanced photocatalytic activity induced by pulsed laser irradiation. The NiO epilayers were grown on Si(001) substrates buffered with cubic yttria-stabilized zirconia (c-YSZ) by using pulsed laser deposition. The NiO/c-YSZ/Si heterostructures were subsequently laser treated by 5 pulses of KrF excimer laser (pulse duration = 25 Multiplication-Sign 10{sup -9} s) at lower energies. Microstructural studies, conducted by X-ray diffraction ({theta}-2{theta} and {phi} techniques) and high resolution transmission electron microscope, showed a cube-on-cube epitaxial relationship at the c-YSZ/Si interface; the epitaxial relationship across the NiO/c-YSZ interface was established as NiO<111 > Double-Vertical-Line Double-Vertical-Line c-YSZ<001> and in-plane NiO<110> Double-Vertical-Line Double-Vertical-Line c-YSZ<100>. Electron microscopy studies showed that the interface between the laser annealed and the pristine region as well as the NiO/c-YSZ interface was atomically sharp and crystallographically continuous. The formation of point defects, namely oxygen vacancies and NiO, due to the coupling of the laser photons with the NiO epilayers was confirmed by XPS. The p-type electrical characteristics of the pristine NiO epilayers turned to an n-type behavior and the electrical conductivity was increased by one order of magnitude after laser treatment. Photocatalytic activity of the pristine (p-NiO/c-YSZ/Si) and the laser-annealed (n-NiO/p-NiO/c-YSZ/Si) heterostructures were assessed by measuring the decomposition rate of 4-chlorophenol under UV light. The photocatalytic reaction rate constants were determined to be 0.0059 and 0.0092 min{sup -1} for the as-deposited and the laser-treated samples, respectively. The enhanced photocatalytic efficiency was attributed to the suppressed charge carrier recombination in the NiO based p-n junctions and higher electrical conductivity. Besides, the oxygen vacancies

  13. 从对电视剧《施琅大将军》的争论看 中国文化民族主义复兴的困境 (The Dilemma of Chinese Cultural Nationalism: the Case of the TV Program 'General Shi Lang'

    Directory of Open Access Journals (Sweden)

    Mobo Gao

    2007-01-01

    Full Text Available With the rise of China's status on international stage as a result of its economic development there is an increasingly audible voice of Chinese cultural nationalism. More and more educators and intellectuals are calling for the revival of Chinese traditional culture values. However, the very issues of who are the Chinese and what are traditional Chinese cultural values present a huge dilemma. The debates on a recent a TV program "General Shi Lang" consist a good case to illustrate this dilemma. Shi Lang was a general of the last days of the Ming Dynasty, but had surrendered to the Manchu Qing dynasty invaders and fought for the Machus take over Taiwan from a Chinese ruler. The debates show that the dilemma has its cause in at least three issues. First, it is not at all obvious who should be categorized as Chinese. Secondly, it is not at all obvious what Chinese cultural values are. And finally it is the issue of evaluation of traditional values against the universal claim of the values of liberal democracy.

  14. Fabrication and characterization of single segment CoNiP and multisegment CoNiP/Au nanowires

    International Nuclear Information System (INIS)

    Luu Van Thiem; Le Tuan Tu

    2014-01-01

    This paper presents the fabrication of CoNiP single segment and CoNiP/Au multisegment nanowires. We have fabricated these nanowires by electrodeposition method into polycarbonate templates with a nominal pore diameter about 100 nm. The hysteresis loops were measured with the applied magnetic field parallel and perpendicular to the wire axis using a vibrating sample magnetometer (VSM). The structure morphology was observed by Scanning Electron Microscopy (SEM) and the element composition of CoNiP/Au multisegment nanowires were analyzed by EDS. The results show that nanowires are very uniform with the diameter of 100 nm. The observed coercivity (H C ) and squareness (Mr/Ms) of CoNiP single segment nanowires are larger than the CoNiP/Au multisegment nanowires. (author)

  15. Natural Ni speciation in the Callovo-Oxfordian clay rocks: implications for potential 63Ni isotopic exchange and retention mechanisms

    International Nuclear Information System (INIS)

    Grangeon, S.; Tournassat, C.; Schaefer, T.; Lerouge, C.; Wille, G.; Giffaut, E.

    2010-01-01

    Document available in extended abstract form only. In the perspective of deep underground long-term nuclear waste storage, 63 Ni is considered as a priority radio-element to be studied. 63 Ni behaviour prediction is made difficult mainly because its geochemical behaviour is still subject to debate. For instance, the solubility of Ni simple compounds at high pH is ill-defined, and the knowledge on solubility control phases is still pending. Clay rocks such as Callovo-Oxfordian (COx) contain non negligible amounts of natural and stable isotopes of Ni. As a consequence, a good understanding of the natural speciation of Ni in the formation could help to understand 63 Ni controls in this environment, including long term isotopic exchange with naturally present Ni. We focused our study on the COx formation, where the Bure (France) ANDRA underground research laboratory is located. Speciation of naturally occurring Ni was studied by combining chemical, microscopic and spectrometric methods. Chemical methods consisted of total rock analyses and sequential extractions on various COx samples representative of the variability of the formation (from carbonate rich samples to clay rich samples). This method enabled quantifying the main Ni reservoirs. Physical methods were used to get a closer look at the Ni-bearing phases. Optical and scanning electron microscopy techniques were used to identify and isolate minerals from thin rock sections, originating from different geological horizons. Chemical results indicate that the mean Ni concentration in the Callovo-Oxfordian clay rock is of ∼30 ppm (10 -6 g/g). Identified Ni-bearing minerals were mainly primary minerals (biotite, chlorite, muscovite), calcite and pyrite; organic matter being also observed. Electron microprobe and X-ray fluorescence analyses were performed in order to quantify the amounts and variability of Ni contents in these different Callovo-Oxfordian components. Ni is occasionally present in primary minerals with

  16. Dye-sensitized MIL-101 metal organic frameworks loaded with Ni/NiOx nanoparticles for efficient visible-light-driven hydrogen generation

    Directory of Open Access Journals (Sweden)

    Xin-Ling Liu

    2015-10-01

    Full Text Available The Ni/NiOx particles were in situ photodeposited on MIL-101 metal organic frameworks as catalysts for boosting H2 generation from Erythrosin B dye sensitization under visible-light irradiation. The highest H2 production rate of 125 μmol h−1 was achieved from the system containing 5 wt. % Ni-loaded MIL-101 (20 mg and 30 mg Erythrosin B dye. Moreover, the Ni/NiOx catalysts show excellent stability for long-term photocatalytic reaction. The enhancement on H2 generation is attributed to the efficient charge transfer from photoexcited dye to the Ni catalyst via MIL-101. Our results demonstrate that the economical Ni/NiOx particles are durable and active catalysts for photocatalytic H2 generation.

  17. Controlled synthesis of mesoporous β-Ni(OH){sub 2} and NiO nanospheres with enhanced electrochemical performance

    Energy Technology Data Exchange (ETDEWEB)

    Xing, Shengtao; Wang, Qian [College of Chemistry and Material Sciences, Hebei Normal University, Shijiazhuang 050016 (China); Ma, Zichuan, E-mail: mazc@vip.163.com [College of Chemistry and Material Sciences, Hebei Normal University, Shijiazhuang 050016 (China); Wu, Yinsu; Gao, Yuanzhe [College of Chemistry and Material Sciences, Hebei Normal University, Shijiazhuang 050016 (China)

    2012-09-15

    Highlights: ► Uniform mesoporous β-Ni(OH){sub 2} and NiO nanospheres with hierarchical structures were synthesized by a simple complexation–precipitation method. ► Both ammonia and citrate played an important role for the formation of mesoporous nanospheres. ► β-Ni(OH){sub 2} and NiO nanospheres showed excellent capacitive properties due to their mesoporous structures and larger surface areas. -- Abstract: Uniform mesoporous β-Ni(OH){sub 2} and NiO nanospheres with hierarchical structures were synthesized by a facile complexation–precipitation method. The effects of ammonia and citrate on the structure and morphology of the products were thoroughly investigated by X-ray powder diffraction, scanning electron microscopy, transmission electron microscopy and nitrogen adsorption–desorption measurements. The results indicated that ammonia played an important role for the formation of flowerlike spheres assembled from nanosheets. The addition of citrate could remarkably reduce the particle sizes and increase the specific surface areas of flowerlike spheres. A possible formation mechanism based on the experimental results was proposed to understand their growing procedures. β-Ni(OH){sub 2} and NiO nanospheres prepared with the addition of citrate showed excellent capacitive properties due to their mesoporous structures and large surface areas, suggesting the importance of controlled synthesis of hierarchical nanostructures for their applications.

  18. Site determination of Ni atoms in Cu-Al-Ni shape memory alloys by electron channelling enhanced microanalysis

    International Nuclear Information System (INIS)

    Nakata, Yoshiyuki; Tadaki, Tsugio; Shimizu, Ken-ichi

    1990-01-01

    The crystallographic site of Ni atoms in the parent phase of differently heat-treated Cu-28.6Al-3.7Ni (at.%) shape memory alloys has been examined by electron channelling enhanced microanalysis (ALCHEMI) in order to clarify effects of heat-treatments on the Ni atom site and M s temperature. The heat-treatments were as follows: (a) Quenching into a 10% NaOH solution at 263 K, (b) Quenching into hot water at 363 K and (c) Aging at 523 K for 3.6 ks after treatment (b). The M s temperatures of specimens (a), (b) and (c) were 158, 185 and 259 K, respectively, increasing with lowering quenching rate or aging. ALCHEMI revealed that Ni atoms occupied an identical site in all the three kinds of specimens: The Ni atoms were located at the nearest neighbor sites around Al atoms. This preferential occupation of Ni atoms was attributed to the strong binding force between Ni and Al atoms. Thus, the change in M s temperature due to different heat-treatments was not directly related to the crystallographic site of Ni atoms, but might be caused by the ordering between the next nearest neighbor Cu and Al atoms. (author)

  19. 11C-radioisotope study of methanol co-reaction with ethanol over Ni-MCM-41 silica-alumina and Ni-alumina

    International Nuclear Information System (INIS)

    Sarkadi-Priboczki, E.; Kovacs, Z.; Tsoncheva, T.; Kumar, N.; Murzin, D.Yu.

    2009-01-01

    Complete text of publication follows. The Ni modifies the properties of acidic alumina and light acidic MCM-41 silica-alumina supports. The radioisotopic method is a suitable tool for distinction of the 11 Cradioisotopic methanol and its co-derivates from derivates of non-radioactive ethanol on these catalysts. Experimental. The Ni/A l 2O 3 (5 wt % Ni) is commercially available while H-MCMN-41 (Si/Al=20) and Ni-ion-exchanged MCM-41 silica-alumina (5 wt % Ni) were prepared and characterized in previous works. Before catalysis the Ni/Al 2 O 3 and Ni-MCM-41 were pre-reduced. The 11 C-methanol was formed by a radiochemical process from 11 C-carbon dioxide produced at cyclotron (T 1/2 = 20.4 min). The mixture of equivalent volume of radioactive methanol and non-radioactive ethanol was introduced into glass tube micro-flow reactor at ambient temperature. After adsorption, the valves were closed and the catalyst was heated up to the required temperatures. The desorption rate of the remaining 11 C-derivatives on catalysts were continuously followed by radiodetectors and the derivatives of methanol with ethanol were analyzed by Radio/FID-gas chromatography (FID is coupled on-line with a radiodetector). The ethanol and its derivates were identified by FID while the 11 C-methanol and its co-derivates (with ethanol) were detected by both of FID and radiodetector. Results The 11 C-dimethyl ether was the common product of the single 11 C-methanol transformation on H-MCM-41, Ni-MCM-41 and Ni- Al 2 O 3 at low temperature (200-280 degC) due to middle strong acid sites. At higher temperature (280-350 degC), the dimethyl ether and hydrocarbons were the dominant products on H-MCM-41 while dimethyl ether selectivity decreased on Ni-alumina and Ni-MCM-41 in favor of methane. The selectivities of methanol to formaldehyde and methane were the highest on Ni-MCM-41. During co-reaction of 11 C-methanol with non-radioactive ethanol, the 11 C-labeled coethers, namely 11 C-methyl ethyl ether

  20. Effects of Ni-5%RExOy Composite Additives on Electrochemical Hydrogen Storage Performances of Mg2Ni

    Directory of Open Access Journals (Sweden)

    ZHANG Guo-fang

    2017-11-01

    Full Text Available The Ni-5%RExOy (CeO2, La2O3, Eu2O3 as composite additives, Mg2Ni-Ni-5%RExOy composites were prepared by the ball milling method. The effects of different additives on the structure, morphology, electrochemistry and kinetic properties of Mg2Ni alloy were studied systematically. The results show that composite additives can improve the proportion of amorphous and nanocrystalline structure of Mg2Ni alloy. The particle size is homogeneous but the agglomeration is observed in the sample with Ni-5%CeO2 additives. The composites with additives show higher maximum discharge capacity and better cycle stabilities. All of these three kinds of composite additives can improve the kinetic properties of the composites effectively, including optimizing the charge-transfer ability, the reversibility of the electrochemical reaction on the alloy surface, and enhancing the diffusion coefficients of H atoms in the bulk of alloy. Among these three kinds of additives, Ni-5%CeO2 additive shows the best catalysis effect on promoting the kinetic properties of the composites.

  1. Synthesis and magnetic properties of multilayer Ni/Cu and NiFe/Cu ...

    Indian Academy of Sciences (India)

    The diameter of wires can be easily varied by pore size of alumina, ranging ... saturated HgCl2 solution to remove the remaining Al, and then dipped in 5 wt% ... for NiFe alloy it is 1.3 V, that is higher than for Ni/Cu nanowires to diminish Cu.

  2. Synthetic Ni3S2/Ni hybrid architectures as potential contrast agents in MRI

    International Nuclear Information System (INIS)

    Ma, J; Chen, K

    2016-01-01

    Traditional magnetic resonance imaging (MRI) contrast agents mainly include superparamagnetic (SPM) iron oxide nanoparticle as T 2 contrast agent for liver and paramagnetic Gd (III)-chelate as T 1 contrast agent for all organs. In this work, weak ferromagnetic kale-like and SPM cabbage-like Ni 3 S 2 @Ni hybrid architectures were synthesized and evaluated as potential T 1 MRI contrast agents. Their relatively small r 2 /r 1 ratios of 2.59 and 2.38, and high r 1 values of 11.27 and 4.89 mmol −1 L s −1 (for the kale-like and cabbage-like Ni 3 S 2 @Ni, respectively) will shed some light on the development of new-type MRI contrast agents. (paper)

  3. Martensitic transformation and magnetic properties of manganese-rich Ni-Mn-In and Ni-Mn-Sn Heusler alloys; Untersuchung der martensitischen Umwandlung und der magnetischen Eigenschaften Mangan-reicher Ni-Mn-In- und Ni-Mn-Sn-Heusler-Legierungen

    Energy Technology Data Exchange (ETDEWEB)

    Krenke, T.

    2007-06-29

    In the present work, the martensitic transition and the magnetic properties of Manganese rich Ni{sub 50}Mn{sub 50-x}Sn{sub x} and Ni{sub 50}Mn{sub 50-y}In{sub y} alloys with 5 at%{<=}x(y){<=}25 at% were investigated. Calorimetry, X-ray and neutron diffraction, magnetization, and strain measurements were performed on polycrystalline samples. It was shown that alloys close to the stoichiometric composition Ni{sub 50}Mn{sub 25}Sn{sub 25} and Ni{sub 50}Mn{sub 25}Sn{sub 25} do not exhibit a structural transition on lowering of the temperature, whereas alloys with x{<=}15 at% Tin and y{<=}16 at% Indium transform martensitically. The structural transition temperatures increase linearly with decreasing Tin or Indium content. The crystal structures of the low temperature martensite are modulated as well as unmodulated. Alloys with compositions close to stoichiometry are dominated by ferromagnetic interactions, whereas those close to the binary composition Ni{sub 50}Mn{sub 50} order antiferromagnetically. Ferromagnetic order and structural instability coexist in a narrow composition range between 13 at%{<=}x{<=}15 at% and 15 at%{<=}x{<=}16 at% for Ni{sub 50}Mn{sub 50-x}Sn{sub x} and Ni{sub 50}Mn{sub 50-y}In{sub y} respectively. As a consequence, interesting magnetoelastic effects are observed. The Ni{sub 50}Mn{sub 34}In{sub 16} alloy shows a magnetic field-induced structural transition, whereby application of an external magnetic field in the martensitic state stabilizes the high temperature L2{sub 1} structure. Evidence for this was given by neutron diffraction experiments in external magnetic fields. Moreover, the structural transition temperatures of this alloy show large magnetic field dependencies. By use of calorimetry, M(T), and strain measurements, changes in M{sub s} up to -11 K/Tesla are observed. Such large values have, until now, not been observed in Heusler alloys. Since during transformation the volume changes reversibly, magnetic field-induced strains of about

  4. La diversidad en la construcción de mundo de niños y niñas de dos culturas

    Directory of Open Access Journals (Sweden)

    Nolfa Ibáñez-Salgado

    2015-02-01

    Full Text Available Asumiendo la concepción de diversidad como distintas construcciones de mundo, pretendo en este trabajo develar las lógicas que guían las interacciones en las que participan niños y niñas de dos culturas: cultura mayor y cultura mapuche. Comparo las interacciones habituales en el hogar de niños y niñas de clase media de Santiago, y de niños y niñas mapuche de comunidades rurales, y posteriormente en sus respectivas aulas. La metodología es cualitativa, de enfoque etnográfico. Los resultados muestran que las lógicas que guían la interacción en las familias de los niños y niñas mapuche son distintas y en algunos casos opuestas a las que imperan en la escuela, que la diversidad no es acogida pedagógicamente por el profesorado, y que aprendizajes previos de los niños y niñas mapuche se invisibilizan en el aula.

  5. Structure determination of the ordered (2 × 1) phase of NiSi surface alloy on Ni(111) using low-energy electron diffraction

    Science.gov (United States)

    Sazzadur Rahman, Md.; Amirul Islam, Md.; Saha, Bidyut Baran; Nakagawa, Takeshi; Mizuno, Seigi

    2015-12-01

    The (2 × 1) structure of the two-dimensional nickel silicide surface alloy on Ni(111) was investigated using quantitative low-energy electron diffraction analysis. The unit cell of the determined silicide structure contains one Si and one Ni atom, corresponding to a chemical formula of NiSi. The Si atoms adopt substitutional face-centered cubic hollow sites on the Ni(111) substrate. The Ni-Si bond lengths were determined to be 2.37 and 2.34 Å. Both the alloy surface and the underlying first layers of Ni atoms exhibit slight corrugation. The Ni-Si interlayer distance is smaller than the Ni-Ni interlayer distance, which indicates that Si atoms and underlying Ni atoms strongly interact.

  6. In situ NiTi/Nb(Ti) composite

    International Nuclear Information System (INIS)

    Jiang, Daqiang; Cui, Lishan; Jiang, Jiang; Zheng, Yanjun

    2013-01-01

    Graphical abstract: - Highlights: • In situ NiTi/Nb(Ti) composites were fabricated. • The transformation temperature was affected by the mixing Ti:Ni atomic ratios. • The NiTi component became micron-scale lamella after forging and rolling. • The composite exhibited high strength and high damping capacity. - Abstract: This paper reports on the creation of a series of in situ NiTi/Nb(Ti) composites with controllable transformation temperatures based on the pseudo-binary hypereutectic transformation of NiTi–Nb system. The composite constituent morphology was controlled by forging and rolling. It is found that the thickness of the NiTi lamella in the composite reached micron level after the hot-forging and cold-rolling. The NiTi/Nb(Ti) composite exhibited high damping capacity as well as high yield strength

  7. When NiO@Ni Meets WS2 Nanosheet Array: A Highly Efficient and Ultrastable Electrocatalyst for Overall Water Splitting.

    Science.gov (United States)

    Wang, Dewen; Li, Qun; Han, Ce; Xing, Zhicai; Yang, Xiurong

    2018-01-24

    The development of low-cost, high-efficiency, and stable bifunctional electrocatalysts toward the hydrogen evolution reaction (HER) and oxygen evolution reaction (OER) is of paramount importance for large-scale water splitting. Here, we develop a new strategy for the first design and synthesis of a NiO@Ni decorated WS 2 nanosheet array on carbon cloth (NiO@Ni/WS 2 /CC) composite. This composite serves as a unique three-dimensional (3D) synergistic electrocatalyst that not only combines the intrinsic properties of individual NiO@Ni and WS 2 , but also exhibits significantly improved HER and OER activities when compared to that of pure NiO@Ni and WS 2 . This electrocatalyst possesses Pt-like activity for HER and exhibits better OER performance than that for commercial RuO 2 , as well as demonstrating superior long-term durability in alkaline media. Furthermore, it enables an alkaline electrolyzer with a current density of 10 mA cm -2 at a cell voltage as 1.42 V, which is the lowest one among all reported values to date. The excellent performance is mainly attributed to the unique 3D configuration and multicomponent synergies among NiO, Ni, and WS 2 . Our findings provide a new idea to design advanced bifunctional catalysts for water splitting.

  8. Work production using the two-way shape memory effect in NiTi and a Ni-rich NiTiHf high-temperature shape memory alloy

    International Nuclear Information System (INIS)

    Atli, K C; Karaman, I; Noebe, R D; Bigelow, G; Gaydosh, D

    2015-01-01

    The work output capacity of the two-way shape memory effect (TWSME) in a Ni 50.3 Ti 29.7 Hf 20 (at%) high-temperature shape memory alloy (HTSMA) was investigated and compared to that of binary Ni 49.9 Ti 50.1 (at%). TWSME was induced through a training procedure of 100 thermomechanical cycles under different tensile stresses. It was observed that TWSME in as-extruded and trained Ni 50.3 Ti 29.7 Hf 20 could produce 0.7% strain against a compressive stress of 100 MPa, corresponding to a maximum work output of 0.08 J g −1 , compared to a maximum value of 0.06 J g −1 for binary NiTi. A peak aging heat treatment of 3 h at 550 °C, which previously has been shown to result in near-perfect functional stability in Ni 50.3 Ti 29.7 Hf 20 during isobaric thermal cycling, did not improve the TWSME and actually resulted in a decrease in the magnitude and stability of the TWSME and its work output capacity. Nevertheless, the magnitude of TWSM behavior of Ni 50.3 Ti 29.7 Hf 20 , in the absence of an aging heat treatment, renders it an attractive candidate for high-temperature TWSM actuation. (paper)

  9. Ab-initio thermodynamic and elastic properties of AlNi and AlNi3 intermetallic compounds

    Science.gov (United States)

    Yalameha, Shahram; Vaez, Aminollah

    2018-04-01

    In this paper, thermodynamic and elastic properties of the AlNi and AlNi3 were investigated using density functional theory (DFT). The full-potential linearized augmented plane-wave (APW) in the framework of the generalized gradient approximation as used as implemented in the Wien2k package. The temperature dependence of thermal expansion coefficient, bulk modulus and heat capacity in a wide range of temperature (0-1600 K) were investigated. The calculated elastic properties of the compounds show that both intermetallic compounds of AlNi and AlNi3 have surprisingly negative Poisson’s ratio (NPR). The results were compared with other experimental and computational data.

  10. Nonvolatile memory characteristics influenced by the different crystallization of Ni-Si and Ni-N nanocrystals

    International Nuclear Information System (INIS)

    Chen, W.-R.; Yeh, J.-L.; Chang, C.-Y.; Chang, T.-C.; Chen, S.-C.

    2008-01-01

    The formation of Ni-Si and Ni-N nanocrystals by sputtering a Ni 0.3 Si 0.7 target in argon and nitrogen environment were proposed in this paper. A transmission electron microscope analysis shows the nanocrystals embedded in the nitride layer. X-ray photoelectron spectroscopy and x-ray diffraction also offer the chemical material analysis of nanocrystals with surrounding dielectric and the crystallization of nanocrystals for different thermal annealing treatments. Nonvolatile Ni-Si nanocrystal memories reveal superior electrical characteristics for charge storage capacity and reliability due to the improvement of thermal annealing treatment. In addition, we used energy band diagrams to explain the significance of surrounding dielectric for reliability

  11. Comparison of NiS2 and α-NiS hollow spheres for supercapacitors, non-enzymatic glucose sensors and water treatment.

    Science.gov (United States)

    Wei, Chengzhen; Cheng, Cheng; Cheng, Yanyan; Wang, Yan; Xu, Yazhou; Du, Weimin; Pang, Huan

    2015-10-21

    NiS2 hollow spheres are successfully prepared by a one-step template free method. Meanwhile, α-NiS hollow spheres can also be synthesized via the calcination of the pre-obtained NiS2 hollow spheres at 400 °C for 1 h in air. The electrochemical performances of the as-prepared NiS2 and α-NiS hollow sphere products are evaluated. When used for supercapacitors, compared with NiS2 hollow spheres, the α-NiS hollow sphere electrode shows a large specific capacitance of 717.3 F g(-1) at 0.6 A g(-1) and a good cycle life. Furthermore, NiS2 and α-NiS hollow spheres are successfully applied to fabricate non-enzymatic glucose sensors. In particular, the α-NiS hollow spheres exhibit good catalytic activity for the oxidation of glucose, a fast amperometric response time of less than 5 s, and the detection limit is estimated to be 0.08 μM. More importantly, compared with other normally co-existing interfering species, such as ascorbic acid, uric acid and dopamine, the electrode modified with α-NiS hollow spheres shows good selectivity. Moreover, the α-NiS hollow spheres also present good capacity to remove Congo red organic pollutants from wastewater by their surface adsorption ability.

