WorldWideScience

Sample records for shi gu pen

  1. Pen dosimeters

    SC/RP Group

    2006-01-01

    The Radiation Protection Group has decided to withdraw all pen dosimeters from the main PS and SPS access points. This will be effective as of January 2006. The following changes will be implemented: All persons working in a limited-stay controlled radiation area must wear an operational dosimeter in addition to their personal DIS dosimeter. Any persons not equipped with this additional dosimeter must contact the SC/RP Group, which will make this type of dosimeter available for temporary loan. A notice giving the phone numbers of the SC/RP Group members to contact will be displayed at the former distribution points for the pen dosimeters. Thank you for your cooperation. The SC/RP Group

  2. Research on Foreign Background and Musical Thought of Teng Gu

    Bo Zhang

    2014-12-01

    Full Text Available TENG Gu is a famous art historian in Republic of China. Together with early Chinese scholars studying abroad like ZONG Bai-hua, ZHU Guang-qian, DENG Yi-zhe, MA Cai and FU Bao-shi, he constructed a framework of early Chinese Art. We still know his influence after a century. In his artistic thought, the essential music idea occupies 1/3.He had given music the highest position among all arts and cultures. In his view, culture won’t have any value if art is removed. And all arts follow the rhythm of music.

  3. Women stereotypes in Shi Zhecun's short stories.

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  4. Dr. Shi Hanzhang's Experience in Treating Andropathy

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  5. Civil Engineering for the SHiP facility

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  6. Radiation protection studies for the SHiP facility

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  7. Dicty_cDB: SHI251 [Dicty_cDB

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  8. Dicty_cDB: SHI867 [Dicty_cDB

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  9. Dicty_cDB: SHI777 [Dicty_cDB

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  10. Dark matter at the SHiP experiment

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  11. The SHiP physics program

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  12. Why investors shy away from coal

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  13. The SHiP project at CERN

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  14. The SHiP experiment at CERN

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  15. De innemende verteller Louwrens Penning

    Ester, Hans

    2012-01-01

    Dutch author Louwrens Penning (1854 – 1927) indisputably contributed more than any other novelist in the Netherlands to the high degree of solidarity with the Boers before, during and after the Anglo- Boer War 1899 – 1902. Penning, being a believer in the Calvinist tradition, had a profound trust in God’s guidance of history. He identified the war of the Boer soldiers against the British imperialists with the rebellion of the Dutch out of their true religious convictions against t...

  16. La guía de aludes

    Agencia Estatal de Meteorología (España)

    2015-01-01

    Guía disponible en castellano, catalán, euskera y gallego La gestión del riesgo asociado a las avalanchas es una tarea compleja y multidisciplinar que incluye tanto la cartografía de las zonas proclives a los aludes como la predicción del fenómeno, la construcción de estructuras de defensa y el desencadenamiento artificial de las avalanchas. Sin embargo, ante todo, es imprescindible conocer el fenómeno y sus causas. Esta guía pretende ser una primera aproximación a dicho conocimiento a...

  17. Isodose plotting for pen plotters

    Rosen, I.I.

    1985-01-01

    A general algorithm for treatment plan isodose line plotting is described which is particularly useful for pen plotters. Unlike other methods of plotting isodose lines, this algorithm is designed specifically to reduce pen motion, thereby reducing plotting time and wear on the transport mechanism. Points with the desired dose value are extracted from the dose matrix and stored, sorted into continuous contours, and then plotted. This algorithm has been implemented on DEC PDP-11/60 and VAX-11/780 computers for use with two models of Houston Instrument pen plotters, two models of Tektronix vector graphics terminals, a DEC VT125 raster graphics terminal, and a DEC VS11 color raster graphics terminal. Its execution time is similar to simpler direct-plotting methods

  18. Brothers or Rivals? Iran and the Shi'a of Iraq

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  19. Extraction and beam transfer for the SHiP facility

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  20. Asymmetric Penning trap coherent states

    Contreras-Astorga, Alonso; Fernandez, David J.

    2010-01-01

    By using a matrix technique, which allows to identify directly the ladder operators, the coherent states of the asymmetric Penning trap are derived as eigenstates of the appropriate annihilation operators. They are compared with those obtained through the displacement operator method.

  1. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  2. A SHiP to explore new routes

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  3. Gu??a de autoempleo en Logopedia

    Planells del Pozo, Elena Mar??a; Molina Cantero, Camila; Jacobe Mart??nez, Soledad; Jim??nez Rodr??guez, Jorge; Herrera Torres, Fuensanta

    2016-01-01

    Esta Gu??a de Autoempleo en Logopedia es un documento que pretende aportar informaci??n y generar motivaci??n al reci??n titulado en Logopedia, demostrando que dise??ar y crear un centro profesional propio es un camino posible y no supone tanta dificultad como se piensa. Este peque??o manual permitir?? recoger informaci??n dispersa referente al tema del autoempleo en Logopedia en un documento ??nico y asequible al titulado en Logopedia que se plantee y decida crear su propia empresa, apoya...

  4. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  5. $\\mu$-flux measurements for SHiP using NA61/SHINE

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  6. Calibrating the SHiP muon-flux using NA61/SHINE

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  7. SHI induced irradiation effect on Mo/Si interface

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  8. Vegetation survey of PEN Branch wetlands

    1991-01-01

    A survey was conducted of vegetation along Pen Branch Creek at Savannah River Site (SRS) in support of K-Reactor restart. Plants were identified to species by overstory, understory, shrub, and groundcover strata. Abundance was also characterized and richness and diversity calculated. Based on woody species basal area, the Pen Branch delta was the most impacted, followed by the sections between the reactor and the delta. Species richness for shrub and groundcover strata were also lowest in the delta. No endangered plant species were found. Three upland pine areas were also sampled. In support of K Reactor restart, this report summarizes a study of the wetland vegetation along Pen Branch. Reactor effluent enters Indian Grove Branch and then flows into Pen Branch and the Pen Branch Delta.

  9. Search for New Physics in SHiP and at future colliders

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  10. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  11. Interaction and conflict between Sufism and Shi`ism during Safavid era

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  12. Tema. Patrones alimentarios: guías nutricionales

    Ortiz-Moncada, Rocío

    2011-01-01

    El objetivo del la presentacion del tema es reconocer las bases de la alimentación saludable de acuerdo a los patrones alimentarios de España, y su relación con la dieta mediterránea. Se espera que al finalizar el tema, los estudiantes tengan la capacidad de analizar la evolución de las guías nutricionales en España desde su aparición teniendo en cuenta las características que debe de llevar una guía alimentaria. Plantear ventajas y limitaciones de las guías alimentarias, y proponer opciones...

  13. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  14. Propaganda mitu nägu / Kulle Raig

    Raig, Kulle, 1940-

    2016-01-01

    Arvustus: Lehtonen, Pekka. Tehtävä Tallinnassa : neuvostopropagandaa ja itsenäisyysinnostusta. Helsinki : Into, 2016 ; Lehtonen, Pekka. Ülesandega üle lahe : propaganda mitu nägu. Tallinn : K&K, 2016

  15. Negative Ion Sources: Magnetron and Penning

    Faircloth, D C

    2013-01-01

    The history of the magnetron and Penning electrode geometry is briefly outlined. Plasma generation by electrical discharge-driven electron impact ionization is described and the basic physics of plasma and electrodes relevant to magnetron and Penning discharges are explained. Negative ions and their applications are introduced, along with their production mechanisms. Caesium and surface production of negative ions are detailed. Technical details of how to build magnetron and Penning surface plasma sources are given, along with examples of specific sources from around the world. Failure modes are listed and lifetimes compared. (author)

  16. Negative Ion Sources: Magnetron and Penning

    Faircloth, D.C.

    2013-12-16

    The history of the magnetron and Penning electrode geometry is briefly outlined. Plasma generation by electrical discharge-driven electron impact ionization is described and the basic physics of plasma and electrodes relevant to magnetron and Penning discharges are explained. Negative ions and their applications are introduced, along with their production mechanisms. Caesium and surface production of negative ions are detailed. Technical details of how to build magnetron and Penning surface plasma sources are given, along with examples of specific sources from around the world. Failure modes are listed and lifetimes compared.

  17. Search for hidden particles with the SHiP experiment

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  18. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  19. The Penning fusion experiment-ions

    Schauer, M. M.; Umstadter, K. R.; Barnes, D. C.

    1999-01-01

    The Penning fusion experiment (PFX) studies the feasibility of using a Penning trap as a fusion confinement device. Such use would require spatial and/or temporal compression of the plasma to overcome the Brillouin density limit imposed by the nonneutrality of Penning trap plasmas. In an earlier experiment, we achieved enhanced plasma density at the center of a pure, electron plasma confined in a hyperbolic, Penning trap by inducing spherically convergent flow in a nonthermal plasma. The goal of this work is to induce similar flow in a positive ion plasma confined in the virtual cathode provided by a spherical, uniform density electron plasma. This approach promises the greatest flexibility in operating with multi-species plasmas (e.g. D + /T + ) or implementing temporal compression schemes such as the Periodically Oscillating Plasma Sphere of Nebel and Barnes. Here, we report on our work to produce and diagnose the necessary electron plasma

  20. Penning ionization processes studied by electron spectroscopy

    Yencha, A.J.

    1978-01-01

    The technique of measuring the kinetic energy of electrons ejected from atomic or molecular species as a result of collisional energy transfer between a metastable excited rare gas atom and an atom or molecule is known as Penning ionization spectroscopy. Like the analogous photoionization process of photoelectron spectroscopy, a considerable amount of information has been gained about the ionization potentials of numerous molecular systems. It is, in fact, through the combined analyses of photoelectron and Penning electron spectra that affords a probe of the particle-particle interactions that occur in the Penning process. In this paper a short survey of the phenomenon of Penning ionization, as studied by electron spectroscopy, will be presented as it pertains to the ionization processes of simple molecules by metastable excited atoms. (author)

  1. Coherent states approach to Penning trap

    Fernandez, David J; Velazquez, Mercedes

    2009-01-01

    By using a matrix technique, which allows us to identify directly the ladder operators, the Penning trap coherent states are derived as eigenstates of the appropriate annihilation operators. These states are compared with those obtained through the displacement operator. The associated wavefunctions and mean values for some relevant operators in these states are also evaluated. It turns out that the Penning trap coherent states minimize the Heisenberg uncertainty relation

  2. The secret of René Guénon: A critical review of Guénon's traditionalism

    Poznanović Željko

    2014-01-01

    Full Text Available This paper aims to present the basic principles of the doctrine of René Guénon (1886-1951, a French thinker of broad and comprehensive scope when it comes to Hinduism, Western Occult Tradition, Freemasonry, Taoism, symbolism and certain aspects of metaphysics. His teaching did not leave a mark in the mainstream of philosophy, yet it founded a whole syncretic movement known as Traditionalism or Perennialism. While Guénons doctrine is commonly either ignored or accepted as unquestionably true, a critical approach to it is very rare, especially criticism of the logical coherence of the system itself. Although Guénon was not a transparently systematic thinker, his own beliefs just like any other cannot be self-contradictory. A special attention is given to the contradiction of his doctrine with Islam despite the fact that Guénon was a declared Muslim. In this paper we have particularly shown socio-political implications of Guénons doctrine supporting our attitudes by both Guénons own statements and the statements of his supporters as well as critics ranging from moderate to the most severe ones. We hope we have shown that in his doctrine there is a hidden coherent system that leads to conclusions and objectives that are precisely determined regardless of apparent contradictions.