  12. Mechanical alloying of the FeNi-Ag system

    International Nuclear Information System (INIS)

    Gonzalez, G.; Ibarra, D.; Ochoa, J.; Villalba, R.; Sagarzazu, A.

    2007-01-01

    The Fe-Ni-Ag system is of particular interest for its potential applications as soft magnetic granular material with small magnetic grains embedded in a non-magnetic metal matrix. Under equilibrium conditions: Fe-Ag and Ni-Ag are immiscible and Fe-Ni shows complete solubility. These materials are particularly important for magnetoresistivity properties. The properties of these alloys are closely related to their microstructure; therefore, a detailed study of the transformations occurring during milling was undertaken using pre-alloyed Fe x Ni 100-x (x = 30, 50 and 70) further milled with different Ag content to give the following alloys compositions (Fe x -Ni 100-x ) 100-y Ag y (y = 5, 20, 60). Consolidation of the mechanically alloyed powders by sintering at 950 o C was performed. Morphological and structural characterization of the sintered powders was carried out by scanning and transmission electron microscopy and X-ray diffraction. Fe 30 Ni 70 and Fe 50 Ni 50 formed ordered FeNi 3 compound. Fe 70 Ni 30 showed the formation of a mixture of γ-(Fe,Ni) and α-Fe(Ni) solid solutions. The mixture of these systems with Ag showed the metal solid solutions surrounded by Ag islands of Fe x Ni y -Ag, There was also evidence of Ag diffusing into the γ-(Fe,Ni). High Ag content (60%) shows formation of islands of FeNi surrounded by Ag. Sintering is always improved with the Ag content

  13. Development of improved HP/IP rotor material 2% CrMoNiWV (23 CrMoNiWV 88)

    International Nuclear Information System (INIS)

    Wiemann, W.

    1989-01-01

    The new 2% CrMoNiWV steel has a sufficient strength level, a very good creep (rupture) behaviour and an excellent toughness behaviour for a creep resistant steel. Even after long time high temperature exposure the toughness degradation is so small that it is still better than this of best 1% CrMo(Ni)V steels. The fatigue behaviour is well comparable to this of 1% CrMo(Ni)V. The 2% CrMoNiWV steel has the capability to substitute the traditional 1% CrMo(Ni)V. (orig.) With 26 annexes

  14. Study of hyperfine interactions in intermetallic compounds Gd(Ni,Pd,Cu)In, Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In; Estudo de interacoes hiperfinas em compostos intermetalicos Gd(Ni,Pd,Cu)In, Tb(Ni,Pd)In, Dy(Ni,Pd)In e Ho(Ni,Pd)In

    Energy Technology Data Exchange (ETDEWEB)

    Lapolli, Andre Luis

    2006-07-01

    Systematic behavior of magnetic hyperfine field (B{sub hf}) in the intermetallic compounds Gd(Ni,Pd,Cu)In Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In was studied by Perturbed Gamma-Gamma Angular Correlation spectroscopy. The measurements of B{sub hf} were carried out at the rare earth atom and in sites using the nuclear probes {sup 140}Ce and {sup 11}'1Cd respectively. The variation of hyperfine field with temperature, in most cases, follows the Brillouin function predicted from the molecular field theory. The hyperfine field values at rare earth atom sites obtained from {sup 140}Ce probe as well as at in sites obtained from {sup 111}Cd probe for each series of compounds were extrapolated to zero Kelvin B{sub hf}(T=0) from these curves. These values were compared with the values of the literature for other compounds containing the same rare earth element and all of them show a linear relationship with the ordering temperature. This indicates that the main contribution to B{sub hf} comes from the conduction electron polarization (CEP) through Fermi contact interaction and the principal mechanism of magnetic interaction in these compounds can be described by the RKKY type interaction. The values of B{sub hf}(T=0) for each family of intermetallic compounds RNiIn and RPdIn when plotted as a function of 4f spin projection of rare earth element also shows a linear relationship. Exceptions are the results for the compounds RNiIn obtained with {sup 111}Cd probe where a small deviation from linearity is observed. The results of the measurements carried out with the {sup 111}Cd probe were also analyzed to obtain the hyperfine parameters of the quadrupole interaction as a function of temperature for RPdln and GdNiIn compounds. The results show that for the compound GdPdIn there might be some Gd-In disorder at high temperature. (author)

  15. Study of hyperfine interactions in intermetallic compounds Gd(Ni,Pd,Cu)In, Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In; Estudo de interacoes hiperfinas em compostos intermetalicos Gd(Ni,Pd,Cu)In, Tb(Ni,Pd)In, Dy(Ni,Pd)In e Ho(Ni,Pd)In

    Energy Technology Data Exchange (ETDEWEB)

    Lapolli, Andre Luis

    2006-07-01

    Systematic behavior of magnetic hyperfine field (B{sub hf}) in the intermetallic compounds Gd(Ni,Pd,Cu)In Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In was studied by Perturbed Gamma-Gamma Angular Correlation spectroscopy. The measurements of B{sub hf} were carried out at the rare earth atom and in sites using the nuclear probes {sup 140}Ce and {sup 11}'1Cd respectively. The variation of hyperfine field with temperature, in most cases, follows the Brillouin function predicted from the molecular field theory. The hyperfine field values at rare earth atom sites obtained from {sup 140}Ce probe as well as at in sites obtained from {sup 111}Cd probe for each series of compounds were extrapolated to zero Kelvin B{sub hf}(T=0) from these curves. These values were compared with the values of the literature for other compounds containing the same rare earth element and all of them show a linear relationship with the ordering temperature. This indicates that the main contribution to B{sub hf} comes from the conduction electron polarization (CEP) through Fermi contact interaction and the principal mechanism of magnetic interaction in these compounds can be described by the RKKY type interaction. The values of B{sub hf}(T=0) for each family of intermetallic compounds RNiIn and RPdIn when plotted as a function of 4f spin projection of rare earth element also shows a linear relationship. Exceptions are the results for the compounds RNiIn obtained with {sup 111}Cd probe where a small deviation from linearity is observed. The results of the measurements carried out with the {sup 111}Cd probe were also analyzed to obtain the hyperfine parameters of the quadrupole interaction as a function of temperature for RPdln and GdNiIn compounds. The results show that for the compound GdPdIn there might be some Gd-In disorder at high temperature. (author)

  16. Martensitic transformation and magnetic properties of manganese-rich Ni-Mn-In and Ni-Mn-Sn Heusler alloys

    International Nuclear Information System (INIS)

    Krenke, T.

    2007-01-01

    In the present work, the martensitic transition and the magnetic properties of Manganese rich Ni 50 Mn 50-x Sn x and Ni 50 Mn 50-y In y alloys with 5 at%≤x(y)≤25 at% were investigated. Calorimetry, X-ray and neutron diffraction, magnetization, and strain measurements were performed on polycrystalline samples. It was shown that alloys close to the stoichiometric composition Ni 50 Mn 25 Sn 25 and Ni 50 Mn 25 Sn 25 do not exhibit a structural transition on lowering of the temperature, whereas alloys with x≤15 at% Tin and y≤16 at% Indium transform martensitically. The structural transition temperatures increase linearly with decreasing Tin or Indium content. The crystal structures of the low temperature martensite are modulated as well as unmodulated. Alloys with compositions close to stoichiometry are dominated by ferromagnetic interactions, whereas those close to the binary composition Ni 50 Mn 50 order antiferromagnetically. Ferromagnetic order and structural instability coexist in a narrow composition range between 13 at%≤x≤15 at% and 15 at%≤x≤16 at% for Ni 50 Mn 50-x Sn x and Ni 50 Mn 50-y In y respectively. As a consequence, interesting magnetoelastic effects are observed. The Ni 50 Mn 34 In 16 alloy shows a magnetic field-induced structural transition, whereby application of an external magnetic field in the martensitic state stabilizes the high temperature L2 1 structure. Evidence for this was given by neutron diffraction experiments in external magnetic fields. Moreover, the structural transition temperatures of this alloy show large magnetic field dependencies. By use of calorimetry, M(T), and strain measurements, changes in M s up to -11 K/Tesla are observed. Such large values have, until now, not been observed in Heusler alloys. Since during transformation the volume changes reversibly, magnetic field-induced strains of about 0.12 % appear. Additionally, the alloys Ni 50 Mn 35 Sn 15 , Ni 50 Mn 37 Sn 13 , Ni 50 Mn 34 In 16 , Ni 51.5 Mn 33 In

  17. Growing imbedded Ni3C-rich layer with sharp interfaces by means of ion beam mixing of C/Ni layers

    International Nuclear Information System (INIS)

    Barna, Arpad; Kotis, Laszlo; Labar, Janos; Sulyok, Attila; Toth, Attila L; Menyhard, Miklos; Panjan, Peter

    2011-01-01

    C/Ni bilayers of various layer thicknesses (20-40 nm) were ion bombarded using Ga + and Ni + projectiles of energies 20 and 30 keV. Ion bombardment resulted in the growth of a Ni 3 C rich layer with the following features: (a) sharp carbon/Ni 3 C rich layer interface, (b) the amount of Ni 3 C produced by the irradiation proportional to the square root of the fluence and dependent on the type of projectile, (c) good correlation between the distribution of vacancies produced by the ion bombardment and the distribution of Ni 3 C. The formation of the metastable Ni 3 C compound was explained by a vacancy-assisted process. The sharp interface is the consequence of a relaxation process removing the intermixed Ni from the carbon layer. The square root of fluence dependence of the thickness of the Ni 3 C-rich layer can be explained by a usual diffusion equation considering moving boundaries.

  18. Microstructure investigation of NiAl-Cr(Mo) interface in a directionally solidified NiAl-Cr(Mo) eutectic alloyed with refractory metal

    International Nuclear Information System (INIS)

    Chen, Y.X.; Cui, C.Y.; Guo, J.T.; Li, D.X.

    2004-01-01

    The microstructure of a directionally solidified NiAl-Cr(Mo) eutectic alloyed with refractory metal in as-processed and heat-treated states has been studied by means of scanning electron microscopy and high resolution electron microscopy (HREM). The microstructure of the NiAl-Cr(Mo) eutectic was characterized by lamellar Cr(Mo) phases embedded within NiAl matrix with common growth direction of . The interface between NiAl and lamellar Cr(Mo) did not have any transition layers. Misfit dislocations were observed at the NiAl-Cr(Mo) interface. In addition to lamellar Cr(Mo) phases, coherent Cr(Mo, Ni, Al) precipitates and NiAl precipitates were also observed in the NiAl matrix and lamellar Cr(Mo) phases, respectively. After hot isostatic pressing and heat treatment, the NiAl-Cr(Mo) interfaces became smooth and straight. Square array of misfit dislocations was directly observed at the (0 0 1) interface between NiAl and Cr(Mo, Ni, Al) precipitate. The configuration of misfit dislocation network showed a generally good agreement with prediction based on the geometric O-lattice model

  19. Direct evidence of Ni magnetic moment in TbNi{sub 2}Mn—X-ray magnetic circular dichroism

    Energy Technology Data Exchange (ETDEWEB)

    Yu, D.H., E-mail: dyu@ansto.gov.au [Bragg Institute, Australian Nuclear Science and Technology Organisation, Lucas Heights, Sydney, NSW 2234 (Australia); Huang, Meng-Jie [National Synchrotron Radiation Research Center, 101 Hsin-Ann Road, Hsinchu Science Park, Hsinchu 30076, Taiwan (China); Wang, J.L. [Bragg Institute, Australian Nuclear Science and Technology Organisation, Lucas Heights, Sydney, NSW 2234 (Australia); School of Physical, Environmental and Mathematical Sciences, University of New South Wales, Canberra at the Australian Defense Force Academy, Sydney, ACT 2600 (Australia); Institute for Superconductivity and Electronic Materials, University of Wollongong, Wollongong, NSW 2522 (Australia); Su, Hui-Chia; Lin, Hong-Ji; Chen, Chien-Te [National Synchrotron Radiation Research Center, 101 Hsin-Ann Road, Hsinchu Science Park, Hsinchu 30076, Taiwan (China); Campbell, S.J. [School of Physical, Environmental and Mathematical Sciences, University of New South Wales, Canberra at the Australian Defense Force Academy, Sydney, ACT 2600 (Australia)

    2014-12-15

    We have investigated the individual magnetic moments of Ni, Mn and Tb atoms in the intermetallic compound TbNi{sub 2}Mn in the Laves phase (magnetic phase transition temperature T{sub C} ∼131 K) by X-ray magnetic circular dichroism (XMCD) studies at 300 K, 80 K and 20 K. Analyses of the experimental results reveal that Ni atoms at 20 K in an applied magnetic field of 1 T carry an intrinsic magnetic moment of spin and orbital magnetic moment contributions 0.53±0.01 μ{sub B} and 0.05±0.01 μ{sub B}, respectively. These moment values are similar to those of the maximum saturated moment of Ni element. A very small magnetic moment of order <0.1 μ{sub B} has been measured for Mn. This suggests that Mn is antiferromagnetically ordered across the two nearly equally occupied sites of 16d and 8a. A magnetic moment of up to ∼0.3 μ{sub B} has been observed for the Tb atoms. Identification of a magnetic moment on the Ni atoms has provided further evidence for the mechanism of enhancement of the magnetic phase transition temperature in TbNi{sub 2}Mn compared with TbNi{sub 2} (T{sub C}∼37.5 K) and TbMn{sub 2} (T{sub C}∼54 K) due to rare earth–transition metal (R–T) and transition metal–transition metal (T–T) interactions. The behaviour of the X-ray magnetic circular dichroism spectra of TbNi{sub 2}Mn at 300 K, 80 K and 20 K – above and below the magnetic ordering temperature T{sub C} ∼131 K – is discussed. - Highlights: • We study the magnetic moment of TbNi{sub 2}Mn with XMCD. • We observe directly the Ni intrinsic magnetic moment in TbNi{sub 2}Mn. • We find that Mn ordered antiferromagnetically across the 16d and 8a sites. • We confirm the mechanism for increasing the magnetic phase transition temperature.

  20. Effect of NiO growth conditions on the bipolar resistance memory switching of Pt/NiO/SRO structure

    International Nuclear Information System (INIS)

    Kurnia, F.; Hadiyawarman, H.; Jung, C. U.; Liu, C. L.; Lee, S. B.; Yang, S. M.; Park, H. W.; Song, S. J.; Hwang, C. S.

    2010-01-01

    We deposited NiO thin films with SrRuO 3 bottom electrodes on SrTiO 3 (001) substrates by using pulsed laser deposition. The growth temperature and the oxygen pressure were varied in order to obtain NiO films with different structural and electrical properties. We investigated the I-V characteristics of the Pt/NiO/SRO structures and observed a strong dependence of bipolar resistance switching on the growth conditions of the NiO thin films. Stable bipolar memory resistance switching was observed only in the devices with NiO films deposited at 400 .deg. C and 10 mTorr of O 2 . The off-state I-V curve of bipolar switching showed a linear fitting to the Schottky effect, indicating its origin in the NiO/SRO interface. Our results suggest that the growth conditions of NiO may affect the bipolar switching behavior through the film's resistance, the film's crystallinity, or the status of the grain boundaries.

  1. Sputtering yields of Si and Ni from the Ni sub(1-x)Si sub(x) system studied by Rutherford backscattering spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Kim, S C; Yamaguchi, S; Kataoka, Y; Iwami, M; Hiraki, A [Osaka Univ., Suita (Japan). Faculty of Engineering; Satou, M; Fujimoto, F

    1982-01-01

    Sputtering yields of Si and Ni from thin layer films of Ni-Si compounds (Ni sub(1-x)Si sub(x)), including the pure materials (Ni and Si), caused by 5keV Ar/sup +/ ion bombardment were investigated using backscattering spectrometry. The sputtering yield for Si from Ni sub(1-x)Si sub(x) increased with increasing Si concentration. However, there is an abrupt decrease in the yield for Si concentrations above NiSi/sub 2/ to pure Si. This is in clear contrast to the sputtering yield of Ni from Ni sub(1-x)Si sub(x) which increased with increasing Ni concentration monotonously. These results are discussed on the basis of both the difference in the atomic density and the electronic state of the alloy.

  2. Remarkable sensitivity for detection of bisphenol A on a gold electrode modified with nickel tetraamino phthalocyanine containing Ni-O-Ni bridges.

    Science.gov (United States)

    Chauke, Vongani; Matemadombo, Fungisai; Nyokong, Tebello

    2010-06-15

    This work reports the electrocatalysis of bisphenol A on Ni(II) tetraamino metallophthalocyanine (NiTAPc) polymer modified gold electrode containing Ni-O-Ni bridges (represented as Ni(OH)TAPc). The Ni(II)TAPc films were electro-transformed in 0.1 mol L(-1) NaOH aqueous solution to form 'O-Ni-O oxo bridges', forming poly-n-Ni(OH)TAPc (where n is the number of polymerising scans). poly-30-Ni(OH)TAPc, poly-50-Ni(OH)TAPc, poly-70-Ni(OH)TAPc and poly-90-Ni(OH)TAPc films were investigated. The polymeric films were characterised by electrochemical impedance spectroscopy and the charge transfer resistance (R(CT)) values increased with film thickness. The best catalytic activity for the detection of bisphenol A was on poly-70-Ni(OH)TAPc. Electrode resistance to passivation improved with polymer thickness. The electrocatalytic behaviour of bisphenol A was compared to that of p-nitrophenol in terms of electrode passivation and regeneration. The latter was found to passivate the electrode less than the former. The poly-70-Ni(OH)TAPc modified electrode could reliably detect bisphenol A in a concentration range of 7x10(-4) to 3x10(-2)mol L(-1) with a limit of detection of 3.68x10(-9)mol L(-1). The sensitivity was 3.26x10(-4)A mol(-1) L cm(-2). Copyright 2010 Elsevier B.V. All rights reserved.

  3. The irradiation hardening of Ni-Mo-Cr and Ni-W-Cr alloy under Xe26+ ion irradiation

    Science.gov (United States)

    Chen, Huaican; Hai, Yang; Liu, Renduo; Jiang, Li; Ye, Xiang-xi; Li, Jianjian; Xue, Wandong; Wang, Wanxia; Tang, Ming; Yan, Long; Yin, Wen; Zhou, Xingtai

    2018-04-01

    The irradiation hardening of Ni-Mo-Cr and Ni-W-Cr alloy was investigated. 7 MeV Xe26+ ion irradiation was performed at room temperature and 650 °C with peak damage dose from 0.05 to 10 dpa. With the increase of damage dose, the hardness of Ni-Mo-Cr and Ni-W-Cr alloy increases, and reaches saturation at damage dose ≥1 dpa. Moreover, the damage dose dependence of hardness in both alloys can be described by the Makin and Minter's equation, where the effective critical volume of obstacles can be used to represent irradiation hardening resistance of the alloys. Our results also show that Ni-W-Cr alloy has better irradiation hardening resistance than Ni-Mo-Cr alloy. This is ascribed to the fact that the W, instead of Mo in the alloy, can suppress the formation of defects under ion irradiation.

  4. Synthesis and characterization of n-type NiO:Al thin films for fabrication of p-n NiO homojunctions

    Science.gov (United States)

    Sun, Hui; Liao, Ming-Han; Chen, Sheng-Chi; Li, Zhi-Yue; Lin, Po-Chun; Song, Shu-Mei

    2018-03-01

    n-type NiO:Al thin films were deposited by RF magnetron sputtering. Their optoelectronic properties versus Al target power was investigated. The results show that with increasing Al target power, the conduction type of NiO films changes from p-type to n-type. The variation of the film’s electrical and optical properties depends on Al amount in the film. When Al target power is relatively low, Al3+ cations tend to enter nickel vacancy sites, which makes the lattice structure of NiO more complete. This improves the carrier mobility and film’s transmittance. However, when Al target power exceeds 40 W, Al atoms begin to enter into interstitial sites and form an Al cluster in the NiO film. This behavior is beneficial for improving the film’s n-type conductivity but degrades the film’s transmittance. Finally, Al/(p-type NiO)/(n-type NiO:Al)/ITO homojunctions were fabricated. Their performance was compared with Al/(p-type NiO)/ITO heterojunctions without an n-type NiO layer. Thanks to the better interface quality between the two NiO layers, the homojunctions present better performance.

  5. Ni/Ni-YSZ current collector/anode dual layer hollow fibers for micro-tubular solid oxide fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Kanawka, K.; Othman, M.H.D.; Droushiotis, N.; Wu, Z.; Kelsall, G.; Li, K. [Department of Chemical Engineering and Chemical Technology, Imperial College London, London SW7 2AZ (United Kingdom)

    2011-10-15

    A co-extrusion technique was employed to fabricate a novel dual layer NiO/NiO-YSZ hollow fiber (HF) precursor which was then co-sintered at 1,400 C and reduced at 700 C to form, respectively, a meshed porous inner Ni current collector and outer Ni-YSZ anode layers for SOFC applications. The inner thin and highly porous ''mesh-like'' pure Ni layer of approximately 50 {mu}m in thickness functions as a current collector in micro-tubular solid oxide fuel cell (SOFC), aiming at highly efficient current collection with low fuel diffusion resistance, while the thicker outer Ni-YSZ layer of 260 {mu}m acts as an anode, providing also major mechanical strength to the dual-layer HF. Achieved morphology consisted of short finger-like voids originating from the inner lumen of the HF, and a sponge-like structure filling most of the Ni-YSZ anode layer, which is considered to be suitable macrostructure for anode SOFC system. The electrical conductivity of the meshed porous inner Ni layer is measured to be 77.5 x 10{sup 5} S m{sup -1}. This result is significantly higher than previous reported results on single layer Ni-YSZ HFs, which performs not only as a catalyst for the oxidation reaction, but also as a current collector. These results highlight the advantages of this novel dual-layer HF design as a new and highly efficient way of collecting current from the lumen of micro-tubular SOFC. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Surface Modification of NiTi Alloy via Cathodic Plasma Electrolytic Deposition and its Effect on Ni Ion Release and Osteoblast Behaviors

    International Nuclear Information System (INIS)

    Yan Ying; Cai Kaiyong; Yang Weihu; Liu Peng

    2013-01-01

    To reduce Ni ion release and improve biocompatibility of NiTi alloy, the cathodic plasma electrolytic deposition (CPED) technique was used to fabricate ceramic coating onto a NiTi alloy surface. The formation of a coating with a rough and micro-textured surface was confirmed by X-ray diffraction, scanning electron microscopy, and energy-dispersive X-ray spectroscopy, respectively. An inductively coupled plasma mass spectrometry test showed that the formed coating significantly reduced the release of Ni ions from the NiTi alloy in simulated body fluid. The influence of CPED treated NiTi substrates on the biological behaviors of osteoblasts, including cell adhesion, cell viability, and osteogenic differentiation function (alkaline phosphatase), was investigated in vitro. Immunofluorescence staining of nuclei revealed that the CPED treated NiTi alloy was favorable for cell growth. Osteoblasts on CPED modified NiTi alloy showed greater cell viability than those for the native NiTi substrate after 4 and 7 days cultures. More importantly, osteoblasts cultured onto a modified NiTi sample displayed significantly higher differentiation levels of alkaline phosphatase. The results suggested that surface functionalization of NiTi alloy with ceramic coating via the CPED technique was beneficial for cell proliferation and differentiation. The approach presented here is useful for NiTi implants to enhance bone osteointegration and reduce Ni ion release in vitro

  7. Surface Modification of NiTi Alloy via Cathodic Plasma Electrolytic Deposition and its Effect on Ni Ion Release and Osteoblast Behaviors

    Science.gov (United States)

    Yan, Ying; Cai, Kaiyong; Yang, Weihu; Liu, Peng

    2013-07-01

    To reduce Ni ion release and improve biocompatibility of NiTi alloy, the cathodic plasma electrolytic deposition (CPED) technique was used to fabricate ceramic coating onto a NiTi alloy surface. The formation of a coating with a rough and micro-textured surface was confirmed by X-ray diffraction, scanning electron microscopy, and energy-dispersive X-ray spectroscopy, respectively. An inductively coupled plasma mass spectrometry test showed that the formed coating significantly reduced the release of Ni ions from the NiTi alloy in simulated body fluid. The influence of CPED treated NiTi substrates on the biological behaviors of osteoblasts, including cell adhesion, cell viability, and osteogenic differentiation function (alkaline phosphatase), was investigated in vitro. Immunofluorescence staining of nuclei revealed that the CPED treated NiTi alloy was favorable for cell growth. Osteoblasts on CPED modified NiTi alloy showed greater cell viability than those for the native NiTi substrate after 4 and 7 days cultures. More importantly, osteoblasts cultured onto a modified NiTi sample displayed significantly higher differentiation levels of alkaline phosphatase. The results suggested that surface functionalization of NiTi alloy with ceramic coating via the CPED technique was beneficial for cell proliferation and differentiation. The approach presented here is useful for NiTi implants to enhance bone osseointegration and reduce Ni ion release in vitro.