  3. Pen- Name in Persian and Arabic Poetry

    Ebrahim Khodayar

    2012-03-01

    Full Text Available  Abstract Pen-name (Takhalloss is one of the main features of Persian poetry. It has been a matter of concern among many of Persian language geography poets in the orient at least up to the Mashrouteh era. Pen-name has been promoted among the other Muslim nations throuph Persian poetry. Although it is not as famous in the Arab nations as in the Persian speaking nations, it is known as “Alqab-o-shoara” among the Arab nations and, through this way, it has affected the poetrical wealth of the Arabic poets.   The Present paper, using description-analystic approach, compares the pen-names of Persian and Arabic poets under the title of “pen-names” and investigates their features in both cultures. The main research question is: What are the similarities and differences of poetic-names, in Persian and Arabic poets in terms of the type of name, position and importance? The results showed that Pseudonym by its amazing expansion in Persian poetry has also influenced Arabic poetry. In addition to the factors affecting in the choice of pen-names (like pseudonym, pen-name, nickname..., sometimes such external factors as events, commends, community benefactors and climate, as well as internal factors including the poets’ inner beliefs are associated too. .

  4. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  5. Muon-flux measurements for SHiP at H4

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  6. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  7. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  8. SyGuS-Comp 2016: Results and Analysis

    Rajeev Alur

    2016-11-01

    Full Text Available Syntax-Guided Synthesis (SyGuS is the computational problem of finding an implementation f that meets both a semantic constraint given by a logical formula φ in a background theory T, and a syntactic constraint given by a grammar G, which specifies the allowed set of candidate implementations. Such a synthesis problem can be formally defined in SyGuS-IF, a language that is built on top of SMT-LIB. The Syntax-Guided Synthesis Competition (SyGuS-Comp is an effort to facilitate, bring together and accelerate research and development of efficient solvers for SyGuS by providing a platform for evaluating different synthesis techniques on a comprehensive set of benchmarks. In this year's competition we added a new track devoted to programming by examples. This track consisted of two categories, one using the theory of bit-vectors and one using the theory of strings. This paper presents and analyses the results of SyGuS-Comp'16.

  9. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  10. Neutrino scattering physics with the SHiP Experiment

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  11. The SHiP experiment at CERN SPS

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  12. Neutrino scattering physics with the SHiP Experiment

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  13. Neutrino physics with the SHiP experiment

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  14. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  15. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  16. Particle confinement in penning traps an introduction

    Vogel, Manuel

    2018-01-01

    This book provides an introduction to the field of Penning traps and related experimental techniques. It serves both as a primer for those entering the field, and as a quick reference for those working in it. The book is motivated by the observation that often a vast number of different resources have to be explored to gain a good overview of Penning trap principles. This is especially true for students who experience additional difficulty due to the different styles of presentation and notation. This volume provides a broad introductory overview in unified notation.

  17. Pen-and-Paper User Interfaces

    Steimle, Jurgen

    2012-01-01

    Even at the beginning of the 21st century, we are far from becoming paperless. Pen and paper is still the only truly ubiquitous information processing technology. Pen-and-paper user interfaces bridge the gap between paper and the digital world. Rather than replacing paper with electronic media, they seamlessly integrate both worlds in a hybrid user interface. Classical paper documents become interactive. This opens up a huge field of novel computer applications at our workplaces and in our homes. This book provides readers with a broad and extensive overview of the field, so as to provide a fu

  18. The secret of René Guénon: A critical review of Guénon's traditionalism

    Poznanović Željko

    2014-01-01

    This paper aims to present the basic principles of the doctrine of René Guénon (1886-1951), a French thinker of broad and comprehensive scope when it comes to Hinduism, Western Occult Tradition, Freemasonry, Taoism, symbolism and certain aspects of metaphysics. His teaching did not leave a mark in the mainstream of philosophy, yet it founded a whole syncretic movement known as Traditionalism or Perennialism. While Guénons doctrine is commonly either ignored or accepted as unquestionably true,...

  19. Kuidas tehti filmi "Arminägu" / Timo Diener

    Diener, Timo

    2003-01-01

    Mängufilm "Arminägu" ("Scarface") : stsenarist Oliver Stone : režissöör Brian De Palma : peaosas Al Pacino : produtsent Martin Bregman : Ameerika Ühendriigid 1983. Järgneb 20. ja 27. okt. 2003, lk. 38

  20. Bird checklist, Guánica Biosphere Reserve, Puerto Rico

    Wayne J. Arendt; John Faaborg; Miguel Canals; Jerry Bauer

    2015-01-01

    This research note compiles 43 years of research and monitoring data to produce the first comprehensive checklist of the dry forest avian community found within the Guánica Biosphere Reserve. We provide an overview of the reserve along with sighting locales, a list of 185 birds with their resident status and abundance, and a list of the available bird habitats....

  1. Electrospray deposition from fountain pen AFM probes

    Geerlings, J.; Sarajlic, Edin; Berenschot, Johan W.; Abelmann, Leon; Tas, Niels Roelof

    2012-01-01

    In this paper we present for the first time electrospraying from fountain pen probes. By using electrospray contactless deposition in an AFM setup becomes possible. Experiments on a dedicated setup were carried out as first step towards this goal. Spraying from 8 and 2 µm apertures was observed. For

  2. 9 CFR 89.5 - Feeding pens.

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feeding pens. 89.5 Section 89.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE INTERSTATE TRANSPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS STATEMENT OF POLICY UNDER THE...

  3. 9 CFR 313.1 - Livestock pens, driveways and ramps.

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Livestock pens, driveways and ramps... INSPECTION AND CERTIFICATION HUMANE SLAUGHTER OF LIVESTOCK § 313.1 Livestock pens, driveways and ramps. (a) Livestock pens, driveways and ramps shall be maintained in good repair. They shall be free from sharp or...

  4. From handwriting analysis to pen-computer applications

    Schomaker, L

    1998-01-01

    In this paper, pen computing, i.e. the use of computers and applications in which the pen is the main input device, will be described from four different viewpoints. Firstly a brief overview of the hardware developments in pen systems is given, leading to the conclusion that the technological

  5. An evaluation of prefilled insulin pens: a focus on the Next Generation FlexPen®

    Estella M Davis

    2010-08-01

    Full Text Available Estella M Davis, Emily L Sexson, Mikayla L Spangler, Pamela A ForalDepartment of Pharmacy Practice, Creighton University School of Pharmacy and Health Professions, Omaha, Nebraska, USAAbstract: Insulin pen delivery systems are preferred by patients over the traditional vial and syringe method for insulin delivery because they are simple and easy to use, improve confidence in dosing insulin, and have less interference with activities and improved discretion with use. Insulin manufacturers have made numerous improvements to their first marketed pen devices and are now introducing their next generation of devices. Design modifications to the newest generation of prefilled insulin pen devices are intended to improve the ease of use and safety and continue to positively impact adherence to insulin. This review focuses on the Next Generation FlexPen® with regard to design considerations to reduce injection force, improve accuracy and ease of use, and evaluate the preference of patient and health-care provider compared with other disposable, prefilled insulin pen devices.Keywords: diabetes, dose accuracy, injection force, patient preference, insulin pen device

  6. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  7. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  8. TianShuiShi space breeding current situation and developing trend

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  9. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  10. Pen of Health Care Worker as Vector of Infection

    Prashant Patil

    2010-10-01

    Full Text Available Nosocomial infections are the major concern in tertiary hospitals. Health care workers and their belonging are known to act as vector in transmission of infections. In present study, the writing pen of health care workers was worked out for carrying infection. The swab from writing pen of health care workers were cultured for any growth of microorganism and compared with swab from pen of the non health care workers. It was found that the rate of growth of microorganism were more in pen of health care workers. Similarly the organism attributed to the nosocomial infection was grown from the pens of health care workers. These organisms might be transmitted from the hands of health care workers. The writing pen which health care worker are using became the vectors of transmission of infection. So to prevent it, the most important way is to wash the hands and pen properly after examining the patients.

  11. Nonlinear PIC simulation in a Penning trap

    Lapenta, G.; Delzanno, G.L.; Finn, J. M.

    2002-01-01

    We study the nonlinear dynamics of a Penning trap plasma, including the effect of the finite length and end curvature of the plasma column. A new cylindrical PIC code, called KANDINSKY, has been implemented by using a new interpolation scheme. The principal idea is to calculate the volume of each cell from a particle volume, in the same manner as it is done for the cell charge. With this new method, the density is conserved along streamlines and artificial sources of compressibility are avoided. The code has been validated with a reference Eulerian fluid code. We compare the dynamics of three different models: a model with compression effects, the standard Euler model and a geophysical fluid dynamics model. The results of our investigation prove that Penning traps can really be used to simulate geophysical fluids

  12. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  13. GuMNet - Guadarrama Monitoring Network initiative (Madrid,Spain)

    Santolaria-Canales, Edmundo

    2017-04-01

    The Guadarrama Monitoring Network initiative (GuMNet) is an observational infrastructure focused on monitoring the state of the atmosphere, surface and subsurface in the Sierra de Guadarrama, 50 km NW of the city of Madrid. The network is composed of 10 automatic real time weather stations ranging from low altitude (ca. 900 m.a.s.l) to high mountain areas (ca. 2400 m.a.s.l). The GuMNet infrastructure consists in 10 real time automatic weather stations with instrumentation for observing the state of the atmosphere, surface and the subsurface at the Sierra de Guadarrama, just 50 km north-northwest of the city of Madrid. GuMNet lays the foundations of a research network on weather, soil thermodynamics, boundary layer physics, climate and ecosystem oriented impacts, air pollutions, etc. in the Sierra de Guadarrama. GuMNet represents a first step to provide a unique observational network in an environment of high protection to be used as a laboratory serving a wide range of scientific and educational interests. High altitude sites are focused on periglacial areas and lower altitude sites have emphasis on pastures. One of the low altitude sites is equipped with a 10 m high anemometric tower with a 3D sonic anemometer at the top jointly with a CO2/H2O analyzer that will allow sampling of wind profiles and H2O and CO2 eddy covariance fluxes, important for soil respiration and CO2 and water vapor exchange. A portable station has also a 3D sonic anemometer with CO2/H2O analyzer, this 4 meters-high portable tower is designed for comparison with other soil terrain fluxes. The network is connected via general packet radio service (GPRS) to the central lab in the Campus of Excellence of Moncloa and a management software has been developed to handle the operation of the infrastructure. The deployment of instrumentation and connection of sites to the network was finished in 2016. GuMNet is currently in the process of becoming operational. Conceptually, GuMNet intends to convert a

  14. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  15. Cytotoxicity of Pd nanostructures supported on PEN: Influence of sterilization on Pd/PEN interface

    Polívková, M., E-mail: polivkoa@vscht.cz [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Siegel, J. [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Rimpelová, S. [Department of Biochemistry and Microbiology, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Hubáček, T. [Institute of Hydrobiology, Biology Centre of the AS CR, 370 05 Ceske Budejovice (Czech Republic); Kolská, Z. [Materials Centre of Usti n. L., J.E. Purkyne University, 400 96 Usti nad Labem (Czech Republic); Švorčík, V. [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic)

    2017-01-01

    Non-conventional antimicrobial agents, such as palladium nanostructures, have been increasingly used in the medicinal technology. However, experiences uncovering their harmful and damaging effects to human health have begun to appear. In this study, we have focused on in vitro cytotoxicity assessment of Pd nanostructures supported on a biocompatible polymer. Pd nanolayers of variable thicknesses (ranging from 1.1 to 22.4 nm) were sputtered on polyethylene naphthalate (PEN). These nanolayers were transformed by low-temperature post-deposition annealing into discrete nanoislands. Samples were characterized by AFM, XPS, ICP-MS and electrokinetic analysis before and after annealing. Sterilization of samples prior to cytotoxicity testing was done by UV irradiation, autoclave and/or ethanol. Among the listed sterilization techniques, we have chosen the gentlest one which had minimal impact on sample morphology, Pd dissolution and overall Pd/PEN interface quality. Cytotoxic response of Pd nanostructures was determined by WST-1 cell viability assay in vitro using three model cell lines: mouse macrophages (RAW 264.7) and two types of mouse embryonic fibroblasts (L929 and NIH 3T3). Finally, cell morphology in response to Pd/PEN was evaluated by means of fluorescence microscopy. - Highlights: • Annealing of Pd nanolayers on PEN resulted to Pd aggregation and formation of discrete nanoislands. • UV treatment was found as the gentlest sterilization method in term of physicochemical properties of Pd/PEN interface. • Autoclaving and chemical sterilization by ethanol resulted into remarkable changes of Pd/PEN interface. • Cytotoxicity of Pd samples was insignificant. • Pd nanostructures are potentially applicable as health-unobjectionable antibacterial coatings of medical devices.

  16. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  17. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  18. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  19. Design of a detector to study associated charm production in the SHiP beam dump facility

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  20. Development and Evaluation of an Interactive Pen

    Froilan G. Destreza

    2015-11-01

    Full Text Available Technologies have reached the classroom. It is one of the means of teaching strategies nowadays. Multimedia projectors have become one of the teaching tools the teacher cannot bear without it. The concept of making this tool to be interactive and easier to use was far conceived by the researcher. The researcher’s objective was to develop such tool and evaluate it according to its portability, simplicity, robustness, user-friendliness, effectiveness and efficiency. The respondents of the project were both the students and teachers of Batangas State University ARASOF-Nasugbu. The researcher has developed different prototypes for the interactive pen and tested in different environment and demonstrated the “know-how” of the project. The project was built using a simple infrared light emitting diode (IR LED, infrared tracker, and software which computes, detects and interact with the application program. Evaluation of the project followed the demonstration. The project got a high acceptance according to its portability, simplicity, robustness, user-friendliness, effectiveness and efficiency. The researcher is recommending the full implementation of the project in the Batangas State University ARASOF- Nasugbu and for better enhancement of the project by eliminating the pen.

  1. Angioedema hereditario: Guía de tratamiento

    Alejandro Malbrán

    2012-04-01

    Full Text Available El angioedema hereditario (HAE es una enfermedad rara, autosómica dominante, caracterizada por episodios que comprometen la piel, el tracto gastrointestinal y la laringe. Tiene una mortalidad histórica por asfixia del 15 al 50%. Es producida por la deficiencia funcional del C1 inhibidor. La identificación de la bradiquinina como mediador principal ha estimulado el desarrollo de nuevos medicamentos para tratar la enfermedad. El tratamiento del HAE se establece en consensos internacionales. El desarrollo de guías para el tratamiento de la enfermedad permite ordenar el uso de procedimientos diagnósticos y drogas. Describimos aquí algunas características farmacológicas de los medicamentos utilizados en el tratamiento del HAE en la Argentina: el concentrado plasmático de C1 inhibidor, el antagonista de la bradiquinina, icatibant, el andrógeno atenuado danazol y los agentes anti-fibrinolíticos ácidos épsilon aminocaproico (EACA y tranexámico. Asimismo, se describe su forma de uso y del control de los eventos adversos más frecuentes, así como las recomendaciones del último consenso internacional, aplicables para conformar una primera guía de tratamiento del HAE en la Argentina.

  2. The LEBIT 9.4 T Penning trap system

    Ringle, R.; Bollen, G.; Schury, P.; Sun, T. [National Superconducting Cyclotron Laboratory, East Lansing, MI (United States); Michigan State University, Department of Physics and Astronomy, East Lansing, MI (United States); Lawton, D.; Schwarz, S. [National Superconducting Cyclotron Laboratory, East Lansing, MI (United States)

    2005-09-01

    The initial experimental program with the Low-Energy Beam and Ion Trap Facility, or LEBIT, will concentrate on Penning trap mass measurements of rare isotopes, delivered by the Coupled Cyclotron Facility (CCF) of the NSCL. The LEBIT Penning trap system has been optimized for high-accuracy mass measurements of very short-lived isotopes. (orig.)

  3. The LEBIT 9.4 T Penning trap system

    Ringle, R.; Bollen, G.; Schury, P.; Sun, T.; Lawton, D.; Schwarz, S.

    2005-01-01

    The initial experimental program with the Low-Energy Beam and Ion Trap Facility, or LEBIT, will concentrate on Penning trap mass measurements of rare isotopes, delivered by the Coupled Cyclotron Facility (CCF) of the NSCL. The LEBIT Penning trap system has been optimized for high-accuracy mass measurements of very short-lived isotopes. (orig.)

  4. ν{sub τ}-physics with the SHiP experiment

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  5. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  6. Early warning of diarrhea and pen fouling in growing pigs using sensor-based monitoring

    Jensen, D. B.; Toft, Nils; Kristensen, A. R.

    2016-01-01

    then identify specific pens in need of extra attention. Here we evaluate the value of monitoring live weight, feed usage, humidity, drinking behavior and pen temperature in relation to early warnings of diarrhea and pen fouling in slaughter pigs. Materials and methods: We used data collected in 16 pens (8...... double-pens) between November 2013 and December 2014 at a commercial Danish farm. During this time, three new batches were inserted. We monitored the mean live weight of the pigs per pen (weekly, only in 4 pens), feed usage per double-pen (daily), humidity per section (daily), temperature at two...... positions per pen (hourly), water flow per double-pen (liters/hour/pig) and drinking frequency per pen (activations/hour/pig). Staff registrations of diarrhea and pen fouling were the events of interest. The data were divided into a learning set (15 events) and a test set (18 events). The data were modeled...

  7. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  8. Study of nu-tau properties with the SHiP experiment

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  9. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  10. Penning trap mass measurements on nobelium isotopes

    Dworschak, M.; Block, M.; Ackermann, D.; Herfurth, F.; Hessberger, F. P.; Hofmann, S.; Vorobyev, G. K.; Audi, G.; Blaum, K.; Droese, C.; Marx, G.; Schweikhard, L.; Eliseev, S.; Ketter, J.; Fleckenstein, T.; Haettner, E.; Plass, W. R.; Scheidenberger, C.; Ketelaer, J.; Kluge, H.-J.

    2010-01-01

    The Penning trap mass spectrometer SHIPTRAP at GSI Darmstadt allows accurate mass measurements of radionuclides, produced in fusion-evaporation reactions and separated by the velocity filter SHIP from the primary beam. Recently, the masses of the three nobelium isotopes 252-254 No were determined. These are the first direct mass measurements of transuranium elements, which provide new anchor points in this region. The heavy nuclides were produced in cold-fusion reactions by irradiating a PbS target with a 48 Ca beam, resulting in production rates of the nuclei of interest of about one atom per second. In combination with data from decay spectroscopy our results are used to perform a new atomic-mass evaluation in this region.

  11. NovoPen Echo® insulin delivery device

    Hyllested-Winge J

    2016-01-01

    Full Text Available Jacob Hyllested-Winge,1 Thomas Sparre,2 Line Kynemund Pedersen2 1Novo Nordisk Pharma Ltd, Tokyo, Japan; 2Novo Nordisk A/S, Søborg, Denmark Abstract: The introduction of insulin pen devices has provided easier, well-tolerated, and more convenient treatment regimens for patients with diabetes mellitus. When compared with vial and syringe regimens, insulin pens offer a greater clinical efficacy, improved quality of life, and increased dosing accuracy, particularly at low doses. The portable and discreet nature of pen devices reduces the burden on the patient, facilitates adherence, and subsequently contributes to the improvement in glycemic control. NovoPen Echo® is one of the latest members of the NovoPen® family that has been specifically designed for the pediatric population and is the first to combine half-unit increment (=0.5 U of insulin dosing with a simple memory function. The half-unit increment dosing amendments and accurate injection of 0.5 U of insulin are particularly beneficial for children (and insulin-sensitive adults/elders, who often require small insulin doses. The memory function can be used to record the time and amount of the last dose, reducing the fear of double dosing or missing a dose. The memory function also provides parents with extra confidence and security that their child is taking insulin at the correct doses and times. NovoPen Echo is a lightweight, durable insulin delivery pen; it is available in two different colors, which may help to distinguish between different types of insulin, providing more confidence for both users and caregivers. Studies have demonstrated a high level of patient satisfaction, with 80% of users preferring NovoPen Echo to other pediatric insulin pens. Keywords: NovoPen Echo®, memory function, half-unit increment dosing, adherence, children, adolescents 

  12. Pen Branch fault: Confirmatory drilling results

    Stieve, A.; Coruh, C.; Costain, J.K.

    1994-01-01

    The Confirmatory Drilling Project is the final investigation under the Pen Branch Fault Program initiated to determine the capability of the Pen Branch fault (PBF) to release seismic energy. This investigation focused on a small zone over the fault where previously collected seismic reflection data had indicated the fault deforms the subsurface at 150 msec (with reference to an 80 m reference datum). Eighteen drill holes, 2 to basement and the others to 300 ft, were arranged in a scatter pattern over the fault. To adequately define configuration of the layers deformed by the fault boreholes were spaced over a zone of 800 ft, north to south. The closely spaced data were to confirm or refute the existence of flat lying reflectors observed in seismic reflection data and to enable the authors to identify and correlate lithologic layers with seismic reflection data. Results suggest that deformation by the fault in sediments 300 ft deep ad shallower is subtle. Corroboration of the geologic interpretation with the seismic reflection profile is ongoing but preliminary results indicate that specific reflectors can be assigned to lithologic layers. A large amplitude package of reflections below a flat lying continuous reflection at 40 msec can be correlated with a lithology that corresponds to carbonate sediments in geologic cross-section. Further, data also show that a geologic layer as shallow as 30 ft can be traced on these seismic data over the same subsurface distance where geologic cross-section shows corresponding continuity. The subsurface structure is thus corroborated by both methods at this study site

  13. Guía de uso de la base de datos Emerald

    Biblioteca de la Universidad de Málaga

    2014-01-01

    Guía de uso de la base de datos Emerald. Recoge publicaciones de diferentes áreas temáticas: Economía, Ciencias Sociales, Ingeniería, Biblioteconomía, etc. Guía de uso de la base de datos Emerald en PDF.

  14. Surgical Complications of Bacille Calmette-Guérin (BCG) Infection in ...

    Surgical Complications of Bacille Calmette-Guérin (BCG) Infection in HIV infected children. J Karpelowsky, A Alexander, SD Peek, A Millar, H Rode. Abstract. Aim. Bacille Calmette-Guérin (BCG) immunisation is well established as part of the South African national expanded programme for immunisation (EPI). The World ...

  15. Guía de gestores de proyectos, setiembre 2012

    Morante Milla, Antoni

    2012-01-01

    Què és un projecte?, La gestió de projectes, aspectes clau en la definició i gestió d'un projecte, planificació d'un projecte eines informàtiques per a la planificació i gestió de projectes i guia d'ús del programari de gestió de projectes ClockingIT. ¿Qué es un proyecto?, la gestión de proyectos, aspectos clave en la definición y gestión de un proyecto, planificación de un proyecto herramientas informáticas para la planificación y gestión de proyectos y guía de uso del software de gestión...