  8. Moessbauer effect measurements on the intermetallic compounds Ni3Al and Ni3Ge

    International Nuclear Information System (INIS)

    Drijver, J.W.; Woude, F. van der

    1975-01-01

    Moessbauer parameters obtained from room temperature emission and absorption spectra of Ni 3 Al and Ni 3 Ga processed by a computer assuming a singlet and a doublet are given. The doublet is due to iron or cobalt atoms at the nickel site. Quadrupole splitting at 57 Fe nuclei in Ni 3 Ga is larger than in Ni 3 Al, viz. 0.52 and 0.37 mm/sec, respectively. Isomer shift at the Al/Ga position is very close to -0.02 mm/sec found in metallic nickel. Also given are the hyperfine magnetic fields at 4.2 K. Considering the preference of 57 Co and 57 Fe atoms in the lattice, the field intensities at the nickel and aluminium sites are found to be 227 +- 1 and 238 +- 1 kOe, respectively. (Z.S.)

  9. When NiO@Ni Meets WS2 Nanosheet Array: A Highly Efficient and Ultrastable Electrocatalyst for Overall Water Splitting

    Directory of Open Access Journals (Sweden)

    Dewen Wang

    2017-12-01

    Full Text Available The development of low-cost, high-efficiency, and stable bifunctional electrocatalysts toward the hydrogen evolution reaction (HER and oxygen evolution reaction (OER is of paramount importance for large-scale water splitting. Here, we develop a new strategy for the first design and synthesis of a NiO@Ni decorated WS2 nanosheet array on carbon cloth (NiO@Ni/WS2/CC composite. This composite serves as a unique three-dimensional (3D synergistic electrocatalyst that not only combines the intrinsic properties of individual NiO@Ni and WS2, but also exhibits significantly improved HER and OER activities when compared to that of pure NiO@Ni and WS2. This electrocatalyst possesses Pt-like activity for HER and exhibits better OER performance than that for commercial RuO2, as well as demonstrating superior long-term durability in alkaline media. Furthermore, it enables an alkaline electrolyzer with a current density of 10 mA cm–2 at a cell voltage as 1.42 V, which is the lowest one among all reported values to date. The excellent performance is mainly attributed to the unique 3D configuration and multicomponent synergies among NiO, Ni, and WS2. Our findings provide a new idea to design advanced bifunctional catalysts for water splitting.

  10. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Science.gov (United States)

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  11. Cathodic Electrodeposition of Ni-Mo on Semiconducting NiFe2 O4 for Photoelectrochemical Hydrogen Evolution in Alkaline Media.

    Science.gov (United States)

    Wijten, Jochem H J; Jong, Ronald P H; Mul, Guido; Weckhuysen, Bert M

    2018-04-25

    Photocathodes for hydrogen evolution from water were made by electrodeposition of Ni-Mo layers on NiFe 2 O 4 substrates, deposited by spin coating on F:SnO 2 -glass. Analysis confirmed the formation of two separate layers, without significant reduction of NiFe 2 O 4 . Bare NiFe 2 O 4 was found to be unstable under alkaline conditions during (photo)electrochemistry. To improve the stability significantly, the deposition of a bifunctional Ni-Mo layer through a facile electrodeposition process was performed and the composite electrodes showed stable operation for at least 1 h. Moreover, photocurrents up to -2.1 mA cm -2 at -0.3 V vs. RHE were obtained for Ni-Mo/NiFe 2 O 4 under ambient conditions, showing that the new combination functions as both a stabilizing and catalytic layer for the photoelectrochemical evolution of hydrogen. The photoelectrochemical response of these composite electrodes decreased with increasing NiFe 2 O 4 layer thickness. Transient absorption spectroscopy showed that the lifetime of excited states is short and on the ns timescale. An increase in lifetime was observed for NiFe 2 O 4 of large layer thickness, likely explained by decreasing the defect density in the primary layer(s), as a result of repetitive annealing at elevated temperature. The photoelectrochemical and transient absorption spectroscopy results indicated that a short charge carrier lifetime limits the performance of Ni-Mo/NiFe 2 O 4 photocathodes. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. On the data between the ratio of new supply houses at four tenures in Japan. At 47 prefectures and 80 cities; 300,000 and more population on 1995; Shinsetsu chako jutaku no riyo kankeibetsu deta. 47 todofuken and 80 toshi (jinko 300,000 nin 'heisei 7 {center_dot} kokucho' ijo narabini kencho shozaishi)(1993 {approx} 1997)

    Energy Technology Data Exchange (ETDEWEB)

    Iida, Toshihiko; Kojina, Kyoji

    1999-03-01

    On the owned tenure, the average construction-started ratio spreaded from 1.15 houses in Amagasaki-shi to 6.30 houses in Hamamatsu-shi during 1983 {approx} 1987, the same values spreaded from 1.42 houses in Amagasaki-shi to 5083 houses in Akita-shi during 1988 {approx} 1992 and the same values spreaded from 1.44 houses in Osaka-shi to 6.67 houses in Aomori-shi during 1993 {approx} 1997. 2nd on the rental tenure, the average construction-started ratio spreaded from 1.88 house in Sakai-shi to 14.32 houses in Ichikawa-shi during 1983 {approx} 1987, the same values spreaded from 3.72 houses in Sakai-shi to 13.93 houses in Kawasaki-shi during 1988 {approx} 1992 and from 2.82 houses in Yokosuka-shi to 9.88 houses in Sendai-shi during 1993 {approx} 1997, espicialy 13.17 houses in Nishinomiya-shi. 3rd on the issued tenure, the average construction-started ratio spreaded from 0.05 houses in Maebashi-shi 0.45 houses in Mito-shi during 1983 {approx} 1992 and from 0.02 houses in Naha-shi to 0.74 houses in Omiya-shi during 1993 {approx} 1997, espicialy 1.00 houses in Nishinomiya-shi. 4th on the for-sale tenure, the average construction-started ratio spraeded from 0.36 houses in Kurashiki-shi 5.65 houses in Kobe-shi during 1983 {approx} 1987, the same values spreaded from 0.89 houses in Iwaki-shi and Fukui-shi to 6.14 houses in Fukuoka-shi during 1988 {approx} 1992 and from 0.63 houses in Kurashiki-shi to 7.51 houses in Urawa-shi during 1993 {approx} 1997, especially 8.66 houses in Nishinomiya-shi. The construction-started hoses of the rental tenure were leading during this fifteen years, but the construction-started houses of the for-sale tenure were increasing recently in Japan, though the same values of the owned tenure were continuing during this periods. At 80 cities the construction-started ratio of the rental tenure spreaded from 2.61 houses in Kitakyushu-shi to 12.01 houses in Hachioji-shi on 1993, the same values spreaded from 2.41 houses in Toyota-shi to 9.98 houses in

  13. The Deoxygenation Pathways of Palmitic Acid into Hydrocarbons on Silica-Supported Ni12P5 and Ni2P Catalysts

    Directory of Open Access Journals (Sweden)

    Wenjun Zhou

    2018-04-01

    Full Text Available Pure Ni12P5/SiO2 and pure Ni2P/SiO2 catalysts were obtained by adjusting the Ni and P molar ratios, while Ni/SiO2 catalyst was prepared as a reference against which the deoxygenation pathways of palmitic acid were investigated. The catalysts were characterized by N2 adsorption, X-ray diffraction (XRD, X-ray photoelectron spectroscopy (XPS, transmission election microscopy (TEM, infrared spectroscopy of pyridine adsorption (Py-IR, H2-adsorption and temperature-programmed desorption of hydrogen (H2-TPD. The crystallographic planes of Ni(111, Ni12P5(400, Ni2P(111 were found mainly exposed on the above three catalysts, respectively. It was found that the deoxygenation pathway of palmitic acid mainly proceeded via direct decarboxylation (DCO2 to form C15 on Ni/SiO2. In contrast, on the Ni12P5/SiO2 catalyst, there were two main competitive pathways producing C15 and C16, one of which mainly proceeded via the decarbonylation (DCO to form C15 accompanying water formation, and the other pathway produced C16 via the dehydration of hexadecanol intermediate, and the yield of C15 was approximately twofold that of C16. Over the Ni2P/SiO2 catalyst, two main deoxygenation pathways formed C15, one of which was mainly the DCO pathway and the other was dehydration accompanying the hexadecanal intermediate and then direct decarbonylation without water formation. The turn over frequency (TOF followed the order: Ni12P5/SiO2 > Ni/SiO2 > Ni2P/SiO2.

  14. Improvement of in-plane alignment for surface oxidized NiO layer on textured Ni substrate by two-step heat-treatment

    International Nuclear Information System (INIS)

    Hasegawa, Katsuya; Izumi, Toru; Izumi, Teruo; Shiohara, Yuh; Maeda, Toshihiko

    2004-01-01

    Epitaxial growth of NiO on a textured Ni substrate as a template for an REBa 2 Cu 3 O y coated conductor was investigated. Highly in-plane aligned NiO layers were successfully fabricated using a new process of a two-step heat-treatment for oxidation. In the first-step, a highly in-plane aligned thin NiO layer was formed on a textured Ni substrate under a low driving force of oxidation. Then, in the second-step, a thick NiO layer was grown at a higher rate with maintaining its high in-plane grain alignment, as if the first NiO layer acts as a seed crystal layer. Further, growth rates and microstructures of the NiO layers were studied comparatively in the cases with and without the first layer. It was found that the oxidation rate in the case with the first layer was lower than that without the first layer. The microstructure observation revealed that the NiO without the first layer was poly-crystalline with many grain-boundaries. On the other hand, in the case with the first layer, grain-boundaries of the NiO were hardly observed. Hence, the reason for this difference of the growth rate and the microstructure of the NiO layers were discussed in view of a diffusivity path

  15. Structural conditions of achieving maximum ductility of two-phase Ni-NiO alloys

    International Nuclear Information System (INIS)

    Grabin, V.V.; Dabizha, E.V.; Movchan, B.A.

    1984-01-01

    A study was made on possibility of increasing ductility of two-phase Ni-NiO alloys, proJuced by traditional technology: ingot smelting, rolling and corresponding annealing for production of grain with certain size. The correlation of mechanical properties of Ni-NiO alloys and pure nickel shows that completion of the structural conJition D--lambda (where D - the average grain diameter, lambda - the value of free path between particles) in two-phase alloys enables: to increase the ultimate strength 1.5 times and preserve the basic level of pure nickel plasticity - at 20 deg C; to increase plasticity 1.4-1.5 times with preserved basic level of pure nickel plasticity - at 800 deg C. The conclusions testify to possibility of controlling mechanical properties of two-phase alloys using structural D and lambda parameters It is proposed that creation of structures with more unifor m particle distribution with respect to sizes will the accompanied by further increase of plasticity under D=lambda condition

  16. Rate of hydrogen motion in Ni-substituted LaNi5Hx from NMR

    International Nuclear Information System (INIS)

    Mendenhall, Michael P.; Bowman, Robert C.; Ivancic, Timothy M.; Conradi, Mark S.

    2007-01-01

    Partial substitution of Sn, Ge, or Si for Ni in LaNi 5 H x greatly enhances the stability under repeated hydrogen-cycling. Proton NMR relaxation measurements are reported here to determine the rates of H hopping in the substituted metals LaNi 4.6 M 0.4 H x with M = Sn, Ge, and Si, for comparison to bare LaNi 5 H x . The relaxation times T 2 * (FID), T 2 (Hahn echo), T 2 -CPMG, T 1 , and T 1ρ were determined from 130 to 375 K. The three substituents result in only small increases in the average rate of motion at a given temperature but with a broader distribution of rates over the many inequivalent H sites and hopping paths. Evidently, the average energy barriers along the paths for H motion are only little affected by these substituents. Changes of H content x produce only minor changes in the relaxation times

  17. Laser alloyed Al-Ni-Fe coatings

    CSIR Research Space (South Africa)

    Pityana, SL

    2008-10-01

    Full Text Available The aim of this work was to produce crack-free thin surface layers consisting of binary (Al-Ni, Al-Fe) and ternary (Al-Ni-Fe) intermetallic phases by means of a high power laser beam. The laser surface alloying was carried out by melting Fe and Ni...

  18. A Ni-P@NiCo LDH core-shell nanorod-decorated nickel foam with enhanced areal specific capacitance for high-performance supercapacitors.

    Science.gov (United States)

    Xing, Jiale; Du, Jing; Zhang, Xuan; Shao, Yubo; Zhang, Ting; Xu, Cailing

    2017-08-14

    Recently, transition metal-based nanomaterials have played a key role in the applications of supercapacitors. In this study, nickel phosphide (Ni-P) was simply combined with NiCo LDH via facile phosphorization of Ni foam and subsequent electrodeposition to form core-shell nanorod arrays on the Ni foam; the Ni-P@NiCo LDH was then directly used for a pseudocapacitive electrode. Owing to the splendid synergistic effect between Ni-P and NiCo LDH nanosheets as well as the hierarchical structure of 1D nanorods, 2D nanosheets, and 3D Ni foam, the hybrid electrode exhibited significantly enhanced electrochemical performances. The Ni-P@NiCo LDH electrode showed a high specific capacitance of 12.9 F cm -2 at 5 mA cm -2 (3470.5 F g -1 at a current density of 1.3 A g -1 ) that remained as high as 6.4 F cm -2 at a high current density of 100 mA cm -2 (1700 F g -1 at 27 A g -1 ) and excellent cycling stability (96% capacity retention after 10 000 cycles at 40 mA cm -2 ). Furthermore, the asymmetric supercapacitors (ASCs) were assembled using Ni-P@NiCo LDH as a positive electrode and activated carbon (AC) as a negative electrode. The obtained ASCs delivered remarkable energy density and power density as well as good cycling performance. The enhanced electrochemical activities open a new avenue for the development of supercapacitors.

  19. Separation and preparation of "6"2Ni isotope

    International Nuclear Information System (INIS)

    Ren Xiuyan; Mi Yajing; Zeng Ziqiang; Li Gongliang; Tu Rui

    2014-01-01

    Micro nuclear battery is the perfect power of space craft equipment. "6"3Ni is the core operation material of the "6"3Ni battery. It can produce radioisotope "6"3Ni while high abundance "6"2Ni is irradiated in the reactor. In order to meet the requirements of the abundance and the purity, research of the separation for "6"2Ni isotope was developed. The magnetic field and beam transmission status were simulated. The improvement designs of the ion source and the collector pocket were carried out. The process flow of high abundance "6"2Ni using electromagnetic separation method was established. The experiment of "6"2Ni isotope was developed by using electromagnetism isotope separator. The results show that the enrichment of "6"2Ni isotope is more than 90%. (authors)

  20. Fabrication of metallic alloy powder (Ni{sub 3}Fe) from Fe–77Ni scrap

    Energy Technology Data Exchange (ETDEWEB)

    Seo, Inseok [ES Materials Research Center, Research Institute of Industrial Science and Technology, Incheon 406-840 (Korea, Republic of); Shin, Shun-Myung [Extractive Metallurgy Department, Korea Institute of Geoscience and Mineral Resources, Deajeon 305-350 (Korea, Republic of); Ha, Sang-An [Department of Environmental Engineering, Silla University, Busan 46958 (Korea, Republic of); Wang, Jei-Pil, E-mail: jpwang@pknu.ac.kr [Department of Metallurgical Engineering, Pukyong National University, Busan 608-739 (Korea, Republic of)

    2016-06-15

    The oxidation behavior of Fe–77Ni alloy scrap was investigated at an oxygen partial pressure of 0.2 atm and temperatures ranging from 400 °C to 900 °C. The corresponding oxidation rate increased with increasing temperature and obeyed the parabolic rate law, as evidenced by its linear proportionality to the temperature. In addition, surface morphologies, cross-sectional views, compositions, structural properties were examined by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), and X-ray diffraction (XRD). Diffusion through either the spinel structure or the NiO layer, which were both present in the alloy during oxidation at elevated temperatures, was deemed the rate-limiting step of the reaction. The oxide powder less than 10 μm was obtained from Fe–77Ni alloy scrap was obtained using ball-milling and sieving processes. In fact, 15 h of milling yielded a recovery ratio of 97%. Using hydrogen gas, the oxide powder was successfully reduced to an alloy powder of Ni{sub 3}Fe and reduction rates of ∼97% were achieved after 3 h at 1000 °C. - Highlights: • The oxidation behavior of Fe–77Ni alloy scrap was investigated. • The oxide powder less than 10 μm was obtained from Fe–77Ni alloy scrap. • Using hydrogen gas, the oxide powder was successfully reclaimed. • Reduction rates of ∼97% were achieved after 3 h at 1000 °C.

  1. Structural, electrical and magnetic properties of evaporated Ni/Cu and Ni/glass thin films

    Energy Technology Data Exchange (ETDEWEB)

    Nacereddine, C. [Departement de Physique, Universite Ferhat Abbas, Setif 19000 (Algeria); Layadi, A. [Departement de Physique, Universite Ferhat Abbas, Setif 19000 (Algeria)]. E-mail: A_Layadi@yahoo.fr; Guittoum, A. [Centre de Recherche Nucleaire d' Alger (CRNA), Alger 16000 (Algeria); Cherif, S.-M. [Laboratoire PMTM, Institut Galilee, Univeriste Paris 13, Villetaneuse 93340 (France); Chauveau, T. [Laboratoire PMTM, Institut Galilee, Univeriste Paris 13, Villetaneuse 93340 (France); Billet, D. [Laboratoire PMTM, Institut Galilee, Univeriste Paris 13, Villetaneuse 93340 (France); Youssef, J. Ben [Laboratoire de Magnetisme de Bretagne, U.B.O., Brest 29238 (France); Bourzami, A. [Departement de Physique, Universite Ferhat Abbas, Setif 19000 (Algeria); Bourahli, M.-H. [Departement d' O. M. P., Universite Ferhat Abbas, Setif 19000 (Algeria)

    2007-01-25

    The structural, electrical and magnetic properties of Ni thin films evaporated onto glass and polycrystalline Cu substrates have been investigated. The Ni thickness ranges from 31 to 165 nm. X-ray diffraction (XRD), scanning electron microscopy (SEM) and atomic force microscopy (AFM) have been used to study the structure and morphology of these systems. The Ni/Cu and Ni/glass thin films are found to be polycrystalline with a (1 1 1) texture. There is an overall increase of the grain size with increasing thickness. A negative strain was noted indicating that all the samples are under a compressive stress. Diffusion at the grain boundaries seems to be a major contribution to the electrical resistivity in this thickness range. Study of the hysteresis curves, obtained by vibrating sample magnetometer (VSM), indicates that all samples are characterized by an in-plane magnetization easy axis. Higher in-plane coercive fields seem to be associated with higher grain size, indicating that coercivity may be due to nucleation of reverse domains rather than pinning of domain walls. The saturation field and the squareness have been studied as a function of the Ni thickness.

  2. Magnetic Properties of Porous Metal-Organic Frameworks: Ni2(BODC)2(TED) and Ni2(BDC)2(TED)

    Science.gov (United States)

    Hamida, Youcef; Danilovic, Dusan; Lin, Chyan; Yuen, Tan; Li, Kunhao; Padmanabhan, Moothetty; Li, Jing

    2010-03-01

    Results of χ(T), M(H), and heat capacity C(T) measurements on two Ni dimer based porous materials Ni2(BODC)2(TED) and Ni2(BDC)2(TED) are reported. These materials form a tetragonal crystal structure of space group P4/ncc with a=b = 14.9 å and c = 19.4 å and Ni-Ni separation of 2.61å within the dimer. Magnetic data of Ni2(BODC)2(TED) revealed a ferromagnetic-like transition at about 17 K with θ = 8 K, and a coercivity field of 1700 G was observed in the hysteresis curve. Though isostructural to Ni2(BODC)2(TED), χ(T) and M(H) results of Ni2(BDC)2(TED) showed an antiferromagnetic transition at 10 K with θ = - 132 K, and no hysteresis was observed. Although specific heat data C(T) showed no clear transition in both compounds, nonlinear behavior is clearly seen in C/T vs. T plots, and a fit to the electron and phonon contributions to C(T) gives a large heavy-fermion-like γ in both cases. A model for the magnetic interactions is proposed and a comparison to the Cu and Co analogues is also made.

  3. CO2 activation on bimetallic CuNi nanoparticles

    Directory of Open Access Journals (Sweden)

    Natalie Austin

    2016-10-01

    Full Text Available Density functional theory calculations have been performed to investigate the structural, electronic, and CO2 adsorption properties of 55-atom bimetallic CuNi nanoparticles (NPs in core-shell and decorated architectures, as well as of their monometallic counterparts. Our results revealed that with respect to the monometallic Cu55 and Ni55 parents, the formation of decorated Cu12Ni43 and core-shell Cu42Ni13 are energetically favorable. We found that CO2 chemisorbs on monometallic Ni55, core-shell Cu13Ni42, and decorated Cu12Ni43 and Cu43Ni12, whereas, it physisorbs on monometallic Cu55 and core-shell Cu42Ni13. The presence of surface Ni on the NPs is key in strongly adsorbing and activating the CO2 molecule (linear to bent transition and elongation of C˭O bonds. This activation occurs through a charge transfer from the NPs to the CO2 molecule, where the local metal d-orbital density localization on surface Ni plays a pivotal role. This work identifies insightful structure-property relationships for CO2 activation and highlights the importance of keeping a balance between NP stability and CO2 adsorption behavior in designing catalytic bimetallic NPs that activate CO2.

  4. In Situ Synthesis and Electrophoretic Deposition of NiO/Ni Core-Shell Nanoparticles and Its Application as Pseudocapacitor

    Directory of Open Access Journals (Sweden)

    Joaquin Yus

    2017-11-01

    Full Text Available A simple, low cost and transferable colloidal processing method and the subsequent heat treatment has been optimized to prepare binder-free electrodes for their application in supercapacitors. NiO/Ni core–shell hybrid nanostructures have been synthetized by heterogeneous precipitation of metallic Ni nanospheres onto NiO nanoplatelets as seed surfaces. The electrophoretic deposition (EPD has been used to shape the electroactive material onto 3D substrates such as Ni foams. The method has allowed us to control the growth and the homogeneity of the NiO/Ni coatings. The presence of metallic Nickel in the microstructure and the optimization of the thermal treatment have brought several improvements in the electrochemical response due to the connectivity of the final microstructure. The highest specific capacitance value has been obtained using a thermal treatment of 325 °C during 1 h in Argon. At this temperature, necks formed among ceramic-metallic nanoparticles preserve the structural integrity of the microstructure avoiding the employment of binders to enhance their connectivity. Thus, a compromise between porosity and connectivity should be established to improve electrochemical performance.

  5. Effect of amorphous Mg{sub 50}Ni{sub 50} on hydriding and dehydriding behavior of Mg{sub 2}Ni alloy

    Energy Technology Data Exchange (ETDEWEB)

    Guzman, D., E-mail: danny.guzman@uda.cl [Departamento de Ingenieria en Metalurgia, Facultad de Ingenieria, Universidad de Atacama y Centro Regional de Investigacion y Desarrollo Sustentable de Atacama (CRIDESAT), Av. Copayapu 485, Copiapo (Chile); Ordonez, S. [Departamento de Ingenieria Metalurgica, Facultad de Ingenieria, Universidad de Santiago de Chile, Av. Lib. Bernardo O' Higgins 3363, Santiago (Chile); Fernandez, J.F.; Sanchez, C. [Departamento de Fisica de Materiales, Facultad de Ciencias, Universidad Autonoma de Madrid, Cantoblanco 28049, Madrid (Spain); Serafini, D. [Departamento de Fisica, Facultad de Ciencias, Universidad de Santiago de Chile and Center for Interdisciplinary Research in Materials, CIMAT, Av. Lib. Bernardo O' Higgins 3363, Santiago (Chile); Rojas, P.A. [Escuela de Ingenieria Mecanica, Facultad de Ingenieria, Av. Los Carrera 01567, Quilpue, Pontificia Universidad Catolica de Valparaiso, PUCV (Chile); Aguilar, C. [Departamento de Ingenieria Metalurgica y Materiales, Universidad Tecnica Federico Santa Maria, Av. Espana 1680, Valparaiso (Chile); Tapia, P. [Departamento de Ingenieria en Metalurgia, Facultad de Ingenieria, Universidad de Atacama, Av. Copayapu 485, Copiapo (Chile)

    2011-04-15

    Composite Mg{sub 2}Ni (25 wt.%) amorphous Mg{sub 50}Ni{sub 50} was prepared by mechanical milling starting with nanocrystalline Mg{sub 2}Ni and amorphous Mg{sub 50}Ni{sub 50} powders, by using a SPEX 8000 D mill. The morphological and microstructural characterization of the powders was performed via scanning electron microscopy and X-ray diffraction. The hydriding characterization of the composite was performed via a solid gas reaction method in a Sievert's-type apparatus at 363 K under an initial hydrogen pressure of 2 MPa. The dehydriding behavior was studied by differential thermogravimetry. On the basis of the results, it is possible to conclude that amorphous Mg{sub 50}Ni{sub 50} improved the hydriding and dehydriding kinetics of Mg{sub 2}Ni alloy upon cycling. A tentative rationalization of experimental observations is proposed. - Research Highlights: {yields} First study of the hydriding behavior of composite Mg{sub 2}Ni (25 wt.%) amorphous Mg{sub 50}Ni{sub 50}. {yields} Microstructural characterization of composite material using XRD and SEM was obtained. {yields} An improved effect of Mg{sub 50}Ni{sub 50} on the Mg{sub 2}Ni hydriding behavior was verified. {yields} The apparent activation energy for the hydrogen desorption of composite was obtained.

  6. Matriz de relación primaria en casos de niños y niñas con problemas de aprendizaje

    Directory of Open Access Journals (Sweden)

    Marta Isabel López

    2010-10-01

    Full Text Available La relación entre las dificultades de aprendizaje (DA y el contexto relacional primario de niño o niña que las presenta, es un aspecto importante reportado en la literatura y en la práctica clínica, y constituye un factor esencial en la comprensión del fenómeno de las DA. Nuestro objetivo en el estudio fue comprender la historia del desarrollo relacional de nueve niños y niñas con DA en la ciudad de Medellín, Colombia, para encontrar relaciones de sentido entre dicha historia y sus DA. La metodología utilizada fue cualitativa desde el enfoque hermenéutico-fenomenológico. Encontramos una dinámica de relación primaria caracterizada por ansiedad y apoyo constante al niño o niña por parte de la madre, y por un padre por fuera de la relación madre - niño o niña. Esa dinámica se reproduce en las relaciones con otras personas y situaciones, favoreciendo la emergencia de un niño o niña en un lugar de discapacidad.

  7. Matriz de relación primaria en casos de niños y niñas con problemas de aprendizaje

    Directory of Open Access Journals (Sweden)

    Marta Isabel López

    2010-01-01

    Full Text Available La relación entre las dificultades de aprendizaje (DA y el contexto relacional primario del niño o niña que las presenta, es un aspecto importante reportado en la literatura y en la práctica clínica, y constituye un factor esencial en la comprensión del fenómeno de las DA. Nuestro objetivo en el estudio fue comprender la historia del desarrollo relacional de nueve niños y niñas con DA en la ciudad de Medellín, Colombia, para encontrar relaciones de sentido entre dicha historia y sus DA. La metodología utilizada fue cualitativa desde el enfoque hermenéutico-fenomenológico. Encontramos una dinámica de relación primaria caracterizada por ansiedad y apoyo constante al niño o niña por parte de la madre, y por un padre por fuera de la relación madre - niño o niña. Esa dinámica se reproduce en las relaciones con otras personas y situaciones, favoreciendo la emergencia de un niño o niña en un lugar de discapacidad.

  8. Underlying mechanisms leading to El Niño-to-La Niña transition are unchanged under global warming

    Science.gov (United States)

    Yun, Kyung-Sook; Yeh, Sang-Wook; Ha, Kyung-Ja

    2018-05-01

    El Niño's transitions play critical roles in modulating severe weather and climate events. Therefore, understanding the dynamic factors leading to El Niño's transitions and its future projection is a great challenge in predicting the diverse socioeconomic influences of El Niño over the globe. This study focuses on two dynamic factors controlling the El Niño-to-La Niña transition from the present climate and to future climate, using the observation, the historical and the RCP8.5 simulations of Coupled Model Intercomparison phase 5 climate models. The first is the inter-basin coupling between the Indian Ocean and the western North Pacific through the subtropical high variability. The second is the enhanced sensitivity between sea surface temperature and a deep tropical convection in the central tropical Pacific during the El Niño's developing phase. We show that the dynamic factors leading to El Niño-to-La Niña transition in the present climate are unchanged in spite of the increase of greenhouse gas concentrations. We argue that the two dynamic factors are strongly constrained by the climatological precipitation distribution over the central tropical Pacific and western North Pacific as little changed from the present climate to future climate. This implies that two dynamical processes leading to El Niño-to-La Niña transitions in the present climate will also play a robust role in global warming.

  9. The complex transfer reaction (14C, 15O) on Ni, Zn and Ge targets: existence and mass of 69Ni

    International Nuclear Information System (INIS)

    Dessagne, P.; Bernas, M.; Langevin, M.; Pougheon, F.; Roussel, P.; Morrison, G.C.

    1984-01-01

    The ( 14 C, 15 O) complex transfer reaction has been studied at 72 MeV incident energy on 58 Ni, 60 Ni, 62 Ni, 64 Ni, 68 Zn, 70 Zn and 74 Ge, 76 Ge targets. Spectra and differential cross sections have been measured in a 5 0 angular range centred around a laboratory angle of 6 0 . The nucleus 69 Ni has been observed and its mass determined for the first time

  10. Microscopic mechanism on the evolution of plasticity in nanolamellar γ-Ni/Ni_5Zr eutectic composites

    International Nuclear Information System (INIS)

    Maity, T.; Singh, A.; Dutta, A.; Das, J.

    2016-01-01

    The evolution of microstructure and the mechanical properties of a series of (Ni_0_._9_1_2Zr_0_._0_8_8)_1_0_0_-_xAl_x (0≤x≤4) eutectic composites, constitute of γ-Ni and Ni_5Zr nanolamellar phases, have been presented. Al dissolves in γ-Ni phase preferentially, decreases its hardness and refines the microstructure. Strain rate jump test was performed in order to investigate the rate sensitivity. It has been found that activation volume increases from 39b"3 to 46b"3 upon Al addition. The strain rate sensitivity of the composites has been estimated to be ~0.008. The scanning and transmission electron microscopic studies have confirmed that dislocation meditated flow in nano-lamellar phases dominates the plastic deformation mechanism. Analysis based on Stroh's pile-up model suggests that the required shear stress for slip decreases and that for cleavage crack nucleation increases around a dislocation pile-up at the lamellae interface, upon Al addition. The nano-lamellar Ni_5Zr strengthen the composite, whereas, dislocation slip endorses the global plasticity of high strength Ni-Zr-(Al) nanoeutectic composites.

  11. Preliminary Microstructural and Microscratch Results of Ni-Cr-Fe and Cr3C2-NiCr Coatings on Magnesium Substrate

    Science.gov (United States)

    Istrate, B.; Munteanu, C.; Lupescu, S.; Benchea, M.; Vizureanu, P.

    2017-06-01

    Thermal coatings have a large scale application in aerospace and automotive field, as barriers improving wear mechanical characteristics and corrosion resistance. In present research, there have been used two types of coatings, Ni-Cr-Fe, respectively Cr3C2-NiCr which were deposited on magnesium based alloys (pure magnesium and Mg-30Y master alloy). There have been investigated the microstructural aspects through scanning electronic microscopy and XRD analysis and also a series of mechanical characteristics through microscratch and indentation determinations. The results revealed the formation of some adherent layers resistant to the penetration of the metallic indenter, the coatings did not suffer major damages. Microstructural analysis highlighted the formation of Cr3C2, Cr7C3, Cr3Ni2, Cr7Ni3, FeNi3, Cr-Ni phases. Also, the apparent coefficient of friction for Ni-Cr-Fe coatings presents superior values than Cr3C2-NiCr coatings.

  12. Superconducting properties of Zr1+xNi2-xGa and Zr1-xNi2+xGa Heusler compounds

    Directory of Open Access Journals (Sweden)

    Saad Alzahrani

    2017-05-01

    Full Text Available The superconducting properties of a series of Zr1+xNi2-xGa and Zr1-xNi2+xGa compounds have been investigated by x-ray diffraction, electrical resistivity, dc magnetization, and ac susceptibility measurements. While the parent compound, ZrNi2Ga, exhibited the cubic L21 Heusler structure, multiple non-cubic structures formed in the Zr and Ni rich doped materials. For x ≤ 0.3, all Zr1-xNi2+xGa compounds demonstrated superconducting behavior, but no superconductivity was observed in the Zr1+xNi2-xGa alloys for x > 0.2. The magnetization data revealed that all materials in both Zr1+xNi2-xGa and Zr1-xNi2+xGa series exhibited type-II superconductivity. With increasing doping concentration x, the paramagnetic ordering were enhanced in both systems while the superconducting properties were found to weaken. The observations are discussed considering the structural disorders in the systems.

  13. Fate of half-metallicity near interfaces: The case of NiMnSb/MgO and NiMnSi/MgO

    KAUST Repository

    Zhang, Ruijing

    2014-08-27

    The electronic and magnetic properties of the interfaces between the half-metallic Heusler alloys NiMnSb, NiMnSi, and MgO have been investigated using first-principles density-functional calculations with projector augmented wave potentials generated in the generalized gradient approximation. In the case of the NiMnSb/MgO (100) interface, the half-metallicity is lost, whereas the MnSb/MgO contact in the NiMnSb/MgO (100) interface maintains a substantial degree of spin polarization at the Fermi level (∼60%). Remarkably, the NiMnSi/MgO (111) interface shows 100% spin polarization at the Fermi level, despite considerable distortions at the interface, as well as rather short Si/O bonds after full structural optimization. This behavior markedly distinguishes NiMnSi/MgO (111) from the corresponding NiMnSb/CdS and NiMnSb/InP interfaces. © 2014 American Chemical Society.

  14. Confining jackets for concrete cylinders using NiTiNb and NiTi shape memory alloy wires

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Eunsoo; Yoon, Soon-Jong [Department of Civil Engineering, Hongik University, Seoul 121-791 (Korea, Republic of); Nam, Tae-Hyun [School of Materials Science and Engineering and ERI, Gyeongsang National University, Jinju, Gyeongnam 600-701 (Korea, Republic of); Cho, Sun-Kyu [School of Civil Engineering, Seoul National University of Technology, Seoul 139-743 (Korea, Republic of); Park, Joonam, E-mail: eunsoochoi@hongik.ac.k [Department of Railroad Structure Research, Korea Railroad Research Institute, Uiwang 437-050, Korea (Korea, Republic of)

    2010-05-01

    This study used prestrained NiTiNb and NiTi shape memory alloy (SMA) wires to confine concrete cylinders. The recovery stress of the wires was measured with respect to the maximal prestrain of the wires. SMA wires were preelongated during the manufacturing process and then wrapped around concrete cylinders of 150 mmx300 mm ({phi}xL). Unconfined concrete cylinders were tested for compressive strength and the results were compared to those of cylinders confined by SMA wires. NiTiNb SMA wires increased the compressive strength and ductility of the cylinders due to the confining effect. NiTiNb wires were found to be more effective in increasing the peak strength of the cylinders and dissipating energy than NiTi wires. This study showed the potential of the proposed method to retrofit reinforced concrete columns using SMA wires to protect them from earthquakes.

  15. DO22-(Cu,Ni)3Sn intermetallic compound nanolayer formed in Cu/Sn-nanolayer/Ni structures

    International Nuclear Information System (INIS)

    Liu Lilin; Huang, Haiyou; Fu Ran; Liu Deming; Zhang Tongyi

    2009-01-01

    The present work conducts crystal characterization by High Resolution Transmission Electron Microscopy (HRTEM) on Cu/Sn-nanolayer/Ni sandwich structures associated with the use of Energy Dispersive X-ray (EDX) analysis. The results show that DO 22 -(Cu,Ni) 3 Sn intermetallic compound (IMC) ordered structure is formed in the sandwich structures at the as-electrodeposited state. The formed DO 22 -(Cu,Ni) 3 Sn IMC is a homogeneous layer with a thickness about 10 nm. The DO 22 -(Cu,Ni) 3 Sn IMC nanolayer is stable during annealing at 250 deg. C for 810 min. The formation and stabilization of the metastable DO 22 -(Cu,Ni) 3 Sn IMC nanolayer are attributed to the less strain energy induced by lattice mismatch between the DO 22 IMC and fcc Cu crystals in comparison with that between the equilibrium DO 3 IMC and fcc Cu crystals.

  16. Studies on the valence electronic structure of Fe and Ni in FexNi1−x ...

    Indian Academy of Sciences (India)

    structure of Fe and Ni in various Fex Ni1−x alloys. Since Kβ-to-Kα X-ray intensity ratio has been reported [2–7] to be a sensitive physical parameter to investigate the changes in the valence electronic structure of 3d-transition metals [2], we have undertaken the study of the valence electronic structure of Fe and Ni in the Fex ...

  17. Ni-CeO2 Cermets Synthesis by Solid State Sintering of Ni/CeO2 Multilayer

    Directory of Open Access Journals (Sweden)

    Aleksandras ILJINAS

    2013-12-01

    Full Text Available Nickel and gadolinium doped cerium oxide (GDC cermet is intensively investigated for an application as an anode material for solid oxide fuel cells based on various electrolytes. The purpose of the present investigation is to analyze morphology, microstructure, and optical properties of deposited and annealed for one hour in the temperatures from 500 ºC to 900 ºC Ni/CeO2 multilayer thin films deposited by sputtering. The crystallographic structure of thin films was investigated by X-ray diffraction. The morphology of the film cross-section was investigated with scanning electron microscope. The elemental analysis of samples was investigated by energy-dispersive X-ray spectroscopy. The fitting of the optical reflectance data was made using Abeles matrix method that is used for the design of interference coatings. The film cross-section of the post-annealed samples consisted of four layers. The first CeO2 layer (on Si had the same fine columnar structure with no features of Ni intermixing. The part of Ni (middle-layer after annealing was converted to NiO with grain size exceeding 100 nm. The CeO2 layer deposited on Ni was divided into two layers. Lower layer had small grains not exceeding 25 nm and consisting of NiO and CeO2 mixture. Upper layer consisted of CeO2 columns with approximate thickness of 50 nm. Ni sample annealed at 600 ºC was fully oxidized. The NiO thickness and refraction index were almost steady after annealing in various temperatures. The approximation of experimental reflectance data was successful only for the samples with one transparent homogeneous layer. The reflectance of the Ni/CeO2 samples annealed at intermediate temperatures could not be fitted using one-layer or three-layer model. That may show that a simplified model could not be implemented.  The real system has complicated distribution of refraction index. DOI: http://dx.doi.org/10.5755/j01.ms.19.4.3073

  18. Preparation, mechanical strengths, and thermal stability of Ni-Si-B and Ni-P-B amorphous wires

    International Nuclear Information System (INIS)

    Inoue, A.; Furukawa, S.; Hagiwara, M.; Masumoto, T.

    1987-01-01

    Ni-based amorphous wires with good bending ductility have been prepared for Ni/sub 75/Si/sub 8/B/sub 17/ and Ni/sub 78/P/sub 12/B/sub 10/ alloys containing 1 to 2 at. pct Al or Zr by melt spinning in rotating water. The enhancement of the wire-formation tendency by the addition of Al has been clarified to be due to the increase in the stability of the melt jet through the formation of a thin Al/sub 2/O/sub 3/ film on the outer surface. The maximum wire diameter is about 190 to 200 μm for the Ni-Si (or P)-B-Al alloys and increases to about 250 μm for the Ni-Si-B-Al-Cr alloys containing 4 to 6 at. pct Cr. The tensile fracture strength and fracture elongation are 2730 MPa and 2.9 pct for (N/sub 0.75/Si/sub 0.08/B/sub 0.17/)/sub 99/Al/sub 1/ wire and 2170 MPa and 2.4 pct for (Ni/sub 0.78/P/sub 0.12/B/sub 0.1/)/sub 99/Al/sub 1/ wire. These wires exhibit a fatigue limit under dynamic bending strain in air with a relative humidity of 65 pct; this limit is 0.50 pct for a NiSi-B-Al wire, which is higher by 0.15 pct than that of a Fe/sub 75/Si/sub 10/B/sub 15/ amorphous wire. Furthermore, the Ni-base wires do not fracture during a 180-deg bending even for a sample annealed at temperatures just below the crystallization temperature, in sharp contrast to high embrittlement tendency for Fe-base amorphous alloys. Thus, the Ni-based amorphous wires have been shown to be an attractive material similar to Fe- and Co-based amorphous wires because of its high static and dynamic strength, high ductility, high stability to thermal embrittlement, and good corrosion resistance

  19. Magnetic properties of two new compounds: Pr2Ni3Si5 and Ho2Ni3Si5

    International Nuclear Information System (INIS)

    Mazumdar, C.; Padalia, B.D.; Godart, C.

    1994-01-01

    Formation of two more new materials, Pr 2 Ni 3 Si 5 and Ho 2 Ni 3 Si 5 , of the series, R 2 Ni 3 Si 5 (R = rare earth and Y) and their magnetic properties are reported here. These materials crystallize in the orthorhombic U 2 Co 3 Si 5 -type structure (space group Ibam). Magnetic susceptibility measurement in the temperature range 5 K--300 K show that the compound Pr 2 Ni 3 Si 5 order antiferromagnetically at T N ∼ 8.5 K and Ho 2 Ni 3 Si 5 at ∼ 6 K. Considering T N (Gd 2 Ni 3 Si 5 ) ∼ 15 K, T N (Pr 2 Ni 3 Si 5 ) ∼ 8.5 K is rather high. The magnetic susceptibility of both of the materials, in the paramagnetic state, follows a Curie-Weiss law with effective moment close to that of the corresponding free trivalent rare earth ion

  20. Ductility of Ni3Al doped with substitutional elements

    International Nuclear Information System (INIS)

    Hanada, S.; Chiba, A.; Guo, H.Z.; Watanabe, S.

    1993-01-01

    This paper reports on ductility of B-free Ni 3 Al alloys. Recrystallized Ni 3 Al binary alloys with Ni-rich compositions show appreciable ductility when an environmental effect is eliminated, while the alloys with stoichiometric and Al-rich compositions remain brittle. The ductility in the Ni-rich Ni 3 Al alloys is associated with low ordering energy. The additions of ternary elements, which are classified as γ formers, ductilize ternary Ni 3 Al alloys(Ni-23 at% Al-2 at% X, X = Pd, Pt, Cu and Co), whereas the additions of γ' formers embrittle ternary Ni 3 Al alloys(Ni-23 at% Al-2 at% X, X = Ta, Mo, Nb, Zr, Hf, V, Ti and Si). The additions of small amounts (less than 1 at%) of γ' formers such as Zr and Hf also ductilize as-cast ternary Ni 3 Al alloys. Ductility of Ni 3 Al alloys doped with substitutional elements is discussed in terms of ordering energy and microstructure

  1. Using DR52c/Ni2+ mimotope tetramers to detect Ni2+ reactive CD4+ T cells in patients with joint replacement failure.

    Science.gov (United States)

    Zhang, Yan; Wang, Yang; Anderson, Kirsten; Novikov, Andrey; Liu, Zikou; Pacheco, Karin; Dai, Shaodong

    2017-09-15

    T cell mediated hypersensitivity to nickel (Ni 2+ ) is one of the most common causes of allergic contact dermatitis. Ni 2+ sensitization may also contribute to the failure of Ni 2+ containing joint implants, and revision to non-Ni 2+ containing hardware can be costly and debilitating. Previously, we identified Ni 2+ mimotope peptides, which are reactive to a CD4 + T cell clone, ANi2.3 (Vα1, Vβ17), isolated from a Ni 2+ hypersensitive patient with contact dermatitis. This T cell is restricted to the major histocompatibility complex class II (MHCII) molecule, Human Leukocyte Antigen (HLA)-DR52c (DRA, DRB3*0301). However, it is not known if Ni 2+ induced T cell responses in sensitized joint replacement failure patients are similar to subjects with Ni 2+ induced contact dermatitis. Here, we generated DR52c/Ni 2+ mimotope tetramers, and used them to test if the same Ni 2+ T cell activation mechanism could be generalized to Ni 2+ sensitized patients with associated joint implant failure. We confirmed the specificity of these tetramers by staining of ANi2.3T cell transfectomas. The DR52c/Ni 2+ mimotope tetramer detected Ni 2+ reactive CD4 + T cells in the peripheral blood mononuclear cells (PBMC) of patients identified as Ni 2+ sensitized by patch testing and a positive Ni 2+ LPT. When HLA-typed by a DR52 specific antibody, three out of four patients were DR52 positive. In one patient, Ni 2+ stimulation induced the expansion of Vβ17 positive CD4 + T cells from 0.8% to 13.3%. We found that the percentage of DR52 positivity and Vβ17 usage in Ni 2+ sensitized joint failure patients are similar to Ni sensitized skin allergy patients. Ni 2+ independent mimotope tetramers may be a useful tool to identify the Ni 2+ reactive CD4 + T cells. Copyright © 2017 Elsevier Inc. All rights reserved.

  2. In-situ conversion of rGO/Ni2P composite from GO/Ni-MOF precursor with enhanced electrochemical property

    Science.gov (United States)

    Lv, Zijian; Zhong, Qin; Bu, Yunfei

    2018-05-01

    Owing to the metalloid characteristic and superior electrical conductivity, the metal phosphides have received increasing interests in energy storage systems. Here, xrGO/Ni2P composites are successfully synthesized via an In-situ phosphorization process with GO/Ni-MOF as precursors. Compared to pure Ni2P, the xrGO/Ni2P composites appear enhanced electrochemical properties in terms of the specific capacitance and cycling performance as electrodes for supercapacitors. Especially, the 2rGO/Ni2P electrode shows a highest specific capacitance of 890 F g-1 at 1 A g-1 among the obtained composites. The enhancement can be attributed to the inherited structure from Ni-MOF and the well assembled of rGO and Ni2P through the In-situ conversion process. Moreover, when applied as positive electrode in a hybrid supercapacitor, an energy density of 35.9 W h kg-1 at a power density of 752 W kg-1 has been achieved. This work provides an In-situ conversion strategy for the synthesis of rGO/Ni2P composite which might be a promising electrode material for SCs.

  3. Molecules based on M(v) (M=Mo, W) and Ni(II) ions: a new class of trigonal bipyramidal cluster and confirmation of SMM behavior for the pentadecanuclear molecule {NiII[NiII(tmphen)(MeOH)]6[Ni(H2O)3]2[micro-CN]30[WV(CN)3]6}.

    Science.gov (United States)

    Hilfiger, Matthew G; Zhao, Hanhua; Prosvirin, Andrey; Wernsdorfer, Wolfgang; Dunbar, Kim R

    2009-07-14

    The preparation, single crystal X-ray crystallography, and magnetic properties are reported for four new clusters based on [M'V(CN)8]3- octacyanometallates (M'=Mo, W). Reactions of [M'V(CN)8]3- with mononuclear NiII ions in the presence of the tmphen blocking ligand (tmphen=3,4,7,8-tetramethyl-1,10-phenanthroline) in a 2:3:6 ratio, respectively, lead to the formation of the trigonal bipyramidal clusters [NiII(tmphen)2]3[M'V(CN)8]2. Analogous reactions with the same starting materials performed in a 2:3:2 ratio, respectively, produce pentadecanuclear clusters of the type {NiII[NiII(tmphen)(MeOH)]6[Ni(H2O)3]2[micro-CN]30[WV(CN)3]6}. The W2Ni3 (1) and Mo2Ni3(2) pentanuclear clusters and the W6Ni9 (3) and Mo6Ni9 (4) pentadecanuclear molecules are isostructural to each other and crystallize in the space groups P2(1)/c and R3 respectively. Magnetic measurements indicate that the ground states for the trigonal bipyamidal clusters are S=4 as a consequence of ferromagnetic coupling with JW-Ni=9.5 cm(-1), JMo-Ni=10 cm(-1). The pentadecanuclear clusters exhibit ferromagnetic coupling as well, which leads to S=12 ground states (JW-Ni=12 cm(-1), JMo-Ni=12.2 cm(-1)). Reduced magnetization studies on the W-Ni analogues support the conclusion that they exhibit a negative axial anisotropy term; the fits give D values of -0.24 cm(-1) for the W2Ni3 cluster and D=-0.04 cm(-1)for the W6Ni9 cluster. AC susceptibility measurements indicate the beginning of an out-of-phase signal for the W2Ni3 and the W6Ni9 compounds, but detailed low temperature studies on small crystals by the microSQUID technique indicate that only the pentadecanuclear cluster exhibits hysteresis in accord with SMM behavior. Neither Mo cluster reveals any evidence for slow paramagnetic relaxation at low temperatures.

  4. Observations of defect structure evolution in proton and Ni ion irradiated Ni-Cr binary alloys

    Energy Technology Data Exchange (ETDEWEB)

    Briggs, Samuel A., E-mail: sabriggs2@wisc.edu [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States); Barr, Christopher M. [Drexel University, 3141 Chestnut Street, Philadelphia, PA 19104 (United States); Pakarinen, Janne [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States); SKC-CEN Belgian Nuclear Research Centre, Boeretang 200, B-2400 Mol (Belgium); Mamivand, Mahmood [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States); Hattar, Khalid [Sandia National Laboratories, PO Box 5800, Albuquerque, NM 87185 (United States); Morgan, Dane D. [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States); Taheri, Mitra [Drexel University, 3141 Chestnut Street, Philadelphia, PA 19104 (United States); Sridharan, Kumar [University of Wisconsin-Madison, 1415 Engineering Drive, Madison, WI 53706 (United States)

    2016-10-15

    Two binary Ni-Cr model alloys with 5 wt% Cr and 18 wt% Cr were irradiated using 2 MeV protons at 400 and 500 °C and 20 MeV Ni{sup 4+} ions at 500 °C to investigate microstructural evolution as a function of composition, irradiation temperature, and irradiating ion species. Transmission electron microscopy (TEM) was applied to study irradiation-induced void and faulted Frank loops microstructures. Irradiations at 500 °C were shown to generate decreased densities of larger defects, likely due to increased barriers to defect nucleation as compared to 400 °C irradiations. Heavy ion irradiation resulted in a larger density of smaller voids when compared to proton irradiations, indicating in-cascade clustering of point defects. Cluster dynamics simulations were in good agreement with the experimental findings, suggesting that increases in Cr content lead to an increase in interstitial binding energy, leading to higher densities of smaller dislocation loops in the Ni-18Cr alloy as compared to the Ni-5Cr alloy. - Highlights: • Binary Ni-Cr alloys were irradiated with protons or Ni ions at 400 and 500 °C. • Higher irradiation temperatures yield increased size, decreased density of defects. • Hypothesize that varying Cr content affects interstitial binding energy. • Fitting CD models for loop nucleation to data supports this hypothesis.