  16. AHP 44: Interview: FILMMAKER: GU RU 'PHRINS LAS1

    AHP

    2017-02-01

    Full Text Available Please introduce yourself. I am Gu ru 'phrin las, born in 1993 in Smin thang Township, Gjig sgril County, Mgo log (Guoluo Tibetan Autonomous Prefecture, Mtsho sngon (Qinghai Province, PR China. My family members are herders. My paternal grandmother (Ngang rus, 1923-2008 raised me. My family had neither a radio nor television, so Grandmother's folktales and stories about her childhood were the main form of entertainment for me. When I was six years old, Father began to teach me basic Tibetan and mathematics. I started school when I was eight years old. I later studied at Mgo log High School in Rta bo (Dawu, at Northwest Nationalities University in Lan gru (Lanzhou, and in Zhi an (Xi'an. My dream is to become a film director. ...

  17. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  18. Influence of lucite phantoms on calibration of dosimetric pens

    Oliveira, E.C.; Xavier, M.; Caldas, L.E.V.

    1992-01-01

    Dosimetrical pens were studied for the answer repetition and were tested in gamma radiation fields ( 60 Co and 137 Cs) in air and in front of a lucite phantom, obtaining a backscattering contribution. The medium backscattering factors were 1,053 and 1,108 for respectively 60 Co and 137 Cs. The pens were placed behind the phantom for verifying the radiation attenuation. (C.G.C.)

  19. SHiP: a new facility to search for heavy neutrinos and study $\

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  20. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  1. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  2. Hepatitis in Disseminated Bacillus Calmette-Guérin Infection

    Markus U Göttke

    2000-01-01

    Full Text Available Local immunotherapy with an attenuated live strain of Mycobacterium bovis, bacillus Calmette-Guérin (BCG, is an effective and frequently used treatment for in situ transitional cell carcinoma (TCC of the bladder. Success rates are high, and serious side effects are infrequent but can affect every organ system. A 79-year-old patient with recently diagnosed TCC who was treated with intravesical BCG for a recurrence after initial surgical treatment is reported. After unsuccessful attempts at bladder catheterization with the creation of a false passage for his third treatment, BCG was instilled via a suprapubic catheter the same day and again a week later. Two weeks after the third BCG instillation, the patient presented with profound lethargy and weakness to the point of not being able to get up out of a chair. He was febrile, anorexic, icteric and had hepatosplenomegaly. Disseminated BCG infection was suspected on the basis of history, clinical examination and a liver biopsy that showed noncaseating granulomatous hepatitis. Empirical treatment was started with antituberculous combination therapy. A short course of an oral corticosteroid was given. Clinical improvement was marked and sustained so that the patient could be discharged home for the full six-month course of his treatment. Disseminated BCG infection with granulomatous hepatitis can be severe and life-threatening in cases where a large intravascular inoculum of BCG may have been given inadvertently.

  3. Bacillus Calmette-Guérin vaccination at birth

    Kjærgaard, Jesper; Stensballe, Lone Graff; Birk, Nina Marie

    2016-01-01

    BACKGROUND: Bacillus Calmette-Guérin vaccine (BCG) induces a complex, pro-inflammatory immune response. Obesity is associated with low-grade inflammation. AIMS: The purpose of the study was to test whether BCG at birth has effects on infant growth and body composition. STUDY DESIGN, SUBJECTS......, AND OUTCOME MEASURES: The Danish Calmette Study is a randomized, clinical trial. The study was conducted at three university hospitals and randomized 4262 children of gestational age ≥32weeks to receive BCG within seven days of birth or to a no-intervention control group. Follow-up consisted of clinical......-up was 94% complete at 3 and 13months after birth. The children were bigger than the WHO reference population. There was no effect of BCG on weight z-score at 13months (-0.028 [95% confidence interval: -0.085 to 0.029], p=0.34). There was no effect on weight and length at 3months, or length, mid...

  4. Late GI and GU complications in the treatment of prostate cancer

    Schultheiss, Timothy E.; Lee, W. Robert; Hunt, Margie A.; Hanlon, Alexandra L.; Peter, Ruth S.; Hanks, Gerald E.

    1997-01-01

    Purpose: To assess the factors that predict late GI and GU morbidity in radiation treatment of the prostate. Methods and Materials: Seven hundred twelve consecutive prostate cancer patients treated at this institution between 1986 and 1994 (inclusive) with conformal or conventional techniques were included in the analysis. Patients had at least 3 months follow-up and received at least 65 Gy. Late GI Grade 3 morbidity was rectal bleeding (requiring three or more procedure) or proctitis. Late Grade 3 GU morbidity was cystitis or structure. Multivariate analysis (MVA) was used to assess factors related to the complication-free survival. The factors assessed were age, occurrence of side effects ≥ Grade 2 during treatment, irradiated volume parameters (use of pelvic fields, treatment of seminal vesicles to full dose or 57 Gy, and use of additional rectal shielding), dose, comorbidities, and other treatments (hormonal manipulation, TURP). Results: Acute GI and GU side effects (Grade 2 or higher ) were noted in 246 and 201 patients, respectively; 67 of these patients exhibited both. GI side effects were not correlated with GU side effects acutely. Late and acute morbidities were correlated (both GI and GU). Fifteen of the 712 patients expressed Grade 3 or 4 GI injuries 3 to 32 months after the end of treatment, with a mean of 14.3 months. One hundred fifteen patients expressed Grade 2 or higher GI morbidity (mean: 13.7 months). The 43 Grade 2 or higher GU morbidities occurred significantly later (mean: 22.7 months). Central axis dose was the only independent variable significantly related to the incidence of late GI morbidity on MVA. No treatment volume parameters were significant for Grade 3. The following parameters were significantly related (by MVA) to Grade 2 GI morbidity: central axis dose, use of the increased rectal shielding, androgen deprivation therapy starting before RT. Acute and late GI morbidities were highly correlated. History of diabetes, treatment of

  5. "Gerontiuse unenägu" Estonias / Igor Garšnek

    Garšnek, Igor, 1958-

    2010-01-01

    2. aprillil Estonia kontserdisaalis toimunud Edward Elgari oratooriumi "Gerontiuse unenägu" ettekandest, esitasid: ERSO, Estonia ooperikoor, Estonia poistekoor, kammerkoor Voces Musicales, Helen Lokuta, Bernhard Gärtner, Priit Volmer, dirigent Carlos Spiereri

  6. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  7. SHiP: a new multipurpose beam-dump experiment at the SPS.

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  8. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  9. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  10. Bartonellosis en Colombia, bartonellosis de guáitara ó fiebre verrucosa del guáitara

    Luis Patiño Camargo

    1939-04-01

    Full Text Available Desde principios de 1936 las autoridades de Nariño venían seriamente preocupadas por una mortífera enfermedad epidémica aparecida al Norte en vertientes de juanambu y del rio Mayo, enfermedad que de improviso se presentó en el Guáitara con gran virulencia. El médico doctor Max Llorente, Gobernador entonces del Departamento, inspeccionó con el Director de Higiene la zona invadida, y a su regreso a Pasto conferencio con el Colegio Médico. En la reunión se acogió el diagnostico de paludismo agudo pernicioso. Como resultado se organizó una comisión de tratamiento encabezada por un médico, y se situó en Ancuya. Por esos días el Departamento Nacional de Higiene envió un ingeniero sanitario, quien recorrió las comarcas atacadas y rindió un informe.

  11. The LongPen--the world's first original remote signing device.

    Kruger, Diane M

    2010-05-01

    The LongPen is a remote-controlled pen and videoconferencing device conceived by Canadian author Margaret Atwood in 2004 and initially intended to bring "live" author signings to far away locations. The LongPen allows for individually inscribed long distance signatures and writing while maintaining an original record, written with pen and ink. LongPen specimens were compared with control specimens using different speeds, pen pressures, and types of pens. Preliminary indications are that LongPen inscriptions can be identified or associated with their author. Size and form are maintained and artifacts are subtle. Some limitations with respect to the capture of long tapered strokes, delicate connecting strokes, and differences in line width were noted. Factors which may impact forensic handwriting examinations include limited amounts of writing, light pen pressure, date of the writing, type of writing instrument, dimensions of the writing, and failure to consider that the device has been used.

  12. Reiter's syndrome postintravesical Bacillus Calmette–Guérin instillations

    Keng Lim Ng

    2017-03-01

    Full Text Available Intravesical Bacillus Calmette–Guérin (BCG has been a proven and effective immunotherapy treatment for superficial transitional cell carcinoma (TCC of the bladder, especially for high-grade tumors and carcinoma in situ. Nevertheless, significant side effects are associated with BCG instillations, including fever, myalgia, malaise, dysuria, hematuria, and irritable lower urinary tract symptoms. We herein report the case of a patient who developed Reiter's syndrome following intravesical BCG instillations. A 39-year-old Chinese man presented with a 3-week history of dysuria, suprapubic pain, and pain at the tip of the penis postmicturition. Initial investigations revealed that he had microhematuria, and an ultrasound with computed tomography scan of the abdomen showed a bladder mass. Transurethral resection of the bladder tumor was performed and the patient received a single dose of intravesical mitomycin postoperatively. Results of histopathological examination revealed high-grade bladder TCC (G3pT1, and the patient was managed with intravesical BCG for 2 weeks following the surgery. Four weekly cycles of BCG were administered uneventfully; however, before the fifth instillation, the patient complained of urethral discharge, bilateral conjunctivitis, and low back pain. Reiter's syndrome was diagnosed as a rare but known complication of BCG instillation and the BCG immunotherapy was withheld. The patient was treated with nonsteroidal antiinflammatory drugs (for back pain and eye ointment (for conjunctivitis and his condition improved. This case report of Reiter's syndrome should be highlighted as a rare but significant complication of BCG immunotherapy and urologists should have a high index of suspicion to diagnose this rare complication.

  13. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  14. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  15. Ballpoint pen ingestion in a 2-year-old child.

    Rameau, Anaïs; Anand, Sumeet M; Nguyen, Lily H

    2011-07-01

    A 2-year-old girl ingested a ballpoint pen, which was found on chest x-ray to have lodged in the lower esophagus and stomach. The pen, which measured nearly 15 cm in length, was removed via rigid esophagoscopy without complication. To the best of our knowledge, this is the longest nonflexible foreign body ingested by a young child ever reported in the English-language literature. We describe the presentation of this case and the current guidelines for safety as enumerated in the Small Parts Regulations established by the U.S. Consumer Product Safety Commission.

  16. Space-charge effects in Penning ion traps

    Porobić, T.; Beck, M.; Breitenfeldt, M.; Couratin, C.; Finlay, P.; Knecht, A.; Fabian, X.; Friedag, P.; Fléchard, X.; Liénard, E.; Ban, G.; Zákoucký, D.; Soti, G.; Van Gorp, S.; Weinheimer, Ch.; Wursten, E.; Severijns, N.

    2015-06-01

    The influence of space-charge on ion cyclotron resonances and magnetron eigenfrequency in a gas-filled Penning ion trap has been investigated. Off-line measurements with K39+ using the cooling trap of the WITCH retardation spectrometer-based setup at ISOLDE/CERN were performed. Experimental ion cyclotron resonances were compared with ab initio Coulomb simulations and found to be in agreement. As an important systematic effect of the WITCH experiment, the magnetron eigenfrequency of the ion cloud was studied under increasing space-charge conditions. Finally, the helium buffer gas pressure in the Penning trap was determined by comparing experimental cooling rates with simulations.