  5. Neutron-capture rates for explosive nucleosynthesis: the case of 68Ni(n, γ)69Ni

    Science.gov (United States)

    Spyrou, A.; Larsen, A. C.; Liddick, S. N.; Naqvi, F.; Crider, B. P.; Dombos, A. C.; Guttormsen, M.; Bleuel, D. L.; Couture, A.; Crespo Campo, L.; Lewis, R.; Mosby, S.; Mumpower, M. R.; Perdikakis, G.; Prokop, C. J.; Quinn, S. J.; Renstrøm, T.; Siem, S.; Surman, R.

    2017-04-01

    Neutron-capture reactions play an important role in heavy element nucleosynthesis, since they are the driving force for the two processes that create the vast majority of the heavy elements. When a neutron capture occurs on a short-lived nucleus, it is extremely challenging to study the reaction directly and therefore the use of indirect techniques is essential. The present work reports on such an indirect measurement that provides strong constraints on the 68Ni(n, γ)69Ni reaction rate. This is done by populating the compound nucleus 69Ni via the β decay of 69Co and measuring the γ-ray deexcitation of excited states in 69Ni. The β-Oslo method was used to extract the γ-ray strength function and the nuclear level density. In addition the half-life of 69Co was extracted and found to be in agreement with previous literature values. Before the present results, the 68Ni(n, γ)69Ni reaction was unconstrained and the purely theoretical reaction rate was highly uncertain. The new uncertainty on the reaction rate based on the present experiment (variation between upper and lower limit) is approximately a factor of 3. The commonly used reaction libraries JINA-REACLIB and BRUSLIB are in relatively good agreement with the experimental rate. The impact of the new rate on weak r-process calculations is discussed.

  6. NiCo2O4 nanosheets in-situ grown on three dimensional porous Ni film current collectors as integrated electrodes for high-performance supercapacitors

    Science.gov (United States)

    Wang, Tao; Guo, Ying; Zhao, Bo; Yu, Shuhui; Yang, Hai-Peng; Lu, Daniel; Fu, Xian-Zhu; Sun, Rong; Wong, Ching-Ping

    2015-07-01

    Three dimensional interconnected hierarchical porous Ni films are easily fabricated as effective current collectors through hydrogen bubble template electrochemical deposition. The binder-free integrated electrodes of spinel NiCo2O4 nanosheets directly coated the three dimensional porous Ni films are facilely obtained through successively electrochemical co-deposition of Ni/Co alloy layer then followed by subsequent annealing at 350 °C in air. Compared with NiCo2O4 nanosheets on smooth Ni foil or porous NiO/Ni film electrodes, the porous NiCo2O4/Ni integrated film electrodes for supercapacitors demonstrate remarkably higher area specific capacitance. The porous NiCo2O4/Ni film electrodes also exhibit excellent rate capability and cycling stability. The super electrochemical capacitive performances are attributed to the unique integrated architecture of NiCo2O4 nanosheets in-situ grown on three dimensional continuous hierarchical porous Ni collector collectors, which could provide large electrode-electrolyte interface area, high active sites, low contact resistance between current collector and active materials, fast electron conduction and ion/electrolyte diffusion.

  7. Effect of interface intermixing on giant magnetoresistance in NiFe/Cu and Co/NiFe/Co/Cu multilayers

    International Nuclear Information System (INIS)

    Nagamine, L.C.C.M.; Biondo, A.; Pereira, L.G.; Mello, A.; Schmidt, J.E.; Chimendes, T.W.; Cunha, J.B.M.; Saitovitch, E.B.

    2003-01-01

    This article reports on the important influence of the spontaneously built-in paramagnetic interfacial layers on the magnetic and magnetoresistive properties of NiFe/Cu and Co/NiFe/Co/Cu multilayers grown by magnetron sputtering. A computational simulation, based on a semiclassical model, has been used to reproduce the variations of the resistivity and of the magnetoresistance (MR) amplitude with the thickness of the NiFe, Cu, and Co layers. We showed that the compositionally intermixed layers at NiFe/Cu interfaces, which are paramagnetic, reduce the flow of polarized electrons and produce a masking on the estimated mean-free path of both types of electrons due to the reduction of their effective values, mainly for small NiFe thickness. Moreover, the transmission coefficients for the electrons decrease when Fe buffer layers are replaced by NiFe ones. This result is interpreted in terms of the variations of the interfacial intermixing and roughness at the interfaces, leading to an increase of the paramagnetic interfacial layer thickness. The effect provoked by Co deposition at the NiFe 16 A/Cu interfaces has also been investigated. The maximum of the MR amplitudes was found at 5 A of Co, resulting in the quadruplication of the MR amplitude. This result is partially attributed to the interfacial spin-dependent scattering due to the increase of the magnetic order at interfaces. Another effect observed here was the increase of the spin-dependent scattering events in the bulk NiFe due to a larger effective NiFe thickness, since the paramagnetic interfacial layer thickness is decreased

  8. Microstructure and Properties of Ni and Ni/Al2O3 Coatings Electrodeposited at Various Current Densities

    Directory of Open Access Journals (Sweden)

    Góral A.

    2016-03-01

    Full Text Available The study presents investigations of an influence of various direct current densities on microstructure, residual stresses, texture, microhardness and corrosion resistance of the nickel coatings electrodeposited from modified Watt’s baths. The properties of obtained coatings were compared to the nano-crystalline composite Ni/Al2O3 coatings prepared under the same plating conditions. The similarities and differences of the obtained coatings microstructures visible on both their surfaces and cross sections and determined properties were presented. The differences in the growth character of the Ni matrix and in the microstructural properties were observed. All electrodeposited Ni and Ni/Al2O3 coatings were compact and well adhering to the steel substrates. The thickness and the microhardness of the Ni and Ni/Al2O3 deposits increased significantly with the current density in the range 2 - 6 A/dm2. Residual stresses are tensile and they reduced as the current density increased. The composite coatings revealed better protection from the corrosion of steel substrate than pure nickel in solution 1 M NaCl.

  9. α-NiPt(Al) and phase equilibria in the Ni-Al-Pt system at 1150 deg C

    International Nuclear Information System (INIS)

    Hayashi, S.; Ford, S.I.; Young, D.J.; Sordelet, D.J.; Besser, M.F.; Gleeson, B.

    2005-01-01

    The α-NiPt(Al) phase and its associated equilibria in the Ni-Al-Pt system at 1150 deg C were investigated by analyzing equilibrated bulk alloys and the interdiffusion zones of diffusion couples. Phase constitutions, tie-lines and microstructures were determined using a combination of techniques, including high-energy synchrotron X-ray diffraction, scanning electron microscopy and electron probe microanalysis. A large Pt solubility limit was found to exist in the β-NiAl, ∼42 at.%, and in γ'-Ni 3 Al, ∼32 at.%. The α-NiPt(Al) phase was found to have wide Pt solubility range of about 33-60 at.% and to skew along an almost constant Pt/Al ratio of 1.5. The α-NiPt(Al) has an ordered face-centered tetragonal L1 0 crystal structure, with the Al and Pt atoms found to be preferentially located in the corners and prismatic faces, respectively. The temperature dependence of the lattice parameters and unit cell volume of the α phase were also determined

  10. Chemical and electrical characteristics of annealed Ni/Au and Ni/Ir/Au contacts on AlGaN

    Energy Technology Data Exchange (ETDEWEB)

    Ngoepe, P.N.M., E-mail: phuti.ngoepe@up.ac.za [Department of Physics, University of Pretoria, Private Bag X20, Hatfield 0028 (South Africa); Meyer, W.E.; Auret, F.D.; Omotoso, E.; Diale, M. [Department of Physics, University of Pretoria, Private Bag X20, Hatfield 0028 (South Africa); Swart, H.C.; Duvenhage, M.M.; Coetsee, E. [Department of Physics, University of the Free State, P.O. Box 339, Bloemfontein 9300 (South Africa)

    2016-01-01

    The evolution of Ni/Au and Ni/Ir/Au metal contacts deposited on AlGaN was investigated at different annealing temperatures. The samples were studied with electrical and chemical composition techniques. I–V characteristics of the Schottky diodes were optimum after 500 and 600 °C annealing for Ni/Au and Ni/Ir/Au based diodes, respectively. The depth profiles of the contacts were measured by x-ray photoelectron spectroscopy and time of flight secondary ion mass spectroscopy. These chemical composition techniques were used to examine the evolution of the metal contacts in order to verify the influence the metals have on the electrical properties of the diodes. The insertion of Ir as a diffusion barrier between Ni and Au effected the electrical properties, improving the stability of the contacts at high temperatures. Gold diffused into the AlGaN film, degrading the electrical properties of the Ni/Au diode. At 500 °C, the insertion of Ir, however, prevented the in-diffusion of Au into the AlGaN substrate.

  11. Hydrogen storage properties of LaMgNi{sub 3.6}M{sub 0.4} (M = Ni, Co, Mn, Cu, Al) alloys

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Tai [Department of Functional Material Research, Central Iron and Steel Research Institute, Beijing 100081 (China); Key Laboratory of Integrated Exploitation of Baiyun Obo Multi-Metal Resources, Inner Mongolia University of Science and Technology, Baotou 014010 (China); Zhai, Tingting; Yuan, Zeming; Bu, Wengang [Department of Functional Material Research, Central Iron and Steel Research Institute, Beijing 100081 (China); Xu, Sheng [Key Laboratory of Integrated Exploitation of Baiyun Obo Multi-Metal Resources, Inner Mongolia University of Science and Technology, Baotou 014010 (China); Zhang, Yanghuan, E-mail: zhangyh59@sina.com [Department of Functional Material Research, Central Iron and Steel Research Institute, Beijing 100081 (China); Key Laboratory of Integrated Exploitation of Baiyun Obo Multi-Metal Resources, Inner Mongolia University of Science and Technology, Baotou 014010 (China)

    2014-12-25

    Highlights: • La–Mg–Ni system AB{sub 2}-type alloys were prepared by induction melting. • Structures and lattice parameters were analysed by XRD. • Hydrogen absorption/desorption performances were studied. • Mechanisms of hydrogen absorption capacity fading were investigated. - Abstract: LaMgNi{sub 3.6}M{sub 0.4} (M = Ni, Co, Mn, Cu, Al) alloys were prepared through induction melting process. The phase compositions and crystal structures were characterised via X-ray diffraction (XRD). The hydrogen storage properties, including activation performance, hydrogen absorption capacity, cycle stability, alloy particle pulverisation and plateau pressure, were systemically investigated. Results show that Ni, Co, Mn and Cu substitution alloys exhibit multiphase structures comprising the main phase LaMgNi{sub 4} and the secondary phase LaNi{sub 5}. However, the secondary phase of the Al substitution alloy changes into LaAlNi{sub 4}. The lattice parameters and cell volumes of the LaMgNi{sub 4} phase follow the order Ni < Co < Al < Cu < Mn. Activation is simplified through partial substitution of Ni with Al, Cu and Co. The hydrogen absorption capacities of all of the alloys are approximately 1.7 wt.% at the first activation process; however, they rapidly decrease with increasing cycle number. In addition, the stabilities of hydriding and dehydriding cycles decrease in the order Al > Co > Ni > Cu > Mn. Hydriding processes result in numerous cracks and amorphisation of the LaMgNi{sub 4} phase in the alloys. The p–c isotherms were determined by a Sieverts-type apparatus. Two plateaus were observed for the Ni, Co and Al substitution alloys, whereas only one plateau was found for Mn and Cu. This result was caused by the amorphisation of the LaMgNi{sub 4} phase during the hydriding cycles. Reversible absorption and desorption of hydrogen are difficult to achieve. Substitutions of Ni with Co, Mn, Cu and Al significantly influence the reduction of hysteresis between

  12. Study of shell evolution in the Ni isotopes via one-neutron transfer reaction in $^{70}$Ni

    CERN Multimedia

    This proposal aims at the study of the single particle properties of the neutron-rich nickel isotopes, specifically of the $^{71}$Ni isotope via a $^{70}$Ni(d,p) $^{71}$Ni reaction. The $^{70}$Ni beam will be delivered by HIE-ISOLDE at 5.5 MeV/u onto a 1.0 mg/cm$^{2}$ CD$_{2}$ target. The protons produced in the (d,p) reaction will be detected with the T-REX silicon array either in singles or in coincidence with $\\gamma$- rays recorded by MINIBALL. The experimental results will be compared with large-scale shell-model calculations using effective interactions that involve large valence spaces for protons and neutrons, with excitations beyond the Z =28 and N=50 shell gap. This comparison will permit the study of the single-particle orbital d$_{5/2}$ that together with the quasi-SU3 partner g$_{9/2}$ gives rise to the collectivity in this region and has direct implications on the $^{78}$Ni.

  13. Development of environmentally-friendly high-efficiency energy utilization system. Research on optimum system design technology (Case study report on wide-area energy supply network system in Osaka Prefecture); Osakafu ni okeru koiki energy kyokyu network system no case study hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-01

    A wide-area energy supply network model is fabricated for a region to be re-developed, and the model is assessed from the viewpoints of economy, environmental preservation, and energy conservation. The model is a combination of element technologies being developed under an Eco-Energy City project and some existing technologies. Although a wide-area heat supply system using high-temperature water is superior to district heating systems in energy conservation and environmental friendliness, yet it contains some unsolved problems relating to cost efficiency. The use of a vacuum-insulated tube as the heat supply main is better than the use of a double tube from every point of view. It is noted here that in the study of the Sakai district, the neighborhood of the old Sakai Port, an area in front of Sakai-shi Station of the Nankai Main Line, Nakamozu-Minami district, and Nakamozu-Kita district are defined to be the areas to be supplied with heat. Petroleum company C, glass mill C, and the Sakai Municipal Incineration Plant situated in the bay area are assumed to be the sources of waste heat. It is so set that the high-temperature water is to be transported at 170 degrees C and is to return at 140 degrees C. (NEDO)

  14. Plasticity and microstructure of epitaxial Ag/Ni multilayers; Mechanische Eigenschaften und Mikrostruktur epitaktischer Ag/Ni-Multilagenschichten

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, Tobias K.

    2007-10-15

    To meet the still increasing technical demands of new materials, it is required to improve basic knowledge of thin films and multilayers. This thesis describes the microstructure and mechanical behaviour of thin epitaxial Ag/Ni-multilayers. Former investigations were only done on polycrystalline multilayers or epitaxial single layers. The manufacture of epitaxial Ag/Ni-multilayers on (111) orientated Si-substrates was performed by a magnetron sputtering technique under ultra high vacuum (UHV). The thickness of the alternating Ag- and Ni-layers varies between 100 and 400 nm, the thickness of the whole film varies between 200 and 800 nm. Hardness and flow stress of Ag/Ni-multilayers were measured with a nanoindentation technique, a substrate curvature method and by X-ray diffraction. The hardness of these multilayers varies between 1.5 and 2.0 GPa. The Ag single film hardness is 0.5 GPa and Ni film 1.8 GPa. The flow stress of the Ag/Ni-multilayers varies between 350 and 800 MPa. The Ag single layer shows a flow stress of 100 MPa and Ni of 450 MPa. Both hardness and flow stress increase with decreasing layer thickness. In situ TEM and HRTEM experiments showed a semicoherent Ag/Ni-interface. It was observed that these interfaces act as sources and sinks. Dislocation loops formed at the interface expand and shrink according to the stress state. They combine with loops from the opposite interface or with the interface itself and form threading dislocations. Dislocation loops penetrating an interface were not observed. Results were compared with various models which simulate flow stress in thin films and multilayers. The most important models are calculated by Nix-Freund, the Source-model after von Blanckenhagen and the Hall-Petch-model. (orig.)

  15. Comparison of three Ni-Hard I alloys

    Energy Technology Data Exchange (ETDEWEB)

    Dogan, Omer N.; Hawk, Jeffrey A.; Rice, J. (Texaloy Foundry Co., Inc., Floresville, Texas)

    2004-09-01

    This report documents the results of an investigation which was undertaken to reveal the similarities and differences in the mechanical properties and microstructural characteristics of three Ni-Hard I alloys. One alloy (B1) is ASTM A532 class IA Ni-Hard containing 4.2 wt. pct. Ni. The second alloy (B2) is similar to B1 but higher in Cr, Si, and Mo. The third alloy (T1) also falls in the same ASTM specification, but it contains 3.3 wt. pct. Ni. The alloys were evaluated in both as-cast and stress-relieved conditions except for B2, which was evaluated in the stress-relieved condition only. While the matrix of the high Ni alloys is composed of austenite and martensite in both conditions, the matrix of the low Ni alloy consists of a considerable amount of bainite, in addition to the martensite and the retained austenite in as cast condition, and primarily bainite, with some retained austenite, in the stress relieved condition. It was found that the stress relieving treatment does not change the tensile strength of the high Ni alloy. Both the as cast and stress relieved high Ni alloys had a tensile strength of about 350 MPa. On the other hand, the tensile strength of the low Ni alloy increased from 340 MPa to 452 MPa with the stress relieving treatment. There was no significant difference in the wear resistance of these alloys in both as-cast and stressrelieved conditions.

  16. Effect of the Cu and Ni content on the crystallization temperature and crystallization mechanism of La–Al–Cu(Ni metallic glasses

    Directory of Open Access Journals (Sweden)

    Peiyou Li

    2016-02-01

    Full Text Available The effect of the Cu and Ni content on the crystallization mechanism and the crystallization temperatures of La–Al–Cu(Ni metallic glasses (MGs was studied by differential scanning calorimetry (DSC. The experimental results have shown that the DSC curves obtained for the La–Al–Cu and La–Al–Ni MGs exhibit two and three crystallization temperatures, respectively. The crystallization temperatures of the La–Al–Cu and La–Al–Ni MGs result from the merging and splitting of thermal events related to the corresponding eutectic atomic pairs in the La72Cu28 and La81.6Al18.4 MGs, and La72Ni28 and La81.6Al18.4 MGs, respectively. In addition, Al- and Ni-containing clusters with weak or strong atomic interaction in the Al–Ni atomic pairs strongly affect the crystallization mechanism and thus the crystallization temperature of La–Al–Ni MGs. This study provides a novel understanding of the relation between the crystallization temperature and the underlying crystallization mechanisms in La–Al–Cu(Ni MGs.

  17. Magnetic studies in evaporated Ni/Pd multilayers

    International Nuclear Information System (INIS)

    Chafai, K.; Salhi, H.; Lassri, H.; Yamkane, Z.; Lassri, M.; Abid, M.; Hlil, E.K.; Krishnan, R.

    2011-01-01

    The magnetic properties of Ni/Pd multilayers, prepared by sequential evaporation in ultrahigh vacuum, have been studied. The Ni thickness dependence of the magnetization and magnetic anisotropy is discussed. The temperature dependence of the spontaneous magnetization is well described by a T 3/2 law in all multilayers. A spin-wave theory has been used to explain the temperature dependence of the spontaneous magnetization, and the approximate values for the exchange interactions for various Ni layer thicknesses have been obtained. - Research highlights: → The magnetic properties of Ni/Pd multilayers, prepared by sequential evaporation in ultrahigh vacuum, have been studied. → The temperature dependence of the spontaneous magnetization is well described by a T 3/2 law in Ni/Pd multilayers. → The spin-wave constant B was observed to depend on t Ni nonmonotonically. → A spin-wave theory has been used to explain the temperature dependence of the spontaneous magnetization. → The approximate values for the exchange interactions for various Ni layer thicknesses have been obtained.

  18. Viviendo con VIH/SIDA: Las voces ocultas de los niños y niñas afectados

    OpenAIRE

    Luz Adriana Aristizábal Becerra

    2015-01-01

    El VIH/SIDA no es solamente un problema de salud, sino también un problema social. Los primeros casos de VIH/SIDA en niños se describen en 1982 en Estados Unidos, y desde entonces el número de niños infectados y afectados continúa incrementándose, hasta convertirse en lo que en la actualidad se denota como una pandemia. Objetivo. Posibilitar un espacio para que los niños y niñas afectados por el VIH/SIDA, puedan expresar sus vivencias en torno al padecimiento propio y/o de sus padres. Metodol...

  19. Derechos de los niños ... ¿de qué niños?

    Directory of Open Access Journals (Sweden)

    Gloria Teresa Zapata O.

    2000-07-01

    Full Text Available En Colombia, son necesarios cambios a la actual legislación para que más que curativa, remedial o rehabilitativa sea de prevención y protección y se acompañe de programas en esa dirección; por ejemplo garantizando el control de crecimiento y desarrollo saludable de la población infantil, mediante programas que incluyan chequeos de rutina para detectar discapacidades, impedimentos físicos, emocionales, en niños y niñas a temprana edad, con el fin de reducir la incidencia de estos problemas. También se requiere de programas que además de orientar en relación al número de hijos que se desean y pueden tener las parejas también sugieran pautas de crianza, comunicación y convivencia; y que apoyen en los adultos cercanos al niño, la construcción de una nueva cultura sobre la salud, la niñez, el desarrollo infantil y la discapacidad.

  20. Effect of Ti seed and spacer layers on structure and magnetic properties of FeNi thin films and FeNi-based multilayers

    Energy Technology Data Exchange (ETDEWEB)

    Svalov, A.V., E-mail: andrey.svalov@ehu.es [Departamento de Electricidad y Electrónica, Universidad del País Vasco (UPV/EHU), 48080 Bilbao (Spain); Department of Magnetism and Magnetic Nanomaterials, Ural Federal University, 620002 Ekaterinburg (Russian Federation); Larrañaga, A. [SGIker, Servicios Generales de Investigación, Universidad del País Vasco (UPV/EHU), 48080 Bilbao (Spain); Kurlyandskaya, G.V. [Departamento de Electricidad y Electrónica, Universidad del País Vasco (UPV/EHU), 48080 Bilbao (Spain); Department of Magnetism and Magnetic Nanomaterials, Ural Federal University, 620002 Ekaterinburg (Russian Federation)

    2014-10-15

    Highlights: • Fe{sub 19}Ni{sub 81} films and FeNi-based multilayers were prepared by magnetron sputtering. • The samples were deposited onto glass substrates at room temperature. • Ti/FeNi films exhibit good (1 1 1) texture and crystallinity. • The thick Cu seed increases the coercive force of the magnetic layer. • The thin Ti spacer restores the magnetic softness of the Cu/Ti/FeNi multilayers. - Abstract: The microstructure and magnetic properties of sputtered permalloy films and FeNi-based multilayers prepared by magnetron sputtering have been studied. X-ray diffraction measurements indicate that Ti/FeNi films exhibit good (1 1 1) texture and crystallinity. Ti/FeNi bilayers with high crystallographic quality have relatively low resistivity. The Ti seed layer does not influence the magnetic properties of FeNi film in Ti/FeNi bilayers, but the thick Cu seed layer leads to an increase of the coercive force of the magnetic layer. For the FeNi films deposited on thick Cu seed layer, the (0 1 0) and (0 0 2) diffraction peaks of hcp nickel were clearly observed. The thin Ti spacer between Cu and FeNi layers prevents the formation of the nickel phase and restores the magnetic softness of the FeNi layer in the Cu/Ti/FeNi sample. Obtained results can be important for the development of multilayer sensitive elements for giant magnetoimpedance or magnetoresistance detectors.

  1. HDO of Methyl Palmitate over Silica-Supported Ni Phosphides: Insight into Ni/P Effect

    Directory of Open Access Journals (Sweden)

    Irina V. Deliy

    2017-10-01

    Full Text Available Two sets of silica-supported nickel phosphide catalysts with a nickel content of about 2.5 and 10 wt % and Ni/P molar ratio 2/1, 1/1 and 1/2 in each set, were prepared by way of a temperature-programmed reduction method using (Ni(CH3COO2 and ((NH42HPO4 as a precursor. The NixPy/SiO2 catalysts were characterized using chemical analysis N2 physisorption, XRD, TEM, 31P MAS NMR. Methyl palmitate hydrodeoxygenation (HDO was performed in a trickle-bed reactor at 3 MPa and 290 °C with LHSV ranging from 0.3 to 16 h−1. The Ni/P ratio was found to affect the nickel phosphide phase composition, POx groups content and catalytic properties in methyl palmitate HDO with the TOF increased along with a decline of Ni/P ratio and a growth of POx groups’ content. Taking into account the possible routes of methyl palmitate conversion (metal-catalyzed hydrogenolysis or acid-catalyzed hydrolysis, we proposed that the enhancement of acid POx groups’ content with the Ni/P ratio decrease provides an enhancement of the rate of methyl palmitate conversion through the acceleration of acid-catalyzed hydrolysis.

  2. Magnetic reconstruction induced magnetoelectric coupling and spin-dependent tunneling in Ni/KNbO_3/Ni multiferroic tunnel junctions

    International Nuclear Information System (INIS)

    Zhang, Hu; Dai, Jian-Qing; Song, Yu-Min

    2016-01-01

    We investigate the magnetoelectric coupling and spin-polarized tunneling in Ni/KNbO_3/Ni multiferroic tunnel junctions with asymmetric interfaces based on density functional theory. The junctions have two stable polarization states. We predict a peculiar magnetoelectric effect in such junctions originating from the magnetic reconstruction of Ni near the KO-terminated interface. This reconstruction is induced by the reversal of the ferroelectric polarization of KNbO_3. Furthermore, the change in the magnetic ordering filters the spin-dependent current. This effect leads to a change in conductance by about two orders of magnitude. As a result we obtain a giant tunneling electroresistance effect. In addition, there exist sizable tunneling magnetoresistance effects for two polarization states. - Highlights: • We study the ME coupling and electron tunneling in Ni/KNbO_3/Ni junctions. • There is magnetic reconstruction of Ni atoms near the KO-terminated interface. • A peculiar magnetoelectric coupling effect is obtained. • Predicted giant tunneling electroresistance effects.