  17. Penning transfer in argon-based gas mixtures

    Sahin, O; Tapan, I; Ozmutlu, E N

    2010-01-01

    Penning transfers, a group of processes by which excitation energy is used to ionise the gas, increase the gas gain in some detectors. Both the probability that such transfers occur and the mechanism by which the transfer takes place, vary with the gas composition and pressure. With a view to developing a microscopic electron transport model that takes Penning transfers into account, we use this dependence to identify the transfer mechanisms at play. We do this for a number of argon-based gas mixtures, using gain curves from the literature.

  18. (Anti)hydrogen recombination studies in a nested Penning trap

    Quint, W.; Kaiser, R.; Hall, D.; Gabrielse, G.

    1993-01-01

    Extremely cold antiprotons, stored in Penning trap at 4 K, open the way toward the production and study of cold antihydrogen. We have begun experimentally investigating the possibility to recombine cold positrons and antiprotons within nested Penning traps. Trap potentials are adjusted to allow cold trapped protons (and positive helium ions) to pass through cold trapped electrons. Electrons, protons and ions are counted by ejecting them to a cold channel plate and by nondestructive radiofrequency techniques. The effect of the space charge of one trapped species upon another trapped species passing through is clearly observed. (orig.)

  19. III. Penning ionization, associative ionization and chemi-ionization processes

    Cermak, V.

    1975-01-01

    Physical mechanisms of three important ionization processes in a cold plasma and the methods of their experimental study are discussed. An apparatus for the investigation of the Penning ionization using ionization processes of long lived metastable rare gas atoms is described. Methods of determining interaction energies and ionization rates from the measured energy spectra of the originating electrons are described and illustrated by several examples. Typical associative ionization processes are listed and the ionization rates are compared with those of the Penning ionization. Interactions with short-lived excited particles and the transfer of excitation without ionization are discussed. (J.U.)

  20. Dynamic-compliance and viscosity of PET and PEN

    Weick, Brian L.

    2016-01-01

    Complex dynamic-compliance and in-phase dynamic-viscosity data are presented and analyzed for PET and PEN advanced polyester substrates used for magnetic tapes. Frequency-temperature superposition is used to predict long-term behavior. Temperature and frequency ranges for the primary glass transition and secondary transitions are discussed and compared for PET and PEN. Shift factors from frequency-temperature superposition are used to determine activation energies for the transitions, and WLF parameters are determined for the polyester substrates.

  1. Dynamic-compliance and viscosity of PET and PEN

    Weick, Brian L. [School of Engineering and Computer Science, University of the Pacific, Stockton, California, 95211 (United States)

    2016-05-18

    Complex dynamic-compliance and in-phase dynamic-viscosity data are presented and analyzed for PET and PEN advanced polyester substrates used for magnetic tapes. Frequency-temperature superposition is used to predict long-term behavior. Temperature and frequency ranges for the primary glass transition and secondary transitions are discussed and compared for PET and PEN. Shift factors from frequency-temperature superposition are used to determine activation energies for the transitions, and WLF parameters are determined for the polyester substrates.

  2. Dynamic-compliance and viscosity of PET and PEN

    Weick, Brian L.

    2016-05-01

    Complex dynamic-compliance and in-phase dynamic-viscosity data are presented and analyzed for PET and PEN advanced polyester substrates used for magnetic tapes. Frequency-temperature superposition is used to predict long-term behavior. Temperature and frequency ranges for the primary glass transition and secondary transitions are discussed and compared for PET and PEN. Shift factors from frequency-temperature superposition are used to determine activation energies for the transitions, and WLF parameters are determined for the polyester substrates.

  3. First reliability test of a surface micromachined microengine using SHiMMeR

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  4. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  5. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  6. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  7. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  8. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  9. Humalog(®) KwikPen™: an insulin-injecting pen designed for ease of use.

    Schwartz, Sherwyn L; Ignaut, Debra A; Bodie, Jennifer N

    2010-11-01

    Insulin pens offer significant benefits over vial and syringe injections for patients with diabetes who require insulin therapy. Insulin pens are more discreet, easier for patients to hold and inject, and provide better dosing accuracy than vial and syringe injections. The Humalog(®) KwikPen™ (prefilled insulin lispro [Humalog] pen, Eli Lilly and Company, Indianapolis, IN, USA) is a prefilled insulin pen highly rated by patients for ease of use in injections, and has been preferred by patients to both a comparable insulin pen and to vial and syringe injections in comparator studies. Together with an engineering study demonstrating smoother injections and reduced dosing error versus a comparator pen, recent evidence demonstrates the Humalog KwikPen device is an accurate, easy-to-use, patient-preferred insulin pen.

  10. Johannes Vermeer and Tom Gouws: textual discourse through pen ...

    Poems such as 'ars poetica' and 'die kantklosser' will be read as speaking paintings of visual texts and visual writing through which an exceptional merger of pen and brush come into being. Keywords: iconicity, tipography, cohesion, visual text, ars poetica, syntactic chiasm, texture, canto. Journal for Language Teaching Vol ...

  11. Novel dip-pen nanolithography strategies for nanopatterning

    Wu, C.C.

    2010-01-01

    Dip-pen nanolithography (DPN) is an atomic force microscopy (AFM)-based lithography technique offering the possibility of fabricating patterns with feature sizes ranging from micrometers to tens of nanometers, utilizing either top-down or bottom-up strategies. Although during its early development

  12. Aspiration of a perforated pen cap: complete tracheal obstruction ...

    Foreign body aspiration is a common but underestimated event in children with potentially fatal outcome. Because of unreliable histories and inconsistent clinical and radiologic findings, diagnosis and treatment can represent a challenge. Inhaled pen caps predispose for complete airway obstruction and are difficult to ...

  13. Penning ionization cross sections of excited rare gas atoms

    Ukai, Masatoshi; Hatano, Yoshihiko.

    1988-01-01

    Electronic energy transfer processes involving excited rare gas atoms play one of the most important roles in ionized gas phenomena. Penning ionization is one of the well known electronic energy transfer processes and has been studied extensively both experimentally and theoretically. The present paper reports the deexcitation (Penning ionization) cross sections of metastable state helium He(2 3 S) and radiative He(2 1 P) atoms in collision with atoms and molecules, which have recently been obtained by the authors' group by using a pulse radiolysis method. Investigation is made of the selected deexcitation cross sections of He(2 3 S) by atoms and molecules in the thermal collisional energy region. Results indicate that the cross sections are strongly dependent on the target molecule. The deexcitation probability of He(2 3 S) per collision increases with the excess electronic energy of He(2 3 S) above the ionization potential of the target atom or molecule. Another investigation, made on the deexcitation of He(2 1 P), suggests that the deexcitation cross section for He(2 1 P) by Ar is determined mainly by the Penning ionization cross section due to a dipole-dipole interaction. Penning ionization due to the dipole-dipole interaction is also important for deexcitation of He(2 1 P) by the target molecules examined. (N.K.)

  14. Aspiration of a perforated pen cap: complete tracheal obstruction ...

    Keywords: children, flexible bronchoscopy, Fogarty catheter, foreign body aspiration, pen cap, rigid ... plastic foreign body with central perforation occluding the trachea in supracarinal ... venous steroids and was discharged home on postoperative day 1 without ... history may not be as reliable, if not witnessed by an adult.

  15. Pen Culture of the Black-Chinned Tilapia, Sarotherodon ...

    Pen-fish-culture as a culture-based fisheries approach was investigated in the Aglor Lagoon from December 2003 to June, 2004. The fish used in the study was the Black-chinned tilapia Sarotherodon melanotheron. The growth performance of S. melanotheron cultured for six months in the Aglor Lagoon under three ...

  16. Pen-based Interfaces for Engineering and Education

    Stahovich, Thomas F.

    Sketches are an important problem-solving tool in many fields. This is particularly true of engineering design, where sketches facilitate creativity by providing an efficient medium for expressing ideas. However, despite the importance of sketches in engineering practice, current engineering software still relies on traditional mouse and keyboard interfaces, with little or no capabilities to handle free-form sketch input. With recent advances in machine-interpretation techniques, it is now becoming possible to create practical interpretation-based interfaces for such software. In this chapter, we report on our efforts to create interpretation techniques to enable pen-based engineering applications. We describe work on two fundamental sketch understanding problems. The first is sketch parsing, the task of clustering pen strokes or geometric primitives into individual symbols. The second is symbol recognition, the task of classifying symbols once they have been located by a parser. We have used the techniques that we have developed to construct several pen-based engineering analysis tools. These are used here as examples to illustrate our methods. We have also begun to use our techniques to create pen-based tutoring systems that scaffold students in solving problems in the same way they would ordinarily solve them with paper and pencil. The chapter concludes with a brief discussion of these systems.

  17. Review: Factors affecting fouling in conventional pens for slaughter pigs

    Larsen, Mona Lilian Vestbjerg; Bertelsen, Maja; Pedersen, Lene Juul

    2018-01-01

    and pigs’ earlier experience. Further, these primary factors are affected by secondary factors such as the shape of the pen, the weight of the pigs and especially the heat balance of the pigs, which is affected by several tertiary factors including, for example, temperature, humidity and draught. Results...

  18. Le Pen õigustas natside tegevust Prantsusmaal / Margo Pajuste

    Pajuste, Margo

    2005-01-01

    Prantsuse paremäärmusliku partei juht Jean-Marie Le Pen väitis, et Saksa okupatsioon II maailmasõja ajal Prantsusmaal ei olnud eriti ebainimlik ja et kui väited massimõrvade kohta Prantsusmaal vastaksid tõele, poleks olnud vaja luua koonduslaagreid poliitvangidele. Reageeringutest Le Peni väidete kohta Prantsusmaal

  19. Le commerce des sels de Guérande (xviie-xviiie siècles)

    Buron, Gildas

    2015-01-01

    Depuis les travaux de Michel Mollat, Henri Touchard, Jean Tanguy et Jean Meyer touchant au sel et aux marais salants du pays de Guérande, l’historien en est resté à l’idée que la production salicole guérandaise n’avait connu, aux Temps modernes, de débouchés que régionaux, vers la Bretagne intérieure par le biais de la troque effectuée par les gens du marais. L’enquête en cours montre que les sels de Guérande, certes peu présents dans le grand commerce international du sel de la Baie du xive ...

  20. Auxiliares de movilidad en la discapacidad visual. Terapia asistida por perros: perros guía

    García López, Verónica

    2017-01-01

    El desplazamiento y movilidad en personas con baja visión o ceguera no sería tan eficiente sin el uso de determinadas ayudas como pueden ser los auxiliares de desplazamiento, como el guía vidente, el bastón blanco y el perro guía. De todos ellos se hará una descripción general de los guías videntes, un análisis del bastón blanco sobre sus características, técnicas de uso y nuevas tecnologías aplicadas a este; también se comentará brevemente el uso del perro como perro de asistencia y una revi...

  1. Of Papers and Pens: Polysemes and Homophones in Lexical (Mis)Selection

    Li, Leon; Slevc, L. Robert

    2017-01-01

    Every word signifies multiple senses. Many studies using comprehension-based measures suggest that polysemes' senses (e.g., "paper" as in "printer paper" or "term paper") share lexical representations, whereas homophones' meanings (e.g., "pen" as in "ballpoint pen" or "pig pen")…

  2. Guía de materiales reciclados en la construcción “+live”

    Herrera Martín, José Adolfo

    2013-01-01

    El objeto de este trabajo es la presentación de guía para la utilización y difusión de materiales procedentes de labores de reciclado y su aplicación en procesos constructivos. La guía persigue los siguientes aspectos: - El conocimiento de materiales procedentes del reciclado, que tienen un uso eficaz en procesos constructivos, en una base de datos. - La generación de una base de datos actualizada que permita la fácil incorporación de nuevos productos y técnicas constructiva...

  3. Guía de uso de la base de datos Dialnet

    Biblioteca de la Universidad de Málaga

    2015-01-01

    Guía de uso de la base de datos Dialnet (y Dialnet Plus). Dialnet es un portal bibliográfico que recopila recursos científicos hispanos, apostando por el acceso abierto a la literatura científica. Dialnet funciona como un proyecto cooperativo, nacido en la Universidad de la Rioja, en el que actualmente participan numerosas bibliotecas universitarias españolas, entre ellas la Biblioteca de la Universidad de Málaga (UMA). Guía de uso de la base de datos Dialnet, elaborada por la Biblioteca d...

  4. The effects of zonation of the pen and grouping in intact litters on use of pen, immune competence and health of pigs

    Damgaard, B.M.; Studnitz, M.; Nielsen, Jens

    2006-01-01

    The effects of pen design and group composition were examined with respect to activity, use of pen, floor conditions, health condition and immune competence for groups of 60 pigs. The experiment was designed with the two factors with zones/without zones and divided litters/intact litters....... The experiment included a total of 1440 pigs from weaning at the age of 4 weeks to the age of 18 weeks after weaning. In pens with zones, the selection of different areas for different activities was improved. Pens with zones were more dirty in the elimination and open areas than pens without zones. In pens...... with zones, the number of lymphocytes was decreased, the ability to respond to an additional challenge by a model infection was decreased and the number of neutrophils was increased in intact litters. In week 9, the health condition was better with a group composition consisting of intact litters compared...

  5. Administration technique and storage of disposable insulin pens reported by patients with diabetes.

    Mitchell, Virginia D; Porter, Kyle; Beatty, Stuart J

    2012-01-01

    The purpose of the study was to evaluate insulin injection technique and storage of insulin pens as reported by patients with diabetes and to compare correct pen use to initial education on injection technique, hemoglobin A1C, duration of insulin therapy, and duration of insulin pen. Cross-sectional questionnaire orally administered to patients at a university-affiliated primary care practice. Subjects were patients with diabetes who were 18 years or older and prescribed a disposable insulin pen for at least 4 weeks. A correct usage score was calculated for each patient based on manufacturer recommendations for disposable insulin pen use. Associations were made between the correct usage score and certainty in technique, initial education, years of insulin therapy, duration of pen use, and hemoglobin A1C. Sixty-seven patients completed the questionnaire, reporting total use of 94 insulin pens. The 3 components most often neglected by patients were priming pen needle, holding for specific count time before withdrawal of pen needle from skin, and storing an in-use pen. For three-fourths of the insulin pens being used, users did not follow the manufacturer's instructions for proper administration and storage of insulin pens. Correct usage scores were significantly higher if initial education on insulin pens was performed by a pharmacist or nurse. The majority of patients may be ignoring or unaware of key components for consistent insulin dosing using disposable insulin pens; therefore, initial education and reeducation on correct use of disposable insulin pens by health care professionals are needed.

  6. DVD-d "Läbi hägu", "Tabamata ime" / Andris Feldmanis

    Feldmanis, Andris, 1982-

    2007-01-01

    Lühiarvustus kuue noorema põlve režissööri R. Sarneti, M. Kõrveri, M. Raati, A. Tammiksaare, J. Kilmi, A. Maimiku lühifilmide kogumikule E. Vilde näidendi "Tabamata ime" ainetel ning Richard Linklateri filmile "Läbi hägu" ("A Scanner Darkly"; USA 2006)

  7. Miks tulite e-õppe konverentsile? / Tia Vene, Tatjana Guž, Eha Kaukveer...[jt.

    2009-01-01

    Konverentsist " Õppijalt õppijale". Küsimusele vastavad: Kallavere Keskkooli algklassiõpetaja Tia Vene, Lasnamäe Põhikooli inglise keele õpetaja Tatjana Guž, Tallinna Päikesejänku lasteaia õpetaja Eha Kaukveer, Pelgulinna Gümnaasiumi IT-arendusjuht, arvutiõpetaja Birgit Lorenz ja Haapsalu Sanatoorse Internaatkooli õpetaja Villu Baumann

  8. Spendere meno, spendere meglio: una proposta panottica di J.-C. Guédon

    Maria Chiara Pievatolo

    2013-06-01

    Full Text Available J.-C. Guédon ha commentato la nostra campagna di crowdsourcing in merito alle spese delle biblioteche sulla mailing list Nexa. Offriamo, qui di seguito, la versione italiana delle sue osservazioni – che presuppongono un mondo accademico molto diverso da quello impostoci...

  9. Peter Brook tuleb koos etendusega festivalile "Talveöö unenägu" / Raivo Põldmaa

    Põldmaa, Raivo

    2008-01-01

    Teatrikülgede küsimused Eesti teatrijuhtidele sügishooaja loomingulistest plaanidest, majanduslangusest tingitud muudatustest teatris, Kultuurkapitali reisirahastamise teemal, algava sügishooaja põhiteema. Tallinna Linnateatri festivali "Talveöö unenägu" tutvustab Laur Kaunissaare. Artikkel ilmub ajaleherubriigis "Teatriküljed 10/34"

  10. A Decision Framework to Protect Coral Reefs in Guánica Bay, Puerto Rico

    A Watershed Management Plan (WMP) for Guánica Bay, Puerto Rico, was introduced in 2008 by a nonprofit organization, the Center for Watershed Protection, with the intent of protecting coral reefs from damage related to watershed discharges. The plan was initially generated with th...

  11. Guía para la evaluación del riesgo de los polinizadores

    La Guía para la evaluación del riesgo de los polinizadores de la EPA es parte de una estrategia de la evaluación de los riesgos que presentan los pesticidas para las abejas a fin de mejorar la protección de los polinizadores.

  12. Arquitectura del Paisaje: gu??a Did??ctica (ETSA-Universidad de Granada)

    Cabrera-Manzano, David

    2013-01-01

    Esta Gu??a contiene informaci??n sobre contenidos, objetivos, actividades, metodolog??a, criterios de evaluaci??n y otros asuntos de inter??s para los alumnos de Arquitectura, que cursan la asignatura optativa ARQUITECTURA DEL PAISAJE del Grado de Arquitectura en la Escuela T??cnica Superior de Arquitectura (ETSA) de la Universidad de Granada.

  13. Tema 4. Calor y temperatura (Guía del tema)

    Beléndez Vázquez, Augusto

    2010-01-01

    Guía del "Tema 4. Calor y temperatura" de la asignatura "Fundamentos Físicos de la Ingeniería I" del "Grado en Ingeniería en Sonido e Imagen" impartido en la Escuela Politécnica Superior de la Universidad de Alicante.

  14. Ajalool on ajaloolaste nägu / Jean-Claude Schmitt ; interv. Marek Tamm

    Schmitt, Jean-Claude

    2004-01-01

    Intervjuu ajaloolase Jean-Claude Schmittiga. Ilm. ka: Keha, pilt ja unenägu : intervjuu Jean-Claude Scmittiga // Schmitt, Jean-Claude. Püha hurdakoer : Guinefort - lasteravija 13. sajandist. - Tallinn, 2000. - Lk. 296-305 ; Kuidas kirjutatakse ajalugu? // Tamm, Marek. Kuidas kirjutatakse ajalugu? - Tallinn, 2007. - 161-177

  15. Guía de los beneficiaros de subvenciones para el uso de las bases ...

    Corey Piccioni

    de los documentos obtenidos a través de estas bases de datos. ... Guía para el uso de las bases de datos de investigación en IDRC .... Los campos donde usted busca utilizando palabras claves tienen un impacto en el número de resulta-.

  16. Low birth weight infants and Calmette-Guérin bacillus vaccination at birth

    Roth, Adam Anders Edvin; Jensen, Henrik; Garly, May-Lill

    2004-01-01

    In developing countries, low birth weight (LBW) children are often not vaccinated with Calmette-Guérin bacillus (BCG) at birth. Recent studies have suggested that BCG may have a nonspecific beneficial effect on infant mortality. We evaluated the consequences of not vaccinating LBW children at birth...

  17. 76 FR 52952 - Student Services Contract EP-11-D-000403 Yin Gu; Transfer of Data

    2011-08-24

    ... will enable Student Services Contract EP-11-D-000403 Yin Gu to fulfill the obligations of the contract... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-OPP-2011-0038; FRL-8884-1] Student Services Contract EP-11... Business Information (CBI) by the submitter, will be transferred to Student Services Contract EP- 11-D...

  18. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  19. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  20. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  1. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  2. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  3. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  4. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  5. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  6. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  7. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  8. arXiv Search for new physics with the SHiP experiment at CERN

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  9. Quadrupole deflector of the double Penning trap system MLLTRAP

    Gartzke, Eva; Kolhinen, Veli; Habs, Dietrich; Neumayr, Juergen; Schuermann, Christian; Szerypo, Jerzy; Thirolf, Peter [Fakultaet fuer Physik, LMU Muenchen, Garching (Germany); Maier-Leibnitz Laboratory, Garching (Germany)

    2009-07-01

    A cylindrical double Penning trap has been installed and successfully commissioned at the Maier-Leibnitz Laboratory in Garching. This trap system has been designed to isobarically purify low energy ion beams and perform highly accurate mass measurements. An electrostatic quadrupole deflector has been designed and installed at the injection line of the Penning trap system enabling a simultaneous use of an online ion beam with reference ions from an offline ion source. Alternatively two offline sources can be used concurrently e.g. an {alpha} recoil sources providing heavy radioactive species (e.g {sup 240}U) together with reference mass ions (which in the future will be e.g. a carbon cluster ion source). The bender has been designed for beam energies up to 1 keV with q/A ratios 1/1-1/250. This presentation shows the technical design and the operating parameters of the quadrupole beam bender and its implementation at the MLLTRAP system.

  10. Confirmation of a second EPR to be built at Penly

    Anon.

    2009-01-01

    The French government has made public its decision to launch the construction of a second EPR in France. This EPR is planned to be built on the Penly site (northern region of France). EDF will manage this project but other investors like GDF-Suez are invited to participate. The construction works are planned to begin in 2012 for a commissioning in 2017. This reactor will be the fifth EPR being built in the world. (A.C.)

  11. Status of the Penning trap project in Munich

    Szerypo, J.; Kolhinen, V.S.; Gartzke, E.; Habs, D.; Neumayr, J.; Schuermann, C.; Sewtz, M.; Thirolf, P.G.; Bussmann, M.; Schramm, U.

    2009-01-01

    The MLLTRAP at the Maier-Leibnitz-Laboratory (Garching) is a new Penning trap facility designed to combine several novel technologies to decelerate, charge breed, cool, bunch and purify the reaction products and perform high-accuracy nuclear and atomic mass measurements. It is now in the commissioning phase, achieving a mass-resolving power of about 10 5 in the purification trap for stable ions. (orig.)