  3. Bath temperature effect on magnetoelectric performance of Ni-lead zirconate titanate-Ni laminated composites synthesized by electroless deposition

    Energy Technology Data Exchange (ETDEWEB)

    Wu, W. [College of Materials Science and Technology, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China); Wang, Y.G., E-mail: yingang.wang@nuaa.edu.c [College of Materials Science and Technology, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China); Bi, K. [College of Materials Science and Technology, Nanjing University of Aeronautics and Astronautics, Nanjing 210016 (China)

    2011-03-15

    Magnetoelectric (ME) Ni-lead zirconate titanate-Ni laminated composites have been prepared by electroless deposition at various bath temperatures. The structure of the Ni layers deposited at various bath temperatures was characterized by X-ray diffraction, and microstructures were investigated by transmission electron microscopy. The magnetostrictive coefficients were measured by means of a resistance strain gauge. The transverse ME voltage coefficient {alpha}{sub E,31} was measured with the magnetic field applied parallel to the sample plane. The deposition rate of Ni increases with bath temperature. Ni layer with smaller grain size is obtained at higher bath temperature and shows higher piezomagnetic coefficient, promoting the ME effect of corresponding laminated composites. It is advantageous to increase the bath temperature, while trying to avoid the breaking of bath constituents. - Research Highlights: Laminated composites without interlayer are prepared by electroless deposition. Bath temperature affects the grain size of the deposited Ni layers. Higher bath temperature is beneficial to obtain stronger ME response.

  4. Characterization of Sputtered Nickel-Titanium (NiTi) Stress and Thermally Actuated Cantilever Bimorphs Based on NiTi Shape Memory Alloy (SMA)

    Science.gov (United States)

    2015-11-01

    necessary anneal . Following this, a thin film of NiTi was blanket sputtered at 600 °C. This NiTi blanket layer was then wet -etch patterned using a...varying the sputter parameters during NiTi deposition, such as thickness, substrate temperature during deposition and anneal , and argon pressure during...6 Fig. 4 Surface texture comparison between NiTi sputtered at RT, then annealed at 600 °C, and NiTi

  5. Phase transitions in alloys of the Ni-Mo system

    International Nuclear Information System (INIS)

    Ustinovshikov, Y.; Shabanova, I.

    2011-01-01

    Graphical abstract: The structure of Ni-20 at.% Mo and Ni-25 at.% Mo alloys was studied by methods of TEM and XPS. It is shown that at high temperatures the tendency toward phase separation takes place in the alloys and crystalline bcc Mo particles precipitate in the liquid solution. At 900 deg. C and below, the tendency toward ordering leads to the dissolution of Mo particles and precipitation of the particles of Ni 3 Mo, Ni 2 Mo or Ni 4 Mo chemical compounds. Highlights: → 'Chemical' phase transition 'ordering-phase separation' is first discovered in alloys of the Ni-Mo system. → It is first shown that the phase separation in the alloys studied begins at temperatures above the liquidus one. → The formation of Ni 3 Mo from A1 has gone through the intervening stage of the Ni 4 Mo and Ni 2 Mo coexistence. - Abstract: The structure of Ni-20 at.% Mo and Ni-25 at.% Mo alloys heat treated at different temperatures was studied by the method of transmission electron microscopy. X-ray photoelectron spectroscopy was used to detect the sign of the chemical interaction between Ni and Mo atoms at different temperatures. It is shown that at high temperatures the tendency toward phase separation takes place. The system of additional reflections at positions {1 1/2 0} on the electron diffraction patterns testifies that the precipitation of crystalline bcc Mo particles begins in the liquid solution. At 900 deg. C and below, the tendency toward ordering leads to the precipitation of the particles of the chemical compounds. A body-centered tetragonal phase Ni 4 Mo (D1 a ) is formed in the Ni-20 at.% Mo alloy. In the Ni-25 at.% Mo alloy, the formation of the Ni 3 Mo (D0 22 ) chemical compound from the A1 solid solution has gone through the intervening stage of the Ni 4 Mo (D1 a ) and Ni 2 Mo (Pt 2 Mo) formation.

  6. Study of hyperfine interactions in intermetallic compounds Gd(Ni,Pd,Cu)In, Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In

    International Nuclear Information System (INIS)

    Lapolli, Andre Luis

    2006-01-01

    Systematic behavior of magnetic hyperfine field (B hf ) in the intermetallic compounds Gd(Ni,Pd,Cu)In Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In was studied by Perturbed Gamma-Gamma Angular Correlation spectroscopy. The measurements of B hf were carried out at the rare earth atom and in sites using the nuclear probes 140 Ce and 11 '1Cd respectively. The variation of hyperfine field with temperature, in most cases, follows the Brillouin function predicted from the molecular field theory. The hyperfine field values at rare earth atom sites obtained from 140 Ce probe as well as at in sites obtained from 111 Cd probe for each series of compounds were extrapolated to zero Kelvin B hf (T=0) from these curves. These values were compared with the values of the literature for other compounds containing the same rare earth element and all of them show a linear relationship with the ordering temperature. This indicates that the main contribution to B hf comes from the conduction electron polarization (CEP) through Fermi contact interaction and the principal mechanism of magnetic interaction in these compounds can be described by the RKKY type interaction. The values of B hf (T=0) for each family of intermetallic compounds RNiIn and RPdIn when plotted as a function of 4f spin projection of rare earth element also shows a linear relationship. Exceptions are the results for the compounds RNiIn obtained with 111 Cd probe where a small deviation from linearity is observed. The results of the measurements carried out with the 111 Cd probe were also analyzed to obtain the hyperfine parameters of the quadrupole interaction as a function of temperature for RPdln and GdNiIn compounds. The results show that for the compound GdPdIn there might be some Gd-In disorder at high temperature. (author)

  7. Room-temperature ferromagnetism in Dy films doped with Ni

    International Nuclear Information System (INIS)

    Edelman, I.; Ovchinnikov, S.; Markov, V.; Kosyrev, N.; Seredkin, V.; Khudjakov, A.; Bondarenko, G.; Kesler, V.

    2008-01-01

    Temperature, magnetic field and spectral dependences of magneto-optical effects (MOEs) in bi-layer films Dy (1-x) Ni x -Ni and Dy (1-x) (NiFe) x -NiFe were investigated, x changes from 0 to 0.06. Peculiar behavior of the MOEs was revealed at temperatures essentially exceeding the Curie temperature of bulk Dy which is explained by the magnetic ordering of the Dy layer containing Ni under the action of two factors: Ni impurities distributed homogeneously over the whole Dy layer and atomic contact of this layer with continues Ni layer. The mechanism of the magnetic ordering is suggested to be associated with the change of the density of states of the alloy Dy (1-x) Ni x owing to hybridization with narrow peaks near the Fermi level character for Ni

  8. Hierarchical Heterostructures of NiCo2O4@XMoO4 (X = Ni, Co) as an Electrode Material for High-Performance Supercapacitors.

    Science.gov (United States)

    Hu, Jiyu; Qian, Feng; Song, Guosheng; Wang, Linlin

    2016-12-01

    Hierarchical heterostructures of NiCo2O4@XMoO4 (X = Ni, Co) were developed as an electrode material for supercapacitor with improved pseudocapacitive performance. Within these hierarchical heterostructures, the mesoporous NiCo2O4 nanosheet arrays directly grown on the Ni foam can not only act as an excellent pseudocapacitive material but also serve as a hierarchical scaffold for growing NiMoO4 or CoMoO4 electroactive materials (nanosheets). The electrode made of NiCo2O4@NiMoO4 presented a highest areal capacitance of 3.74 F/cm(2) at 2 mA/cm(2), which was much higher than the electrodes made of NiCo2O4@CoMoO4 (2.452 F/cm(2)) and NiCo2O4 (0.456 F/cm(2)), respectively. Meanwhile, the NiCo2O4@NiMoO4 electrode exhibited good rate capability. It suggested the potential of the hierarchical heterostructures of NiCo2O4@CoMoO4 as an electrode material in supercapacitors.

  9. Effect of Phosphine Doping and the Surface Metal State of Ni on the Catalytic Performance of Ni/Al2O3 Catalyst

    Directory of Open Access Journals (Sweden)

    Xiaoru Li

    2015-04-01

    Full Text Available Ni-based catalysts as replacement for noble metal catalysts are of particular interest in the catalytic conversion of biomass due to their cheap and satisfactory catalytic activity. The Ni/SiO2 catalyst has been studied for the hydrogenolysis of glycerol, and doping with phosphorus (P found to improve the catalytic performance significantly because of the formation of Ni2P alloys. However, in the present work we disclose a different catalytic phenomenon for the P-doped Ni/Al2O3 catalyst. We found that doping with P has a significant effect on the state of the active Ni species, and thus improves the selectivity to 1,2-propanediol (1,2-PDO significantly in the hydrogenolysis of glycerol, although Ni-P alloys were not observed in our catalytic system. The structure and selectivity correlations were determined from the experimental data, combining the results of X-ray diffraction (XRD, X-ray photoelectron spectroscopy (XPS, hydrogen temperature-programmed reduction (H2-TPR and ammonia temperature-programmed desorption (NH3-TPD. The presence of NiO species, formed from P-doped Ni/Al2O3 catalyst, was shown to benefit the formation of 1,2-PDO. This was supported by the results of the Ni/Al2O3 catalyst containing NiO species with incomplete reduction. Furthermore, the role the NiO species played in the reaction and the potential reaction mechanism over the P-doped Ni/Al2O3 catalyst is discussed. The new findings in the present work open a new vision for Ni catalysis and will benefit researchers in designing Ni-based catalysts.

  10. Improvement in ductility of high strength polycrystalline Ni-rich Ni{sub 3}Al alloy produced by EB-PVD

    Energy Technology Data Exchange (ETDEWEB)

    Sun, J.Y.; Pei, Y.L.; Li, S.S.; Zhang, H.; Gong, S.K., E-mail: gongsk@buaa.edu.cn

    2014-11-25

    Highlights: • High strength and high ductility of polycrystalline Ni-rich Ni{sub 3}Al alloy sheets were produced. • The elongation could be enhanced from ∼0.5% to ∼14.6% by microstructural control. • The fracture strength (∼820 MPa) was enhanced by the precipitation strengthening. • This work provides a general processing for repairing the worn single crystal blades. - Abstract: A 300 μm Ni-rich Ni{sub 3}Al sheet was produced by electron beam physical vapor deposition (EB-PVD) and followed by different heat treatments to obtain fine γ′/γ two-phase structures with large elongation. Tensile testing was performed at room-temperature, and the corresponding mechanisms were investigated in detail. Results indicated that the as-deposited Ni{sub 3}Al alloy exhibited non-equilibrium directional columnar crystal, and transited to equiaxed crystal with uniformly distributed tough γ phase after heat treatment. Meanwhile, the fracture mechanism transited from brittleness to a mixture of ductility and brittleness modes. With an appropriate heat treatment, high strength (ultimate tensile strength obtained 828 MPa) and high ductility (elongation obtained 14.6%) Ni{sub 3}Al alloy has been achieved, which was due to the mesh network microstructure. A series of transmission electron microscope (TEM) characterizations confirmed that the increasing flow stress of Ni{sub 3}Al alloy was attributed to the cubical secondary γ′ phase precipitates (25–50 nm) within the γ phase. This work provides a potential strategy for repairing the worn tip of single crystal engine blades using Ni-rich Ni{sub 3}Al alloy by EB-PVD.

  11. Investigation of microstructure, electrical and photoluminescence behaviour of Ni-doped Zn0.96Mn0.04O nanoparticles: Effect of Ni concentration

    Science.gov (United States)

    Rajakarthikeyan, R. K.; Muthukumaran, S.

    2017-07-01

    ZnO, Zn0.96Mn0.04O and Ni-doped Zn0.96Mn0.04O nanoparticles with different Ni concentrations (0%, 2% and 4%) have been synthesized successfully by sol-gel method. The effects of Ni doping on the structural and optical properties were investigated using X-ray diffraction (XRD), scanning electron microscopy (SEM), UV-visible spectroscopy, Fourier transform infrared (FTIR) spectroscopy and photoluminescence (PL) spectroscopy. The XRD pattern confirmed the existence of single phase wurtzite-like hexagonal structure throughout the Ni concentrations without any additional phases. The substitution of Ni created the lattice distortion due to the disparity of ionic radius between Zn and Ni which reduced the crystallite size. The microscopic images showed that the size of ZnO nanoparticles reduced by Ni-doping while the shape remains almost spherical/hexagonal type. The electrical conductivity found to be maximum at Ni = 2% due to the availability of more charge carriers generated by Ni. The decrease of electrical conductivity at higher doping (Ni = 4%) is due to the fact that the generation of more defects. The enhanced band gap from 3.73 eV (Ni = 0%) to 3.79 eV (Ni = 4%) by the addition of Ni explained by Burstein-Moss effect. The change in infra-red (IR) intensity and full width at half maximum (FWHM) corresponding to the frequency around defect states were caused by the difference in the bond lengths that occurs when Ni ion replaces Zn ion. The observed blue band emission from 474 nm to 481 nm is due to a radiative transition of an electron from the deep donar level of Zni to an acceptor level of neutral VZn and the origin of green band may be due to oxygen vacancies and intrinsic defects. The tuning of the band gap and the visible emission bands by Ni doping concluded that Ni-doped Zn0.96Mn0.04O is suitable for various nano-photo-electronics applications.

  12. Creep and shrinkage of Mo(Ni)

    International Nuclear Information System (INIS)

    Kaysser, W.A.; Hofmann-Amtenbrink, M.; Petzow, G.

    1984-01-01

    To avoid some of the errors inherent in a quantitative interpretation of shrinkage of powder compacts as Mo-Ni, other experiments were looked for, where the influence of Ni on the material transport properties of Mo could be measured semi-quantitatively during heating up to temperature and subsequent isothermal annealing. The bending of thin Mo foils under small loads was found to be an experimental arrangement, where variations in stress, in Ni-concentration and in intrinsic material properties could be realized. The results of these creep experiments will be compared in a qualitative sense with sintering experiments in Mo-Ni done under similar conditions as the creep experiments

  13. Dye-sensitized MIL-101 metal organic frameworks loaded with Ni/NiO{sub x} nanoparticles for efficient visible-light-driven hydrogen generation

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Xin-Ling; Wang, Rong; Yuan, Yu-Peng, E-mail: yupengyuan@ahu.edu.cn, E-mail: cxue@ntu.edu.sg [School of Chemistry and Chemical Engineering, and Innovation Lab for Clean Energy and Green Catalysis, Anhui University, Hefei 230036 (China); Zhang, Ming-Yi [Key Laboratory for Photonic and Electronic Bandgap Materials, Ministry of Education, School of Physics and Electronic Engineering, Harbin Normal University, Harbin 150025 (China); Xue, Can, E-mail: yupengyuan@ahu.edu.cn, E-mail: cxue@ntu.edu.sg [Solar Fuels Lab, School of Materials Science and Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore 639798 (Singapore)

    2015-10-01

    The Ni/NiO{sub x} particles were in situ photodeposited on MIL-101 metal organic frameworks as catalysts for boosting H{sub 2} generation from Erythrosin B dye sensitization under visible-light irradiation. The highest H{sub 2} production rate of 125 μmol h{sup −1} was achieved from the system containing 5 wt. % Ni-loaded MIL-101 (20 mg) and 30 mg Erythrosin B dye. Moreover, the Ni/NiO{sub x} catalysts show excellent stability for long-term photocatalytic reaction. The enhancement on H{sub 2} generation is attributed to the efficient charge transfer from photoexcited dye to the Ni catalyst via MIL-101. Our results demonstrate that the economical Ni/NiO{sub x} particles are durable and active catalysts for photocatalytic H{sub 2} generation.

  14. Role of atomic bonding for compound and glass formation in Ni-Si, Pd-Si, and Ni-B systems

    Science.gov (United States)

    Tanaka, K.; Saito, T.; Suzuki, K.; Hasegawa, R.

    1985-11-01

    Valence electronic structures of crystalline compounds and glassy alloys of Ni silicides, Pd silicides, and Ni borides are studied by soft-x-ray spectroscopy over wide ranges of Si and B concentrations. The samples prepared include bulk compounds, glassy ribbons, and amorphous sputtered films. Silicon Kβ emissions of Ni and Pd silicides generally consist of a prominent peak fixed at ~=4.5 and ~=5.8 eV below the Fermi level EF, respectively, with a shoulder near EF which grows and shifts toward lower energy with increasing Si concentration. The former is identified as due to Si p-like states forming Si 3p-Ni 3d or Si 3p-Pd 4d bonding states while the latter as due to the corresponding antibonding states. Ni L3 and Pd L3 emissions of these silicides indicate that Ni 3d and Pd 4d states lie between the above two states. These local electronic configurations are consistent with partial-density-of-states (PDOS) calculations performed by Bisi and Calandra. Similar electronic configurations are suggested for Ni borides from B Kα and Ni L3 emissions. Differences of emission spectra between compounds and glasses of similar compositions are rather small, but some enhancement of the contribution of antibonding states to the PDOS near EF is suggested for certain glasses over that of the corresponding compounds. These features are discussed in connection with the compound stability and glass formability.

  15. Breakdown of antiferromagnet order in polycrystalline NiFe/NiO bilayers probed with acoustic emission

    Science.gov (United States)

    Lebyodkin, M. A.; Lebedkina, T. A.; Shashkov, I. V.; Gornakov, V. S.

    2017-07-01

    Magnetization reversal of polycrystalline NiFe/NiO bilayers was investigated using magneto-optical indicator film imaging and acoustic emission techniques. Sporadic acoustic signals were detected in a constant magnetic field after the magnetization reversal. It is suggested that they are related to elastic waves excited by sharp shocks in the NiO layer with strong magnetostriction. Their probability depends on the history and number of repetitions of the field cycling, thus testifying the thermal-activation nature of the long-time relaxation of an antiferromagnetic order. These results provide evidence of spontaneous thermally activated switching of the antiferromagnetic order in NiO grains during magnetization reversal in ferromagnet/antiferromagnet (FM/AFM) heterostructures. The respective deformation modes are discussed in terms of the thermal fluctuation aftereffect in the Fulcomer and Charap model which predicts that irreversible breakdown of the original spin orientation can take place in some antiferromagnetic grains with disordered anisotropy axes during magnetization reversal of exchange-coupled FM/AFM structures. The spin reorientation in the saturated state may induce abrupt distortion of isolated metastable grains because of the NiO magnetostriction, leading to excitation of shock waves and formation of plate (or Lamb) waves.

  16. Magnetic ordering of YPd{sub 2}Si-type HoNi{sub 2}Si and ErNi{sub 2}Si compounds

    Energy Technology Data Exchange (ETDEWEB)

    Morozkin, A.V., E-mail: morozkin@tech.chem.msu.ru [Department of Chemistry, Moscow State University, Leninskie Gory, House 1, Building 3, GSP-2, Moscow, 119992 (Russian Federation); Isnard, O. [CNRS, Insitut. Néel, 25 Rue Des Martyrs BP166 x, F-38042 Grenoble (France); Université Grenoble Alpes, Inst. Néel, F-38042 Grenoble (France); Nirmala, R. [Indian Institute of Technology Madras, Chennai 600 036 (India); Quezado, S.; Malik, S.K. [Departamento de Física Teórica e Experimental, Universidade Federal do Rio Grande do Norte, Natal 59082-970 (Brazil)

    2016-12-01

    Magnetic properties of YPd{sub 2}Si-type HoNi{sub 2}Si and ErNi{sub 2}Si were investigated via neutron diffraction and magnetisation measurements. HoNi{sub 2}Si and ErNi{sub 2}Si show ferromagnetic-like ordering at T{sub C} of 9 K and 7 K, respectively. The paramagnetic Weiss temperatures are 9 K and 11 K and the effective magnetic moments are 10.76 μ{sub B}/fu and 9.79 μ{sub B}/fu for HoNi{sub 2}Si and ErNi{sub 2}Si compounds, respectively. The HoNi{sub 2}Si and ErNi{sub 2}Si are soft ferromagnets with saturation magnetization of 8.1 μ{sub B}/fu and 7.5 μ{sub B}/fu, respectively at 2 K and in field of 140 kOe. The isothermal magnetic entropy change, ΔS{sub m}, has a maximum value of −15.6 J/kg·K at 10 K for HoNi{sub 2}Si and −13.9 J/kg·K at 6 K for ErNi{sub 2}Si for a field change of 50 kOe. Neutron diffraction study in zero applied field shows mixed ferromagnetic-antiferromagnetic ordering of HoNi{sub 2}Si at ~9 K and its magnetic structure is a sum of a-axis ferromagnetic F{sub a}, b-axis antiferromagnetic AF{sub b} and c-axis antiferrromagnetic AF{sub c} components of Pn′a2{sub 1}′={1, m_x′/[1/2, 1/2, 1/2], 2_y′/[0, 1/2, 0], m_z/[1/2, 0, 1/2]} magnetic space group and propagation vector K{sub 0}=[0, 0, 0]. The holmium magnetic moment reaches a value of 9.23(9) μ{sub B} at 1.5 K and the unit cell of HoNi{sub 2}Si undergoes isotropic contraction around the temperature of magnetic transition. - Graphical abstract: HoNi{sub 2}Si: mixed ferro-antiferromagnet (F{sub a}+AF{sub b}+AF{sub c}){sup K0} with Pn′a2{sub 1}′ magnetic space group and K{sub 0}=[0, 0, 0] propagation vector below 10 K. - Highlights: • Ferro-antiferromagnetic ordering is observed in HoNi{sub 2}Si at 9 K and in ErNi{sub 2}Si at 7 K. • HoNi{sub 2}Si is soft ferromagnet with ΔS{sub m} of −15.6 J/kg·K at 10 K in field of 0–50 kOe. • ErNi{sub 2}Si is soft ferromagnet with ΔS{sub m} of −13.9 J/kg·K at 6 K in field of 0–50 kOe. • HoNi{sub 2}Si shows mixed F

  17. Diffusion studies in amorphous NiZr alloys

    International Nuclear Information System (INIS)

    Hahn, H.; Averback, R.S.; Hoshino, K.; Rothman, S.J.

    1987-06-01

    Tracer impurity and self diffusion measurements have been made on amorphous (a-) NiZr alloys using radioactive tracer, Secondary Ion Mass Spectrometry and Rutherford backscattering techniques. The temperature dependence of diffusion in a-NiZr can be represented in the form D = D 0 exp(-Q/kT), with no structural relaxation effects being observed. The mobility of an atom in a-NiZr increased dramatically with decreasing atomic radius of the diffusing atom and also with decreasing Ni content for Ni concentrations below ≅40 at. %. These diffusion characteristics in a-NiZr are remarkably similar to those in α-Zr and α-Ti. These mechanisms assume that Zr and Ti provide a close packed structure, either crystalline or amorphous, through which small atoms diffuse by an interstitial mechanism and large atoms diffuse by a vacancy mechanism. 12 refs., 2 figs., 2 tabs

  18. Justificaciones morales de los niños y niñas acerca de la sexualidad

    Directory of Open Access Journals (Sweden)

    Carlos Bolívar Bonilla

    2010-10-01

    Full Text Available En este artículo sintetizo una investigación sobre las justificaciones morales acerca de la sexualidad, realizada con dos grupos de niños y niñas, pertenecientes a una institución educativa pública y a una privada, de la ciudad de Neiva (Colombia. Acudo para ello a un enfoque epistemológico cualitativo.En las conclusiones propongo la hipótesis de un pluralismo moral infantil sobre la sexualidad y la imposibilidad de encasillar la complejidad del juicio moral en un único sendero teórico. Durante la interpretación de las justificaciones morales ofrezco una comparación de lo hallado entre géneros e instituciones educativas. Finalmente, formulo algunas sugerencias para la educación moral y sexual de los niños y niñas.

  19. Justificaciones morales de los niños y niñas acerca de la sexualidad

    Directory of Open Access Journals (Sweden)

    Carlos Bolívar Bonilla

    2010-01-01

    Full Text Available En este artículo sintetizo una investigación sobre las justificaciones morales acerca de la sexualidad, realizada con dos grupos de niños y niñas, pertenecientes a una institución educativa pública y a una privada, de la ciudad de Neiva (Colombia. Acudo para ello a un enfoque epistemológico cualitativo. En las conclusiones propongo la hipótesis de un pluralismo moral infantil sobre la sexualidad y la imposibilidad de encasillar la complejidad del juicio moral en un único sendero teórico. Durante la interpretación de las justificaciones morales ofrezco una comparación de lo hallado entre géneros e instituciones educativas. Finalmente, formulo algunas sugerencias para la educación moral y sexual de los niños y niñas.