  12. Status of the Penning trap project in Munich

    Szerypo, J.; Kolhinen, V.S.; Gartzke, E.; Habs, D.; Neumayr, J.; Schuermann, C.; Sewtz, M.; Thirolf, P.G. [University of Munich (LMU) and Maier-Leibnitz-Laboratory (MLL), Faculty of Physics, Garching (Germany); Bussmann, M.; Schramm, U. [University of Munich (LMU) and Maier-Leibnitz-Laboratory (MLL), Faculty of Physics, Garching (Germany); Forschungszentrum Dresden-Rossendorf, Dresden (Germany)

    2009-12-15

    The MLLTRAP at the Maier-Leibnitz-Laboratory (Garching) is a new Penning trap facility designed to combine several novel technologies to decelerate, charge breed, cool, bunch and purify the reaction products and perform high-accuracy nuclear and atomic mass measurements. It is now in the commissioning phase, achieving a mass-resolving power of about 10{sup 5} in the purification trap for stable ions. (orig.)

  13. Thermoplastic polymers surfaces for Dip-Pen Nanolithography of oligonucleotides

    Suriano, Raffaella; Biella, Serena; Cesura, Federico; Levi, Marinella; Turri, Stefano

    2013-01-01

    Different thermoplastic polymers were spin-coated to prepare smooth surfaces for the direct deposition of end-group modified oligonucleotides by Dip-Pen Nanolithography. A study of the diffusion process was done in order to investigate the dependence of calibration coefficient and quality of deposited features on environmental parameters (temperature, relative humidity) and ink's molecular weight and functionality. The optimization of the process parameters led to the realization of high quality and density nanoarrays on plastics.

  14. Thermoplastic polymers surfaces for Dip-Pen Nanolithography of oligonucleotides

    Suriano, Raffaella [Dipartimento di Chimica, Materiali e Ingegneria Chimica “Giulio Natta”, Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Biella, Serena, E-mail: serena.biella@polimi.it [Dipartimento di Chimica, Materiali e Ingegneria Chimica “Giulio Natta”, Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Cesura, Federico; Levi, Marinella; Turri, Stefano [Dipartimento di Chimica, Materiali e Ingegneria Chimica “Giulio Natta”, Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy)

    2013-05-15

    Different thermoplastic polymers were spin-coated to prepare smooth surfaces for the direct deposition of end-group modified oligonucleotides by Dip-Pen Nanolithography. A study of the diffusion process was done in order to investigate the dependence of calibration coefficient and quality of deposited features on environmental parameters (temperature, relative humidity) and ink's molecular weight and functionality. The optimization of the process parameters led to the realization of high quality and density nanoarrays on plastics.

  15. Chemical composition of felt-tip pen inks.

    Germinario, Giulia; Garrappa, Silvia; D'Ambrosio, Valeria; van der Werf, Inez Dorothé; Sabbatini, Luigia

    2018-01-01

    Felt-tip pens are frequently used for the realization of sketches, drawings, architectural projects, and other technical designs. The formulations of these inks are usually rather complex and may be associated to those of modern paint materials where, next to the binding medium and pigments/dyes, solvents, fillers, emulsifiers, antioxidants, plasticizers, light stabilizers, biocides, and so on are commonly added. Felt-tip pen inks are extremely sensitive to degradation and especially exposure to light may cause chromatic changes and fading. In this study, we report on the complete chemical characterization of modern felt-tip pen inks that are commercially available and commonly used for the realization of artworks. Three brands of felt-tip pens (Faber-Castell, Edding, and Stabilo) were investigated with complementary analytical techniques such as thin-layer chromatography (TLC), VIS-reflectance spectroscopy, μ-Raman spectroscopy, surface-enhanced Raman spectroscopy (SERS), pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS), GC-MS, and Fourier transform infrared (FTIR) spectroscopy. The use of TLC proved to be very powerful in the study of complex mixtures of synthetic dyes. First derivatives of the reflectance spectra acquired on the TLC spots were useful in the preliminary identification of the dye, followed by Raman spectroscopy and SERS, which allowed for the unambiguous determination of the chemical composition of the pigments (phthalocyanines, dioxazines, and azo pigments) and dyes (azo dyes, triarylmethanes, xanthenes). FTIR spectroscopy was used especially for the detection of additives, as well as for confirming the nature of solvents and dyes/pigments. Finally, (Py-)GC-MS data provided information on the binders (styrene-acrylic resins, plant gums), solvents, and additives, as well as on pigments and dyes.

  16. Space-charge effects in Penning ion traps

    Porobic, T.; Beck, M.; Breitenfeldt, M.; Couratin, C.; Finlay, P.; Knecht, A.; Fabian, X.; Friedag, P.; Flechard, X.; Lienard, E.; Ban, G.; Zákoucký, Dalibor; Soti, G.; Van Gorp, S.; Weinheimer, C.; Wursten, E.; Severijns, N.

    2015-01-01

    Roč. 785, JUN (2015), s. 153-162 ISSN 0168-9002 R&D Projects: GA MŠk LA08015; GA MŠk(CZ) LG13031 Institutional support: RVO:61389005 Keywords : Penning trap * space-charge * magnetron motion * ion trapping * buffer gas cooling * ion cyclotron resonance Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.200, year: 2015

  17. Ease of use and patient preference injection simulation study comparing two prefilled insulin pens.

    Clark, Paula E; Valentine, Virginia; Bodie, Jennifer N; Sarwat, Samiha

    2010-07-01

    To determine patient ease of use and preference for the Humalog KwikPen* (prefilled insulin lispro [Humalog dagger] pen, Eli Lilly and Company, Indianapolis, IN, USA) (insulin lispro pen) versus the Next Generation FlexPen double dagger (prefilled insulin aspart [NovoRapid section sign ] pen, Novo Nordisk A/S, Bagsvaerd, Denmark) (insulin aspart pen). This was a randomized, open-label, 2-period, 8-sequence crossover study in insulin pen-naïve patients with diabetes. Randomized patients (N = 367) received device training, then simulated low- (15 U) and high- (60 U) dose insulin injections with an appliance. Patients rated pens using an ease of use questionnaire and were asked separately for final pen preferences. The Insulin Device 'Ease of Use' Battery is a 10-item questionnaire with a 7-point scale (higher scores reflect greater ease of use). The primary objective was to determine pen preference for 'easy to press to inject my dose' (by comparing composite scores [low- plus high-dose]). Secondary objectives were to determine pen preference on select questionnaire items (from composite scores), final pen preference, and summary responses for all questionnaire items. On the primary endpoint, 'easy to press to inject my dose,' a statistically significant majority of patients with a preference chose the insulin lispro pen over the insulin aspart pen (68.4%, 95% CI = 62.7-73.6%). Statistically significant majorities of patients with a preference also favored the insulin lispro pen on secondary items: 'easy to hold in my hand when I inject' (64.9%, 95% CI = 58.8-70.7%), 'easy to use when I am in a public place' (67.5%, 95% CI = 61.0-73.6%), and 'overall easy to use' (69.9%, 95% CI = 63.9-75.4%). A statistically significant majority of patients had a final preference for the insulin lispro pen (67.3%, 95% CI = 62.2-72.1%). Among pen-naïve patients with diabetes who had a preference, the majority preferred the insulin lispro pen over the insulin aspart pen with regard

  18. Pen Branch Delta and Savannah River Swamp Hydraulic Model

    Chen, K.F.

    1999-01-01

    The proposed Savannah River Site (SRS) Wetlands Restoration Project area is located in Barnwell County, South Carolina on the southwestern boundary of the SRS Reservation. The swamp covers about 40.5 km2 and is bounded to the west and south by the Savannah River and to the north and east by low bluffs at the edge of the Savannah River floodplain. Water levels within the swamp are determined by stage along the Savannah River, local drainage, groundwater seepage, and inflows from four tributaries, Beaver Dam Creek, Fourmile Branch, Pen Branch, and Steel Creek. Historic discharges of heated process water into these tributaries scoured the streambed, created deltas in the adjacent wetland, and killed native vegetation in the vicinity of the delta deposits. Future releases from these tributaries will be substantially smaller and closer to ambient temperatures. One component of the proposed restoration project will be to reestablish indigenous wetland vegetation on the Pen Branch delta that covers about 1.0 km2. Long-term predictions of water levels within the swamp are required to determine the characteristics of suitable plants. The objective of the study was to predict water levels at various locations within the proposed SRS Wetlands Restoration Project area for a range of Savannah River flows and regulated releases from Pen Branch. TABS-MD, a United States Army Corps of Engineer developed two-dimensional finite element open channel hydraulic computer code, was used to model the SRS swamp area for various flow conditions

  19. Pen harvester for powering a pulse rate sensor

    Bedekar, Vishwas; Oliver, Josiah; Priya, Shashank

    2009-01-01

    Rapid developments in the area of micro-sensors for various applications such as structural health monitoring, bio-chemical sensors and pressure sensors have increased the demand for portable, low cost, high efficiency energy harvesting devices. In this paper, we describe the scheme for powering a pulse rate sensor with a vibration energy harvester integrated inside a pen commonly carried by humans in the pocket close to the heart. Electromagnetic energy harvesting was selected in order to achieve high power at lower frequencies. The prototype pen harvester was found to generate 3 mW at 5 Hz and 1 mW at 3.5 Hz operating under displacement amplitude of 16 mm (corresponding to an acceleration of approximately 1.14 g rms at 5 Hz and 0.56 g rms at 3.5 Hz, respectively). A comprehensive mathematical modelling and simulations were performed in order to optimize the performance of the vibration energy harvester. The integrated pen harvester prototype was found to generate continuous power of 0.46-0.66 mW under normal human actions such as jogging and jumping which is enough for a small scale pulse rate sensor.

  20. Public debate on the Penly 3 project. Construction of an electronuclear production unit of the Penly site (Seine-Maritime)

    2010-01-01

    After a presentation of the objectives of the Penly 3 project, this report gives an overview of the context of electricity production (increasing world demand, geographically unbalanced energy reserves with fluctuating prices and a tendency to increase, French energy assessment, electricity peculiarities, electricity production and consumption in France in 2009, climate change issue). It presents the Penly 3 project and its alternatives within the frame of the French environment and energy policy. The project is then presented in terms of safety objectives, of design choices, of environmental improvements (water sampling, thermal, chemical and radioactive releases, wastes, sound and visual impact, foreseen cost and financing), and then in terms of socio-economical impact. The main steps of the project are briefly indicated

  1. Factors related to late GI and GU complications in conformal and conventional radiation treatment of cancer of the prostate

    Schultheiss, Timothy E.; Lee, W. Robert; Hunt, Margie A.; Hanlon, Alexandra L.; Peter, Ruth S.; Hanks, Gerald E.