  20. Room-temperature ferromagnetism in Dy films doped with Ni

    Energy Technology Data Exchange (ETDEWEB)

    Edelman, I. [Kirensky Institute of Physics, Siberian Division, Russian Academy of Sciences, Akademgorodok, Krasnoyarsk 660036 (Russian Federation)], E-mail: ise@iph.krasn.ru; Ovchinnikov, S. [Kirensky Institute of Physics, Siberian Division, Russian Academy of Sciences, Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Siberian Federal University, Av. Svobodnyi 71, Krasnoyarsk 660074 (Russian Federation); Markov, V.; Kosyrev, N.; Seredkin, V.; Khudjakov, A.; Bondarenko, G. [Kirensky Institute of Physics, Siberian Division, Russian Academy of Sciences, Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Kesler, V. [Institute of Semiconductor Physics, Siberian Division, Russian Academy of Sciences, Av. Akademika Lavrent' eva 13, Novosibirsk 630090 (Russian Federation)

    2008-09-01

    Temperature, magnetic field and spectral dependences of magneto-optical effects (MOEs) in bi-layer films Dy{sub (1-x)}Ni{sub x}-Ni and Dy{sub (1-x)}(NiFe){sub x}-NiFe were investigated, x changes from 0 to 0.06. Peculiar behavior of the MOEs was revealed at temperatures essentially exceeding the Curie temperature of bulk Dy which is explained by the magnetic ordering of the Dy layer containing Ni under the action of two factors: Ni impurities distributed homogeneously over the whole Dy layer and atomic contact of this layer with continues Ni layer. The mechanism of the magnetic ordering is suggested to be associated with the change of the density of states of the alloy Dy{sub (1-x)}Ni{sub x} owing to hybridization with narrow peaks near the Fermi level character for Ni.

  1. The relationship between the addition method of the Ni-activator and the sinterability for the Ni-doped W-powder compact

    International Nuclear Information System (INIS)

    Moon, I.H.; Kim, J.S.

    1984-01-01

    The relationship between the nickel size added to tungsten powder and the sinterability was investigated for the Ni-doped W-powder compact. The Ni-added W-powder compact with various particle size ratios of W to Ni were prepared by mechanical mixing as well as by salt solution and reduction method. In the latter method the size of reduced Ni-particle could be controlled by drying rate of salt solution. The smaller the size of nickel particles added to W was, the activatedly sintered W-powder compact has shown higher sinterability in the initial stage of sintering. The dependence of sinterability on the size of Ni-activator could be partly explained by some physical characteristics of Ni-activator at sintering temperature. (Auth.)

  2. Pd surface functionalization of 3D electroformed Ni and Ni-Mo alloy metallic nanofoams for hydrogen production

    Science.gov (United States)

    Petica, A.; Brincoveanu, O.; Golgovici, F.; Manea, A. C.; Enachescu, M.; Anicai, L.

    2018-03-01

    The paper presents some experimental results regarding the functionalization of 3D electroformed Ni and Ni-Mo alloy nanofoams with Pd nanoclusters, as potential cathodic materials suitable for HER during seawater electrolysis. The electrodeposition from aqueous electrolytes containing NiCl2 and NH4Cl has been applied to prepare the 3D Ni nanofoams. Ni-Mo alloys have been electrodeposited involving aqueous ammonium citrate type electrolytes. Pd surface functionalization has been performed using both electroless and electrochemical procedures. Pd content varied in the range of 0.5 – 8 wt.%, depending on the applied procedure and the operation conditions. The use of a porous structure associated with alloying element (i.e. Mo) and Pd surface functionalization facilitated enhanced performances from HER view point in seawater electrolyte (lower Tafel slopes). The determined Tafel slope values ranged from 123 to 105 mV.dec-1, suggesting the Volmer step as rate determining step. The improvement of the HER catalytic activity may be ascribed to a synergistic effect between the high real active area of the 3D electroformed metallic substrate, Ni alloying with a left transition metal and surface modification using Pd noble metal.

  3. Effects of P/Ni ratio and Ni content on performance of γ-Al2O3-supported nickel phosphides for deoxygenation of methyl laurate to hydrocarbons

    Science.gov (United States)

    Zhang, Zhena; Tang, Mingxiao; Chen, Jixiang

    2016-01-01

    γ-Al2O3-supported nickel phosphides (mNi-Pn) were prepared by the TPR method and tested for the deoxygenation of methyl laurate to hydrocarbons. The effects of the P/Ni ratio (n = 1.0-2.5) and Ni content (m = 5-15 wt.%) in the precursors on their structure and performance were investigated. Ni/γ-Al2O3 was also studied for comparison. It was found that the formation of AlPO4 in the precursor inhibited the reduction of phosphate and so the formation of nickel phosphides. With increasing the P/Ni ratio and Ni content, the Ni, Ni3P, Ni12P5 and Ni2P phases orderly formed, accompanying with the increases of their particle size and the amount of weak acid sites (mainly due to P-OH group), while the CO uptake and the amount of medium strong acid sites (mainly related to Ni sites) reached maximum on 10%Ni-P1.5. In the deoxygenation reaction, compared with Ni/γ-Al2O3, the mNi-Pn catalysts showed much lower activities for decarbonylation, Csbnd C hydrogenolysis and methanation due to the ligand and ensemble effects of P. The conversion and the selectivity to n-C11 and n-C12 hydrocarbons achieved maximum on 10%Ni-P 2.0 for the 10%Ni-Pn catalysts and on 8%Ni-P2.0 for the mNi-P2.0 catalysts, while the turnover frequency (TOF) of methyl laurate mainly increased with the P/Ni ratio and Ni content. We propose that TOF was influenced by the nickel phosphide phases, the catalyst acidity and the particle size as well as the synergetic effect between the Ni site and acid site. Again, the hydrodeoxygenation pathway of methyl laurate was promoted with increasing P/Ni ratio and Ni content, ascribed to the phase change in the order of Ni, Ni3P, Ni12P5 and Ni2P in the prepared catalysts.

  4. Linear thermal expansion coefficient of cast Fe-Ni invar and Fe-Ni-Co superinvar alloys

    International Nuclear Information System (INIS)

    Ogorodnikova, O.M.; Chermenskaya, E.V.; Rabinovich, S.V.; Grachev, S.V.

    1999-01-01

    Cast invar alloys Fe-Ni (28-35 wt. % Ni) are investigated using metallography, dilatometry and X-ray methods as soon as the crystallization is completed and again after low-temperature treatment resulting in martensitic transformation in low nickel alloys. Nickel distribution in a cast superinvar Fe-32% Ni-4% Co is studied by means of X-ray spectrum microanalysis. The results obtained permit the correction of model concepts about cast invars and the estimate of a coefficient of linear expansion depending on phase composition and nickel microsegregation [ru

  5. Micro-structural characterization of low resistive metallic Ni germanide growth on annealing of Ni-Ge multilayer

    Directory of Open Access Journals (Sweden)

    Mitali Swain

    2015-07-01

    Full Text Available Nickel-Germanides are an important class of metal semiconductor alloys because of their suitability in microelectronics applications. Here we report successful formation and detailed characterization of NiGe metallic alloy phase at the interfaces of a Ni-Ge multilayer on controlled annealing at relatively low temperature ∼ 250 °C. Using x-ray and polarized neutron reflectometry, we could estimate the width of the interfacial alloys formed with nanometer resolution and found the alloy stoichiometry to be equiatomic NiGe, a desirable low-resistance interconnect. We found significant drop in resistance (∼ 50% on annealing the Ni-Ge multilayer suggesting metallic nature of alloy phase at the interfaces. Further we estimated the resistivity of the alloy phase to be ∼ 59μΩ cm.

  6. Glass forming ability of the Al-Ce-Ni system; Avaliacao da capacidade de formacao vitrea do sistema Al-Ce-Ni

    Energy Technology Data Exchange (ETDEWEB)

    Triveno Rios, C. [Engenharia Mecanica, Universidade Federal de Mato Grosso, Rondonopolis, MT (Brazil)], e-mail: triveno@ufmt.br; Surinach, S.; Baro, M.D. [Departamento de Engenharia de Materiais - Universidade Federal de Sao Carlos, SP (Brazil); Bolfarini, C.; Botta, W.J.; Kiminami, C.S. [Departamento de Fisica da Universidade Autonoma de Barcelona, Bellaterra (Spain)

    2010-07-01

    In the present work, the glass forming ability (GFA) and its compositional dependence on Al-Ni-Ce system alloys were investigated in function of several thermal parameters. Rapidly quenched Al{sub 85}Ni{sub 15}-{sub X}Ce{sub X} (X=4,5,6,7,10), Al{sub 90}Ni{sub 5}Ce{sub 5}, Al{sub 89}Ni{sub 2}.{sub 4}Ce{sub 8}.{sub 6}, Al{sub 80}Ni{sub 15.6}Ce{sub 4}.{sub 4} and Al{sub 78}Ni{sub 18.5}Ce{sub 3.5} amorphous ribbons were produced by melt-spinning and the structural transformation during heating was studied using a combination of X-ray diffraction (XRD) and differential scanning calorimetry (DSC). The results showed that the GFA and the thermal stability in the Al-rich corner of Al- Ni-Ce system alloys were enhanced by increasing the solute content and specifically the Ce content (author)

  7. Morphological and compositional engineering of Ni/carbon ...

    Indian Academy of Sciences (India)

    Ni/multi-walled carbon nanotubes (MWCNTs) composite films were deposited on the glassy carbon electrode (GCE) by a Ni plating bath containing homogeneously dispersed MWCNTs using polyvinylpyrrolidone (PVP) as dispersion additive. Incorporation of MWCNTs into Ni matrix was greatly enhanced by the application ...

  8. Anti-corrosive and anti-microbial properties of nanocrystalline Ni-Ag coatings

    Energy Technology Data Exchange (ETDEWEB)

    Raghupathy, Y.; Natarajan, K.A.; Srivastava, Chandan, E-mail: csrivastava@materials.iisc.ernet.in

    2016-04-15

    Graphical abstract: - Highlights: • Electrodeposition yielded phase-segregated, nanocrystalline Ni-Ag coatings. • Ni-Ag alloys exhibited smaller Ni crystals compared to pure Ni. • Ultra fine Ni grains of size 12–14 nm favoured Ni-Ag solid solution. • Nanocrystalline Ag resisted bio-fouling by Sulphate Reducing bacteria. • Ni-Ag outperformed pure Ni in corrosion and bio-corrosion tests. - Abstract: Anti-corrosive and anti-bacterial properties of electrodeposited nanocrystalline Ni-Ag coatings are illustrated. Pure Ni, Ni-7 at.% Ag, & Ni-14 at.% Ag coatings were electrodeposited on Cu substrate. Coating consisted of Ni-rich and Ag-rich solid solution phases. With increase in the Ag content, the corrosion resistance of the Ni-Ag coating initially increased and then decreased. The initial increase was due to the Ni-Ag solid solution. The subsequent decrease was due to the increased galvanic coupling between the Ag-rich and Ni-rich phases. For all Ag contents, the corrosion resistance of the Ni-Ag coating was higher than the pure Ni coating. Exposure to Sulphate Reducing Bacteria (SRB) revealed that the extent of bio-fouling decreased with increase in the Ag content. After 2 month exposure to SRB, the Ni-Ag coatings demonstrated less loss in corrosion resistance (58% for Ni-7 at.% Ag and 20% for Ni-14 at.% Ag) when compared pure Ni coating (115%).

  9. The Nišava river water quality as the indicator of the sustainable development of the city of Niš

    Directory of Open Access Journals (Sweden)

    Branković Saša

    2007-01-01

    Full Text Available The Nišava river has a great importance for the sustainable development of the city of Niš. From the Mediana spring, which is on the bank of the Nišava, the city of Niš satisfies around 30% of its water demand. The aim of this paper is to, on the basis of the analysis of several tens of parameters of water quality; determine whether the Nišava river is a limiting factor to the sustainable development of the city of Niš. For this purpose the data of Public Utility Company Naissus have been used, as it collects daily samples of the Nišava river water. The number of conducted analyses, depending on the water quality parameters, varies from 1 to 1,240. The obtained results, which have been presented in detail in the paper, indicate that a great majority of analyses, of almost all the water quality parameters, is within predicted range. At the end of the paper, certain measures have been proposed, which should contribute to the sustainable development of Niš in this field. .

  10. Level structure of 60Ni from the 58Ni(α,2p#betta#) reaction

    International Nuclear Information System (INIS)

    Chan, T.U.; Morand, C.; Azgui, F.

    1982-03-01

    The 60 Ni nucleus has been studied via the 58 Ni (α, 2p#betta#) reaction at Esub(α)=32 MeV using in-beam #betta# spectroscopy techniques. High-spin states up to 10 MeV excitation have been established. Among the 5 branches depopulating the Yrast Jsup(π)=7 - state, has been found an E3 transition down to the 4 + state. Comparison with direct reaction results leads to assign very probably the [#betta#fsub(5/2),#betta#gsub(9/2)] 7 - configuration to the Jsup(π)=7 - Yrast state at 5349 keV. Other high-spin states might be accounted for by the breaking of the 56 Ni core

  11. High resolution TEM study of Ni4Ti3 precipitates in austenitic Ni51Ti49

    International Nuclear Information System (INIS)

    Tirry, Wim; Schryvers, Dominique

    2003-01-01

    Binary NiTi with a composition of 51 at.% Ni was heat treated to form lens-shaped Ni 4 Ti 3 precipitates that are coherent or semi-coherent with the B2 matrix. High resolution transmission electron microscopy (HRTEM) was used to study the internal structure of the precipitates, precipitate-precipitate and matrix-precipitate interfaces and the deformation of the B2 matrix near a precipitate. Observations were made in the B2 and B2 zones and compared with computer simulated high resolution images. The B2 observations made it possible to study the [0 0 1] H zone orientation of Ni 4 Ti 3 (direction defined according to the hexagonal unit cell of Ni 4 Ti 3 ) which corresponds to the normal of the central plane of the discs. In these images the superperiodicity of the 4:3 ordering is clearly visible confirming the known atomic structure. Close to the precipitate the B2 matrix is deformed, as determined by measuring the interplanar spacing from the HRTEM images. The observed deformations are compared with theoretical models for the stress field

  12. Behavior and effect of Ti2Ni phase during processing of NiTi shape memory alloy wire from cast ingot

    International Nuclear Information System (INIS)

    Bhagyaraj, J.; Ramaiah, K.V.; Saikrishna, C.N.; Bhaumik, S.K.; Gouthama

    2013-01-01

    Highlights: •Ti 2 Ni second phase particles forms in different sizes and shapes in cast ingot. •TEM evidences showed shearing/fragmentation of Ti 2 Ni during processing. •Matrix close to Ti 2 Ni experienced severe plastic deformation lead to amorphisation. •Ti 2 Ni interfaces were mostly faceted and assist in nucleation of martensite. •Heterogeneity of microstructure observed near to and away from Ti 2 Ni. -- Abstract: Binary NiTi alloy is one of the commercially successful shape memory alloys (SMAs). Generally, the NiTi alloy composition used for thermal actuator application is slightly Ti-rich. In the present study, vacuum arc melted alloy of 50.2Ti–Ni (at.%) composition was prepared and characterized using optical, scanning and transmission electron microcopy. Formation of second phase particles (SPPs) in the cast alloy and their influence on development of microstructure during processing of the alloy into wire form has been investigated. Results showed that the present alloy contained Ti 2 Ni type SPPs in the matrix. In the cast alloy, the Ti 2 Ni particles form in varying sizes (1–10 μm) and shapes. During subsequent thermo-mechanical processing, these SPPs get sheared/fragmented into smaller particles with low aspect ratio. The presence of SPPs plays a significant role in refinement of the microstructure during processing of the alloy. During deformation of the alloy, the matrix phase around the SPPs experiences conditions similar to that observed in severe plastic deformation of metallic materials, leading to localized amorphisation of the matrix phase

  13. Chemical profiling approach to evaluate the influence of traditional and simplified decoction methods on the holistic quality of Da-Huang-Xiao-Shi decoction using high-performance liquid chromatography coupled with diode-array detection and time-of-flight mass spectrometry.

    Science.gov (United States)

    Yan, Xuemei; Zhang, Qianying; Feng, Fang

    2016-04-01

    Da-Huang-Xiao-Shi decoction, consisting of Rheum officinale Baill, Mirabilitum, Phellodendron amurense Rupr. and Gardenia jasminoides Ellis, is a traditional Chinese medicine used for the treatment of jaundice. As described in "Jin Kui Yao Lue", a traditional multistep decoction of Da-Huang-Xiao-Shi decoction was required while simplified one-step decoction was used in recent repsorts. To investigate the chemical difference between the decoctions obtained by the traditional and simplified preparations, a sensitive and reliable approach of high-performance liquid chromatography coupled with diode-array detection and electrospray ionization time-of-flight mass spectrometry was established. As a result, a total of 105 compounds were detected and identified. Analysis of the chromatogram profiles of the two decoctions showed that many compounds in the decoction of simplified preparation had changed obviously compared with those in traditional preparation. The changes of constituents would be bound to cause the differences in the therapeutic effects of the two decoctions. The present study demonstrated that certain preparation methods significantly affect the holistic quality of traditional Chinese medicines and the use of a suitable preparation method is crucial for these medicines to produce special clinical curative effect. This research results elucidated the scientific basis of traditional preparation methods in Chinese medicines. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Three-dimensional hierarchical NiCo2O4 nanowire@Ni3S2 nanosheet core/shell arrays for flexible asymmetric supercapacitors

    Science.gov (United States)

    Liu, Bo; Kong, Dezhi; Huang, Zhi Xiang; Mo, Runwei; Wang, Ye; Han, Zhaojun; Cheng, Chuanwei; Yang, Hui Ying

    2016-05-01

    Three-dimensional (3D) hierarchical NiCo2O4@Ni3S2 core/shell arrays on Ni foam were synthesized by a facile, stepwise synthesis approach. The 3D heterogeneous NiCo2O4 nanostructure forms an interconnected web-like scaffold and serves as the core for the Ni3S2 shell. The as-prepared NiCo2O4@Ni3S2 nanowire array (NWA) electrodes exhibited excellent electrochemical performance, such as high specific areal capacitance and excellent cycling stability. The specific areal capacitance of 3.0 F cm-2 at a current density of 5 mA cm-2 is among the highest values and the only 6.7% capacitance decay after 10 000 cycles demonstrates the excellent cycling stability. A flexible asymmetric supercapacitor (ASC) was fabricated with activated carbon (AC) as the anode and the obtained NiCo2O4@Ni3S2 NWAs as the cathode. The ASC device exhibited a high energy density of 1.89 mW h cm-3 at 5.81 W cm-3 and a high power density of 56.33 W cm-3 at 0.94 mW h cm-3. As a result, the hybrid nanoarchitecture opens a new way to design high performance electrodes for electrochemical energy storage applications.Three-dimensional (3D) hierarchical NiCo2O4@Ni3S2 core/shell arrays on Ni foam were synthesized by a facile, stepwise synthesis approach. The 3D heterogeneous NiCo2O4 nanostructure forms an interconnected web-like scaffold and serves as the core for the Ni3S2 shell. The as-prepared NiCo2O4@Ni3S2 nanowire array (NWA) electrodes exhibited excellent electrochemical performance, such as high specific areal capacitance and excellent cycling stability. The specific areal capacitance of 3.0 F cm-2 at a current density of 5 mA cm-2 is among the highest values and the only 6.7% capacitance decay after 10 000 cycles demonstrates the excellent cycling stability. A flexible asymmetric supercapacitor (ASC) was fabricated with activated carbon (AC) as the anode and the obtained NiCo2O4@Ni3S2 NWAs as the cathode. The ASC device exhibited a high energy density of 1.89 mW h cm-3 at 5.81 W cm-3 and a high power

  15. Bimetallic NiFe2O4 synthesized via confined carburization in NiFe-MOFs for efficient oxygen evolution reaction

    Science.gov (United States)

    Fang, Zhiqiang; Hao, Zhaomin; Dong, Qingsong; Cui, Yong

    2018-04-01

    Transition metal oxides that derived from metal-organic framework (MOF) precursor have intensively received attention because of their numerous electrochemical applications. Bimetallic Ni-Fe oxides have been rarely reported on the basis of MOF-related strategy. Herein, a bimetallic NiFe2O4 was successfully synthesized via confined carburization in NiFe-MOF precursors and characterized by XRD, XPS, SEM, and TEM. After conducting an investigation of oxygen evolution reaction (OER), the as-synthesized NiFe2O4 material exhibited good catalytic efficiency and high stability and durability in alkaline media. The as-synthesized NiFe2O4 material would promote the development of MOFs in non-noble-metal OER catalyst.

  16. Microstructure of Vacuum-Brazed Joints of Super-Ni/NiCr Laminated Composite Using Nickel-Based Amorphous Filler Metal

    Science.gov (United States)

    Ma, Qunshuang; Li, Yajiang; Wu, Na; Wang, Juan

    2013-06-01

    Vacuum brazing of super-Ni/NiCr laminated composite and Cr18-Ni8 stainless steel was carried out using Ni-Cr-Si-B amorphous filler metal at 1060, 1080, and 1100 °C, respectively. Microstructure and phase constitution were investigated by means of optical and scanning electron microscopy, energy-dispersive spectroscopy, x-ray diffraction, and micro-hardness tester. When brazed at 1060-1080 °C, the brazed region can be divided into two distinct zones: isothermally solidified zone (ISZ) consisting of γ-Ni solid solution and athermally solidified zone (ASZ) consisting of Cr-rich borides. Micro-hardness of the Cr-rich borides formed in the ASZ was as high as 809 HV50 g. ASZ decreased with increase of the brazing temperature. Isothermal solidification occurred sufficiently at 1100 °C and an excellent joint composed of γ-Ni solid solution formed. The segregation of boron from ISZ to residual liquid phase is the reason of Cr-rich borides formed in ASZ. The formation of secondary precipitates in diffusion-affected zone is mainly controlled by diffusion of B.

  17. An ac susceptibility study in capped Ni/Ni(OH)2 core-shell nanoassemblies: dual peak observations

    International Nuclear Information System (INIS)

    Godsell, Jeffrey F; Roy, Saibal; Bala, Tanushree; Ryan, Kevin M.

    2011-01-01

    In this study, the ac susceptibility (χ' and χ'') variation with temperature (10-100 K) for oleic acid (OA) capped Ni/Ni(OH) 2 core-shell nanoparticle assemblies are reported at frequencies varying from 0.1 to 1000 Hz. Nanoparticle assemblies, with two average particle diameters of ∼34 nm and ∼14 nm, were synthesized using a wet chemical synthesis approach. Two peaks in the ac susceptibility versus temperature curves are clearly discernable for each of the samples. The first, occurring at ∼22 K was attributed to the paramagnetic/antiferromagnetic transition of the Ni(OH) 2 present in the shell. The second higher temperature peak was attributed to the superparamagnetic blocking of the pure Ni situated at the core of the nanoparticles. The higher temperature peaks in both the χ' and χ'' curves were observed to increase with increasing frequency. Thus the Neel and the blocking temperatures for such core-shell nanoassemblies were clearly identified from the ac analysis, whereas they were not discernible (superimposed) even from very low dc (FC/ZFC) field measurements. Interparticle interactions within the assemblies were studied through the fitting of phenomenological laws to the experimental datasets. It is observed that even with an OA capping layer, larger Ni/Ni(OH) 2 nanoparticles experience a greater degree of sub-capping layer oxidation thus producing lower magnetic interaction strengths.

  18. Fundamental Studies of Recombinant Hydrogenases

    Energy Technology Data Exchange (ETDEWEB)

    Adams, Michael W. [Univ. of Georgia, Athens, GA (United States)

    2014-01-25

    This research addressed the long term goals of understanding the assembly and organization of hydrogenase enzymes, of reducing them in size and complexity, of determining structure/function relationships, including energy conservation via charge separation across membranes, and in screening for novel H2 catalysts. A key overall goal of the proposed research was to define and characterize minimal hydrogenases that are produced in high yields and are oxygen-resistant. Remarkably, in spite of decades of research carried out on hydrogenases, it is not possible to readily manipulate or design the enzyme using molecular biology approaches since a recombinant form produced in a suitable host is not available. Such resources are essential if we are to understand what constitutes a “minimal” hydrogenase and design such catalysts with certain properties, such as resistance to oxygen, extreme stability and specificity for a given electron donor. The model system for our studies is Pyrococcus furiosus, a hyperthermophile that grows optimally at 100°C, which contains three different nickel-iron [NiFe-] containing hydrogenases. Hydrogenases I and II are cytoplasmic while the other, MBH, is an integral membrane protein that functions to both evolve H2 and pump protons. Three important breakthroughs were made during the funding period with P. furiosus soluble hydrogenase I (SHI). First, we produced an active recombinant form of SHI in E. coli by the co-expression of sixteen genes using anaerobically-induced promoters. Second, we genetically-engineered P. furiosus to overexpress SHI by an order of magnitude compared to the wild type strain. Third, we generated the first ‘minimal’ form of SHI, one that contained two rather than four subunits. This dimeric form was stable and active, and directly interacted with a pyruvate-oxidizing enzyme with any intermediate electron carrier. The research resulted in five peer-reviewed publications.

  19. Ni(OH){sub 2} nanoflakes electrodeposited on Ni foam-supported vertically oriented graphene nanosheets for application in asymmetric supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xin; Liu, Jiyue; Wang, Yayu; Zhao, Cuimei; Zheng, Weitao, E-mail: wtzheng@jlu.edu.cn

    2014-04-01

    Highlights: • Ni(OH){sub 2}/vertically oriented graphene nanosheets (V-GNs) was prepared. • Ni(OH){sub 2}/V-GNs had enhanced specific capacitance, cycling reversibility and stability. • Performance of Ni(OH){sub 2}/GNs/NF-AC asymmetric supercapacitor was studied. - Abstract: Binderless Ni(OH){sub 2} nanoflakes grown on Ni foam (NF)-supported vertically oriented graphene nanosheets (V-GNs) has been fabricated as a positive electrode material for asymmetric supercapacitor (ASC), coupled with activated carbon (AC) as a counter electrode material. The introduction of V-GNs leads to dense growth of nanocrystalline β-Ni(OH){sub 2} that is confirmed by X-ray diffraction, transmission electron microscopic and scanning electron microscopic analyses. The electrochemical performances of the Ni(OH){sub 2}/GNs/NF electrode are characterized by cyclic voltammetry and charge–discharge tests, which exhibit high specific capacitance of 2215 F g{sup −1} at a scan current density of 2.3 A g{sup −1}, enhanced cycling stability and high rate capability. The Ni(OH){sub 2}/GNs/NF-AC-based ASC can achieve a cell voltage of 1.4 V and a specific energy density of 11.11 Wh kg{sup −1} at 0.5 mA cm{sup −2} with a nearly 100% coulombic efficiency at room temperature.

  20. The effect of Fe2NiO4 and Fe4NiO4Zn magnetic nanoparticles on anaerobic digestion activity.

    Science.gov (United States)

    Chen, Jian Lin; Steele, Terry W J; Stuckey, David C

    2018-06-11

    Two types of magnetic nanoparticles (MNPs), i.e. Ni ferrite nanoparticles (Fe 2 NiO 4 ) and Ni Zn ferrite nanoparticles (Fe 4 NiO 4 Zn) containing the trace metals Ni and Fe, were added to the anaerobic digestion of synthetic municipal wastewater at concentrations between 1 and 100 mg Ni L -1 in order to compare their effects on biogas (methane) production and sludge activity. Using the production of methane over time as a measure, the assays revealed that anaerobic digestion was stimulated by the addition of 100 mg Ni L -1 in Fe 2 NiO 4 NPs, while it was inhibited by the addition of 1-100 mg Ni L -1 in Fe 4 NiO 4 Zn NPs. Especially at 100 mg Ni L -1 , Fe 4 NiO 4 Zn NPs resulted in a total inhibition of anaerobic digestion. The metabolic activity of the anaerobic sludge was tested using the resazurin reduction assay, and the assay clearly revealed the negative effect of Fe 4 NiO 4 Zn NPs and the positive effect of Fe 2 NiO 4 NPs. Re-feeding fresh synthetic medium reactivated the NPs added to the anaerobic sludge, except for the experiment with 100 mg Ni L -1 addition of Fe 4 NiO 4 Zn NPs. The findings in this present study indicate a possible new strategy for NPs design to enhance anaerobic digestion. Crown Copyright © 2018. Published by Elsevier B.V. All rights reserved.

  1. Microstructure and property of directionally solidified Ni-Si hypereutectic alloy

    Science.gov (United States)

    Cui, Chunjuan; Tian, Lulu; Zhang, Jun; Yu, Shengnan; Liu, Lin; Fu, Hengzhi

    2016-03-01

    This paper investigates the influence of the solidification rate on the microstructure, solid/liquid interface, and micro-hardness of the directionally solidified Ni-Si hypereutectic alloy. Microstructure of the Ni-Si hypereutectic alloy is refined with the increase of the solidification rate. The Ni-Si hypereutectic composite is mainly composed of α-Ni matrix, Ni-Ni3Si eutectic phase, and metastable Ni31Si12 phase. The solid/liquid interface always keeps planar interface no matter how high the solidification rate is increased. This is proved by the calculation in terms of M-S interface stability criterion. Moreover, the Ni-Si hypereutectic composites present higher micro-hardness as compared with that of the pure Ni3Si compound. This is caused by the formation of the metastable Ni31Si12 phase and NiSi phase during the directional solidification process.

  2. Quantitative analysis of Ni2+/Ni3+ in Li[NixMnyCoz]O2 cathode materials: Non-linear least-squares fitting of XPS spectra

    Science.gov (United States)

    Fu, Zewei; Hu, Juntao; Hu, Wenlong; Yang, Shiyu; Luo, Yunfeng

    2018-05-01

    Quantitative analysis of Ni2+/Ni3+ using X-ray photoelectron spectroscopy (XPS) is important for evaluating the crystal structure and electrochemical performance of Lithium-nickel-cobalt-manganese oxide (Li[NixMnyCoz]O2, NMC). However, quantitative analysis based on Gaussian/Lorentzian (G/L) peak fitting suffers from the challenges of reproducibility and effectiveness. In this study, the Ni2+ and Ni3+ standard samples and a series of NMC samples with different Ni doping levels were synthesized. The Ni2+/Ni3+ ratios in NMC were quantitatively analyzed by non-linear least-squares fitting (NLLSF). Two Ni 2p overall spectra of synthesized Li [Ni0.33Mn0.33Co0.33]O2(NMC111) and bulk LiNiO2 were used as the Ni2+ and Ni3+ reference standards. Compared to G/L peak fitting, the fitting parameters required no adjustment, meaning that the spectral fitting process was free from operator dependence and the reproducibility was improved. Comparison of residual standard deviation (STD) showed that the fitting quality of NLLSF was superior to that of G/L peaks fitting. Overall, these findings confirmed the reproducibility and effectiveness of the NLLSF method in XPS quantitative analysis of Ni2+/Ni3+ ratio in Li[NixMnyCoz]O2 cathode materials.

  3. In situ observation of Cu-Ni alloy nanoparticle formation by X-ray diffraction, X-ray absorption spectroscopy, and transmission electron microscopy: Influence of Cu/Ni ratio

    DEFF Research Database (Denmark)

    Wu, Qiongxiao; Duchstein, Linus Daniel Leonhard; Chiarello, Gian Luca

    2014-01-01

    Silica-supported, bimetallic Cu-Ni nanomaterials were prepared with different ratios of Cu to Ni by incipient wetness impregnation without a specific calcination step before reduction. Different in situ characterization techniques, in particular transmission electron microscopy (TEM), X-ray...... diffraction (XRD), and X-ray absorption spectroscopy (XAS), were applied to follow the reduction and alloying process of Cu-Ni nanoparticles on silica. In situ reduction of Cu-Ni samples with structural characterization by combined synchrotron XRD and XAS reveals a strong interaction between Cu and Ni species......, which results in improved reducibility of the Ni species compared with monometallic Ni. At high Ni concentrations silica-supported Cu-Ni alloys form a homogeneous solid solution of Cu and Ni, whereas at lower Ni contents Cu and Ni are partly segregated and form metallic Cu and Cu-Ni alloy phases. Under...

  4. Ni-YSZ Substrate Degradation during Carbon Deposition

    Directory of Open Access Journals (Sweden)

    Marinšek, Marjan

    2011-06-01

    Full Text Available Carbon deposition on various Ni-YSZ catalytic composites with average Ni particle size from 0.44 mm to 0.98 μm was studied under dry CH4-Ar and humidified CH4-Ar conditions. The change in the catalytic activity was monitored both as a mass gain due to carbon deposition and hydrogen evolution due to CH4 dehydrogenation on Ni-YSZ. Regarding the start of methane decomposition and subsequent catalyst deactivation rate, composites with smaller Ni-grains were much more active in comparison to those with relatively large grains. Dry methane conditions always caused coking of the catalyst substrate with substantial activity loss. In contrast, under humidified methane atmosphere conditions with a steam to carbon (S/C ratio of 0.82, catalytic activity of the Ni-YSZ composites remained nearly undiminished after 2,000 minutes at chosen deposition temperatures (600–800 °C. On the catalyst surface, some encapsulation of Ni with the deposited carbon was noticed while carbon filaments grew inside the treated samples. The dimensions of C-filaments were influenced by treatment conditions and Ni-YSZ substrate morphology.

    La deposición de carbón en diferentes compuestos catalizadores Ni-YSZ con un tamaño promedio de partícula Ni de 0.44 mm a 0.98 μm fue estudiado bajo condiciones secas: CH4-Ar y húmedas: CH4-Ar. El cambio de la actividad catalítica fue monitoreado tanto como una ganancia de masa debida a la deposición de carbón y una evolución de hidrógeno debido a la deshidrogenación de CH4 en Ni-YSZ. En cuanto al comienzo de descomposición del metano y a la subsiguiente desactivación del catalizador, aquellos compuestos con granos Ni menores fueron mucho más activos en comparación a aquellos con granos relativamente mayores. Las condiciones secas del metano siempre causaron coquificación del sustrato del catalizador con una sustancial pérdida de actividad. Por el

  5. Vacuum-Free, Maskless Patterning of Ni Electrodes by Laser Reductive Sintering of NiO Nanoparticle Ink and Its Application to Transparent Conductors

    KAUST Repository

    Lee, Daeho; Paeng, Dongwoo; Park, Hee K.; Grigoropoulos, Costas P.

    2014-01-01

    © 2014 American Chemical Society. We introduce a method for direct patterning of Ni electrodes through selective laser direct writing (LDW) of NiO nanoparticle (NP) ink. High-resolution Ni patterns are generated from NiO NP thin films by a vacuum

  6. Effects of P/Ni ratio and Ni content on performance of γ-Al_2O_3-supported nickel phosphides for deoxygenation of methyl laurate to hydrocarbons

    International Nuclear Information System (INIS)

    Zhang, Zhena; Tang, Mingxiao; Chen, Jixiang

    2016-01-01

    Graphical abstract: - Highlights: • The formation of AlPO_4 was unfavorable for that of nickel phosphides. • The phase compositions of nickel phosphide depended on the amount of reduced P. • Catalytic activity was determined by surface Ni site density and catalyst acidity. • HDO pathway was promoted by increasing P/Ni ratio and Ni content. • Nickel phosphide gave much higher carbon yield and lower H_2 consumption than Ni. - Abstract: γ-Al_2O_3-supported nickel phosphides (mNi-Pn) were prepared by the TPR method and tested for the deoxygenation of methyl laurate to hydrocarbons. The effects of the P/Ni ratio (n = 1.0–2.5) and Ni content (m = 5–15 wt.%) in the precursors on their structure and performance were investigated. Ni/γ-Al_2O_3 was also studied for comparison. It was found that the formation of AlPO_4 in the precursor inhibited the reduction of phosphate and so the formation of nickel phosphides. With increasing the P/Ni ratio and Ni content, the Ni, Ni_3P, Ni_1_2P_5 and Ni_2P phases orderly formed, accompanying with the increases of their particle size and the amount of weak acid sites (mainly due to P-OH group), while the CO uptake and the amount of medium strong acid sites (mainly related to Ni sites) reached maximum on 10%Ni-P1.5. In the deoxygenation reaction, compared with Ni/γ-Al_2O_3, the mNi-Pn catalysts showed much lower activities for decarbonylation, C−C hydrogenolysis and methanation due to the ligand and ensemble effects of P. The conversion and the selectivity to n-C11 and n-C12 hydrocarbons achieved maximum on 10%Ni-P 2.0 for the 10%Ni-Pn catalysts and on 8%Ni-P2.0 for the mNi-P2.0 catalysts, while the turnover frequency (TOF) of methyl laurate mainly increased with the P/Ni ratio and Ni content. We propose that TOF was influenced by the nickel phosphide phases, the catalyst acidity and the particle size as well as the synergetic effect between the Ni site and acid site. Again, the hydrodeoxygenation pathway of methyl

  7. DFT study on dry reforming of methane over Ni2Fe overlayer of Ni(1 1 1) surface

    Science.gov (United States)

    Xu, Li-li; Wen, Hong; Jin, Xin; Bing, Qi-ming; Liu, Jing-yao

    2018-06-01

    We reported the complete catalytic cycle of dry reforming of methane (DRM) on Ni2Fe overlayer of Ni(1 1 1) surface by periodic density functional theory (DFT) calculations. The pathways for dehydrogenation of CH4 and CO2 activation were located. Our results demonstrate that compared with pure Ni(1 1 1) surface, the introduction Fe into Ni increases the energy barrier of CH dissociation to carbon and hydrogen atoms, thereby suppressing coke deposition on the surface, while it promotes the H-induced CO2 activation pathway to form OH radical, and thus not only the surface oxygen but also OH are responsible for the oxidation of CHx (x = 0,1) on the Ni2Fe overlayer. The most favorable pathway of CH/C oxidation is found to be CH∗ + OH∗ → CHOH∗ → CHO∗ + H∗ → CO∗ + 2H∗, with the rate-limiting energy barrier of 1.12 eV. Furthermore, since Fe is oxidized partially to FeO leading to a partial dealloying under DRM conditions, we also studied the surface-carbon removal and the activity for the reforming of methane on the FeO ribbon supported Ni(1 1 1) (FeO/Ni) interface by DFT+U method. The surface C reacts with lattice oxygen of FeO to produce CO via a Mars-van Krevelen (MvK) mechanism, with a very lower energy barrier of 0.16 eV. The present results show that the introduction of Fe into Ni has a positive effect on the activity toward DRM and has an improved coke resistance.

  8. The process of Ni-63 production and measurement of beta radiation of irradiated Ni-63

    International Nuclear Information System (INIS)

    Kim, Jin Joo; Uhma, Young Rang; Kim, Jong Bum; Choi, Sang Mu; Son, Kwang Jae; Hong, Jin Tae; Park, Jong Han

    2016-01-01

    It has the following characteristics: long service lifetime, high energy density, easy small-scale fabrication, and minimum maintenance. For this reasons, betavoltaic batteries are widely used in many low-power applications such as medical applications and power sources for micro electro-mechanical system (MEMS) because they can operate effectively at extreme environments. Proper selection of radioisotope is a critical factor in the design of a betavoltaic battery. The important factors affecting the performance of a betavoltaic battery are specific activity, half-life, and toxicity. In this study, a target for irradiation was produced using 99% Ni-62 metal power concentrate. Ni-62 target of 1 g was irradiated in MARIA reactor operated in Poland for 470 hours, and estimated production of Ni- 63 was calculated. Irradiated Ni-63 pellets were dissolved in HCl solution, and its beta radiation was measured by Liquid Scintillation Counter (LSC).

  9. Fabrication of TiNi/CFRP smart composite using cold drawn TiNi wires

    Science.gov (United States)

    Xu, Ya; Otsuka, Kazuhiro; Toyama, Nobuyuki; Yoshida, Hitoshi; Jang, Byung-Koog; Nagai, Hideki; Oishi, Ryutaro; Kishi, Teruo

    2002-07-01

    In recent years, pre-strained TiNi shape memory alloys (SMA) have been used for fabricating smart structure with carbon fibers reinforced plastics (CFRP) in order to suppress microscopic mechanical damages. However, since the cure temperature of CFRP is higher than the reverse transformation temperatures of TiNi SMA, special fixture jigs have to be used for keeping the pre-strain during fabrication, which restricted its practical application. In order to overcome this difficulty, we developed a new method to fabricate SMA/CFRP smart composites without using special fixture jigs by controlling the transformation temperatures of SMA during fabrication. This method consists of using heavily cold-worked wires to increase the reverse transformation temperatures, and of using flash electrical heating of the wires after fabrication in order to decrease the reverse transformation temperatures to a lower temperature range again without damaging the epoxy resin around SMA wires. By choosing proper cold-working rate and composition of TiNi alloys, the reverse transformation temperatures were well controlled, and the TiNi/CFRP hybrid smart composite was fabricated without using special fixture jigs. The damage suppressing effect of cold drawn wires embedded in CFRP was confirmed.

  10. Physical and mechanical metallurgy of NiAl

    Science.gov (United States)

    Noebe, Ronald D.; Bowman, Randy R.; Nathal, Michael V.

    1994-01-01

    Considerable research has been performed on NiAl over the last decade, with an exponential increase in effort occurring over the last few years. This is due to interest in this material for electronic, catalytic, coating and especially high-temperature structural applications. This report uses this wealth of new information to develop a complete description of the properties and processing of NiAl and NiAl-based materials. Emphasis is placed on the controlling fracture and deformation mechanisms of single and polycrystalline NiAl and its alloys over the entire range of temperatures for which data are available. Creep, fatigue, and environmental resistance of this material are discussed. In addition, issues surrounding alloy design, development of NiAl-based composites, and materials processing are addressed.

  11. Hydride Reactivity of Ni-II-X-Ni-II Entities : Mixed-Valent Hydrido Complexes and Reversible Metal Reduction

    NARCIS (Netherlands)

    Gehring, Henrike; Metzinger, Ramona; Herwig, Christian; Intemann, Julia; Harder, Sjoerd; Limberg, Christian

    After the lithiation of PYR-H2 (PYR2-=[{NC(Me)C(H)C(Me)NC6H3(iPr)2}2(C5H3N)]2-), which is the precursor of an expanded beta-diketiminato ligand system with two binding pockets, its reaction with [NiBr2(dme)] led to a dinuclear nickel(II)bromide complex, [(PYR)Ni(mu-Br)NiBr] (1). The bridging bromide

  12. Noble-metal-free NiO@Ni-ZnO/reduced graphene oxide/CdS heterostructure for efficient photocatalytic hydrogen generation

    Science.gov (United States)

    Chen, Fayun; Zhang, Laijun; Wang, Xuewen; Zhang, Rongbin

    2017-11-01

    Noble-metal-free semiconductor materials are widely used for photocatalytic hydrogen generation because of their low cost. ZnO-based heterostructures with synergistic effects exhibit an effective photocatalytic activity. In this work, NiO@Ni-ZnO/reduced graphene oxide (rGO)/CdS heterostructures are synthesized by a multi-step method. rGO nanosheets and CdS nanoparticles were introduced into the heterostructures via a redox reaction and light-assisted growth, respectively. A novel Ni-induced electrochemical growth method was developed to prepare ZnO rods from Zn powder. NiO@Ni-ZnO/rGO/CdS heterostructures with a wide visible-light absorption range exhibited highly photocatalytic hydrogen generation rates under UV-vis and visible light irradiation. The enhanced photocatalytic activity is attributed to the Ni nanoparticles that act as cocatalysts for capturing photoexcited electrons and the improved synergistic effect between ZnO and CdS due to the rGO nanosheets acting as photoexcited carrier transport channels.

  13. Hybrid Composite Ni(OH)(2)@NiCo2O4 Grown on Carbon Fiber Paper for High-Performance Supercapacitors

    Energy Technology Data Exchange (ETDEWEB)

    Huang, L; Chen, DC; Ding, Y; Wang, ZL; Zeng, ZZ; Liu, ML

    2013-11-13

    We have successfully fabricated and tested the electrochemical performance of supercapacitor electrodes consisting of Ni(OH)(2) nanosheets coated on NiCo2O4 nanosheets grown on carbon fiber paper (CFP) current collectors. When the NiCo2O4 nanosheets are replaced by Co3O4 nanosheets, however, the energy and power density as well as the rate capability of the electrodes are significantly reduced, most likely due to the lower conductivity of Co3O4 than that of NiCo2O4. The 3D hybrid composite Ni(OH)(2)/ NiCo2O4/CFP electrodes demonstrate a high areal capacitance of 5.2 F/cm(2) at a cycling current density of 2 rnA/cm(2), with a capacitance retention of 79% as the cycling current density was increased from 2 to 50 mA/cm(2). The remarkable performance of these hybrid composite electrodes implies that supercapacitors based on them have potential for many practical applications.

  14. Hybrid composite Ni(OH)2@NiCo2O4 grown on carbon fiber paper for high-performance supercapacitors.

    Science.gov (United States)

    Huang, Liang; Chen, Dongchang; Ding, Yong; Wang, Zhong Lin; Zeng, Zhengzhi; Liu, Meilin

    2013-11-13

    We have successfully fabricated and tested the electrochemical performance of supercapacitor electrodes consisting of Ni(OH)2 nanosheets coated on NiCo2O4 nanosheets grown on carbon fiber paper (CFP) current collectors. When the NiCo2O4 nanosheets are replaced by Co3O4 nanosheets, however, the energy and power density as well as the rate capability of the electrodes are significantly reduced, most likely due to the lower conductivity of Co3O4 than that of NiCo2O4. The 3D hybrid composite Ni(OH)2/NiCo2O4/CFP electrodes demonstrate a high areal capacitance of 5.2 F/cm(2) at a cycling current density of 2 mA/cm(2), with a capacitance retention of 79% as the cycling current density was increased from 2 to 50 mA/cm(2). The remarkable performance of these hybrid composite electrodes implies that supercapacitors based on them have potential for many practical applications.

  15. Hierarchical NiCo-LDH@NiOOH core-shell heterostructure on carbon fiber cloth as battery-like electrode for supercapacitor

    Science.gov (United States)

    Liang, Haoyan; Lin, Jinghuang; Jia, Henan; Chen, Shulin; Qi, Junlei; Cao, Jian; Lin, Tiesong; Fei, Weidong; Feng, Jicai

    2018-02-01

    Constructing rational structure and utilizing distinctive components are two important keys to promote the development of high performance supercapacitor. Herein, we adopt a facile two-step method to develop an in-situ heterostructure with NiCo-LDH nanowire as core and NiOOH nanosheets as shell on carbon fiber cloth. The resultant NiCo-LDH@NiOOH electrode exhibites a high specific capacitance of about 2622 F g-1 at 1 A g-1 and good cycling stability (88.5% remain after 10000 cycles). This reinforced electrochemical performance is benefit from the distinct core-shell structure, and takes advantage of the synergetic effect to supply more electrochemical active spots and pathways to accelerate electron and ion transport. Furthermore, the fabricated asymmetric supercapacitor of optimized NiCo-LDH@NiOOH//AC device displays a high energy density of 51.7 Wh kg-1 while the power density is 599 W kg-1 and presents a satisfying cycling performance.

  16. Structural features in Ni-Al alloys

    International Nuclear Information System (INIS)

    Abylkalykova, R.B.; Kveglis, L.I.; Rakhimova, U.A.; Nasokhova, Sh.B.; Tazhibaeva, G.B.

    2007-01-01

    Purpose of the work is study of structural transformations under diverse memory effect in Ni-Al alloys. Examination were conducted in following composition samples: Ni -75 at.% and Al - 25 at.%. The work is devoted to clarification reasons both formation atom-ordered structures in inter-grain boundaries of bulk samples under temperature action and static load. Revealed inter-grain inter-boundary layers in Ni-Al alloy both bulk and surface state have complicated structure

  17. Synthesis of Supported NiPt Bimetallic Nanoparticles, Methods for Controlling the Surface Coverage of Ni Nanoparticles With Pt, Methods Of Making NiPt Multilayer Core-Shell Structures and Application of the Supported Catalysts for CO2 Reforming

    KAUST Repository

    Li, Lidong; Anjum, Dalaver H.; Zhou, Lu; Laveille, Paco; Basset, Jean-Marie

    2015-01-01

    Embodiments of the present disclosure provide for supported Ni/Pt bimetallic nanoparticles, compositions including supported NiPt nanoparticles, methods of making supported NiPt nanoparticles, methods of using supported NiPt nanoparticles

  18. 59Ni and 63Ni separation from boric acid concentrates produced at NPP

    International Nuclear Information System (INIS)

    Fisera, O.

    2010-01-01

    Procedure for direct separation of radionickel from boric acid concentrate was developed. Quantitative separation from 100 mL of real concentrate on the column filled with 3 mL of PAN-DMG composite material was achieved. PAN-DMG material (dimethylglyoxime in porous beads of polyacrylonitrile) was compared with Ni Resin and DMG-PAN material exhibited higher sorption capacity for nickel than Ni Resin. (author)

  19. Annual energy review-1996; 1996 nen ni okeru juyona energy kankei jiko

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-07-20

    This paper reviews the important items concerned with energy in 1996. Primary energy supply sums to 529times10{sup 13}kcal increasing by 2.4% over last year. The growth rates of demand over last year are 2.5% in industry use, 3.7% in transport use, 3.7% in home use, and 1.3% in business use. On R & D trend of use technologies of energy resources, the following are described: (1) Petroleum: resource exploitation, transport, stock, refining, and petrochemistry, (2) Coal: resource exploitation, coal structure and property, processing, transport, liquefaction, gasification, carbonization, tar industry, carbon industry, and coal ash utilization, (3) Natural gas: resource exploitation, transport, storage, and conversion technology, (4) Natural energy: hydraulic, solar, geothermal, wind power, oceanic and biomass energies, and (5) Others: waste resources, hydrogen and alcohol. On R & D trend of energy conversion technology, combustion theory, boiler, engine, thermal energy system, and high-efficiency power generation technology are described. Environmental problems and their protective technologies are also described

  20. Drop behavior in acoustic standing waves; Teizaihachu ni okeru ekiteki no kyodo

    Energy Technology Data Exchange (ETDEWEB)

    Kamimura, H. [National Aerospace Laboratory, Tokyo (Japan); Yamanaka, T. [Yokohama National University, Yokohama (Japan)

    1997-10-01

    When new materials, such as those for space shuttles, are developed, it is necessary to hold then in a non-contacting manner. Described herein is behavior of drops in a holding device which utilizes acoustic radiation pressure. When an object sufficiently small as compared with wavelength of a sound wave is placed in acoustic standing waves, it is subjected to acoustic radiation pressure. Chandrasekahr developed the theory on the stability of a rotating drop by equating the entire mechanical energy of a drop with its surface energy. This theory, based on the assumption of symmetric surface energy, is incapable of theoretically dealing with multi-lobed waves evolved by surface tension. In this study, multi-lobed waves excited by sound waves in a rotating drop are analytically found without assuming symmetry of drop surface energy. The multi-lobe waves are first found on the assumption that the acoustic radiation pressure around a drop is constant. Then, the effects of the deformed drop on the radiation pressure around the drop are considered. In addition, the equation for the relationship between the radiation pressure and a drop that becomes oblate due to the radiation pressure is obtained. The theoretically derived results by this equation are in good agreement with the observed results by the ground and flight tests. 17 refs., 18 figs.