    1995-01-01

    Purpose: To assess the factors that predict for late GI and GU morbidity in radiation treatment of the prostate. Materials and Methods: Six hundred sixteen consecutive prostate cancer patients treated between 1985 and 1994 with conformal or conventional techniques were included in the analysis. All patients had at least 3 months followup (median 26 months) and received at least 65 Gy. Late GI morbidity was rectal bleeding (requiring more than 2 procedures) or proctitis. Late GU morbidity was cystitis or stricture. Univariate analysis compared the differences in the incidence of RTOG-EORTC grade 3 and 4 late morbidity by age (<60 versus ≥ 60 years), peracute side effects ≥ grade 1 (during treatment), subacute side effects ≥ grade 1 (0 to 90 days after treatment), irradiated volume parameters, and dose. Multivariate proportional hazards analysis includes these same variables in a model of time to complication. Multivariate logistic regression was used to analyze incidence of peracute and subacute GI and GU side effects by GI and GU comorbidities, performance status, pretreatment procedures (biopsy, TURP, etc.), age, treatment volume parameters, and peracute responses. Results: Peracute GI and GU side effects were noted in 441 and 442 patients, respectively. Subacute GI and GU side effects were noted in 34 and 54 patients, respectively. Subacute GI side effects were highly correlated with subacute GU side effects (p<0.00001). Late morbidities were not correlated with peracute side effects but were correlated with subacute side effects (both GI and GU). Thirteen of the 616 patients expressed grade 3 or 4 GI injuries 3 to 32 months after the end of treatment, with a mean of 13 months. The 6 GU morbidities occurred significantly later (9 - 52 months) with a mean of 33 months. Central axis dose and age less than 60 years were the only independent variables significantly related to the incidence of late GI morbidity on multivariate analysis. Subacute and peracute

  2. Las guías de valoración de los requerimientos laborales en la Incapacidad Laboral: la Guía de Valoración Profesional del INSS, el mercal y la Guía Mejorada del Instituto de Biomecánica de Valencia

    Manuel García Herrera

    2014-01-01

    Full Text Available Se hace un análisis comparativo de las guías de valoración de requerimientos laborales: la Guía de Valoración Profesional del INSS, el MERCAL y la Guía mejorada del Instituto de Biomecánica de Valencia, se destacan los defectos y virtudes de cada una de ellas, sus puntos fuertes y sus puntos débiles, y se apuesta hacia la convergencia de todas ellas en una misma herramienta unificada.

  3. Temperature and body weight affect fouling of pig pens.

    Aarnink, A J A; Schrama, J W; Heetkamp, M J W; Stefanowska, J; Huynh, T T T

    2006-08-01

    Fouling of the solid lying area in pig housing is undesirable for reasons of animal welfare, animal health, environmental pollution, and labor costs. In this study the influence of temperature on the excreting and lying behavior of growing-finishing pigs of different BW (25, 45, 65, 85, or 105 kg) was studied. Ten groups of 5 pigs were placed in partially slatted pens (60% solid concrete, 40% metal-slatted) in climate respiration chambers. After an adaptation period, temperatures were raised daily for 9 d. Results showed that above certain inflection temperatures (IT; mean 22.6 degrees C, SE = 0.78) the number of excretions (relative to the total number of excretions) on the solid floor increased with temperature (mean increase 9.7%/ degrees C, SE = 1.41). Below the IT, the number of excretions on the solid floor was low and not influenced by temperature (mean 13.2%, SE = 3.5). On average, the IT for excretion on the solid floor decreased with increasing BW, from approximately 25 degrees C at 25 kg to 20 degrees C at 100 kg of BW (P temperature also affected the pattern and postural lying. The temperature at which a maximum number of pigs lay on the slatted floor (i.e., the IT for lying) decreased from approximately 27 degrees C at 25 kg to 23 degrees C at 100 kg of BW (P temperatures, pigs lay more on their sides and less against other pigs (P Temperature affects lying and excreting behavior of growing-finishing pigs in partially slatted pens. Above certain IT, pen fouling increases linearly with temperature. Inflection temperatures decrease at increasing BW.

  4. [A brief investigation on Gu Dehua, a female healer from Wuzhong in the Qing Dynasty].

    Lin, Z K; Song, W J

    2016-09-28

    The female healer is a special community in traditional Chinese medical professionals. Since the Song-Yuan Dynasties, although the literati class holding the social voices and the male healers acting as medical orthodoxy were always suspicious of the female healers' behaviors and their medical morality, and tarnished their images through all kinds of media. Meanwhile, the female healers were still badly needed on the account of recognition of distinction between sexes between both sexes due to the rising of neo-Confucianism. An excellent female healer could still earn wide respect from the society. Gu Dehua was a famous female healer from Wuzhong in the Qing Dynasty's Daoguang-Xianfeng period. By investigating Gu Delua's family conditions, deeds and works, and her career, the community of the female healers in the Ming-Qing Dynasties can be thus understood.

  5. Guías, indigenismo y turismo en el Cusco, Perú

    Chara Azurín, Alberto Carlos; Jiménez Caballero, José Luis (Coordinador)

    2011-01-01

    La presente investigación reflexiona y analiza sobre la actividad profesional de los guías turísticos que operan en la región de Cusco, Perú. Esta área geográfica declarada Patrimonio Cultural de la Humanidad por la Unesco en el año 1983, es considerada como el gran eje turístico y punto de ingreso obligatorio para la visita de una de las nuevas siete maravillas del mundo “Machu Picchu”. Los guías turísticos desempeñan un importante rol en la difusión del patrimonio cultur...

  6. Guía de Patología Autópsica

    Arce Mateos, Félix Pablo; Fernández Fernández, Fidel Ángel; Fernández Vega, Iván; Galtés, Ignasi; Guerra Merino, Isabel; Lucena, Joaquín; Mayorga Fernández, Marta María; Regojo, Rita María; Suárez, María Paz; Terán Villagrá, Nuria

    2015-01-01

    El trabajo que aquí se publica se trata de la Guía Clinica de Consenso redactada por el Club de Autopsias de la Sociedad Española de Anatomía Patológica para el Libro Blanco de la Anatomía Patológica presentado en el XXVIII Congreso Nacional de la SEAP-IAP, XXII Congreso Nacional Sociedad Española de Citología y III Congreso Nacional Sociedad Española de Patología Forense, en mayo de 2015 en la ciudad de Santander. En palabras de su presidente, el Dr. M.A. Piris, “el papel de estas guías doce...

  7. Correlates of cannabis vape-pen use and knowledge among U.S. college students

    Tessa Frohe

    2018-06-01

    Full Text Available Introduction: The proliferation of electronic devices, such as vape-pens, has provided alternative means for cannabis use. Research has found cannabis-vaping (i.e., vape-pen use is associated with lower perceived risks and higher cannabis use. Knowledge of these products may increase likelihood of subsequent use. As policies for cannabis shift, beliefs that peers and family approve of this substance use (injunctive norms increase and there has been an increase in vape-pen use among young adults (18–35year olds; however, correlates thereof remain unknown. Young adults often engage in cross-substance use with cannabis and alcohol, making alcohol a potential correlate of cannabis vape-pen use and knowledge. Therefore, we examined alcohol use and other potential correlates of vape-pen use and knowledge among a sample of university students. Methods: This secondary data analysis utilized surveys at multiple colleges in the U.S. (N=270. Alcohol use, social anxiety, cannabis expectancies, injunctive and descriptive norms and facets of impulsivity were examined as correlates of vape-pen use and knowledge using bivariate correlations and logistic regressions. Results: Alcohol use was correlated with cannabis vape-pen use and knowledge. Frequency of cannabis use, peer injunctive norms, and positive expectancies were associated with increased likelihood of vape-pen use. Lack of premeditation, a facet of impulsivity, was associated with cannabis vape-pen knowledge. Conclusions: Given the unknown nature and consequences of cannabis vape-pens, the present findings offer valuable information on correlates of this behavior. Further, correlates of knowledge of vape-pens may point to areas for education and clinical intervention to prevent heavy cannabis vape-pen use. Keywords: Marijuana, Vaporizer, College students, Substance use, Attitudes, Cannabis

  8. Tilting-Twisting-Rolling: a pen-based technique for compass geometric construction

    Fei LYU; Feng TIAN; Guozhong DAI; Hongan WANG

    2017-01-01

    This paper presents a new pen-based technique,Tilting-Twisting-Rolling,to support compass geometric construction.By leveraging the 3D orientation information and 3D rotation information of a pen,this technique allows smooth pen action to complete multi-step geometric construction without switching task states.Results from a user study show this Tilting-Twisting-Rolling technique can improve user performance and user experience in compass geometric construction.

  9. Development of the Pirani and penning vacuum gauges

    Oh, B. H.; In, S. R.; Yoon, B. J.; Yoon, J. S.

    2000-02-01

    The Pirani and penning gauges developed during this study had made good characteristics compared with the measured results of customized other gauges, and this results show the possibility of developing the gauges by ourselves in Korea. In order to make a competition with the customized gauges of other countries, it is necessary to upgrade several points to have good characteristics over the large range of the pressure. The new efforts will be made in developing the full scale gauge in the next year. (author)

  10. Mechanism of force mode dip-pen nanolithography

    Yang, Haijun, E-mail: yanghaijun@sinap.ac.cn, E-mail: swguo@sjtu.edu.cn, E-mail: wanghuabin@cigit.ac.cn [Key Laboratory for Thin Film and Microfabrication of the Ministry of Education, Research Institute of Micro/Nano Science and Technology, Shanghai Jiao Tong University, Shanghai 200240 (China); Interfacial Water Division and Key Laboratory of Interfacial Physics and Technology, Shanghai Institute of Applied Physics, CAS, Shanghai 201800 (China); Xie, Hui; Rong, Weibin; Sun, Lining [State Key Laboratory of Robotics and Systems, Harbin Institute of Technology, Harbin 150080 (China); Wu, Haixia; Guo, Shouwu, E-mail: yanghaijun@sinap.ac.cn, E-mail: swguo@sjtu.edu.cn, E-mail: wanghuabin@cigit.ac.cn [Key Laboratory for Thin Film and Microfabrication of the Ministry of Education, Research Institute of Micro/Nano Science and Technology, Shanghai Jiao Tong University, Shanghai 200240 (China); Wang, Huabin, E-mail: yanghaijun@sinap.ac.cn, E-mail: swguo@sjtu.edu.cn, E-mail: wanghuabin@cigit.ac.cn [Centre for Tetrahertz Research, Chongqing Institute of Green and Intelligent Technology, Chinese Academy of Sciences, Chongqing 400714 (China)

    2014-05-07

    In this work, the underlying mechanism of the force mode dip-pen nanolithography (FMDPN) is investigated in depth by analyzing force curves, tapping mode deflection signals, and “Z-scan” voltage variations during the FMDPN. The operation parameters including the relative “trigger threshold” and “surface delay” parameters are vital to control the loading force and dwell time for ink deposition during FMDPN. A model is also developed to simulate the interactions between the atomic force microscope tip and soft substrate during FMDPN, and verified by its good performance in fitting our experimental data.

  11. Xenon-based Penning mixtures for proportional counters

    Ramsey, B.D.; Agrawal, P.C.; National Aeronautics and Space Administration, Huntsville, AL

    1989-01-01

    The choice of quench gas can have a significant effect on the gas gain and energy resolution of gas-filed proportional counters. Details are given on the performance obtained with a variety of quench additives of varying ionization potentials for use in xenon-filled systems. It is confirmed that optimum performance is obtained when the ionization potential is closely matched to the first metastable level of xenon (8.3 eV) as is the case with xenon + trimethylamine and xenon + dimethylamine. For these mixtures the Penning effect is at its strongest. (orig.)

  12. Experiments with Highly-Ionized Atoms in Unitary Penning Traps

    Shannon Fogwell Hoogerheide

    2015-08-01

    Full Text Available Highly-ionized atoms with special properties have been proposed for interesting applications, including potential candidates for a new generation of optical atomic clocks at the one part in 1019 level of precision, quantum information processing and tests of fundamental theory. The proposed atomic systems are largely unexplored. Recent developments at NIST are described, including the isolation of highly-ionized atoms at low energy in unitary Penning traps and the use of these traps for the precise measurement of radiative decay lifetimes (demonstrated with a forbidden transition in Kr17+, as well as for studying electron capture processes.

  13. Electron Cooling of Protons in a Nested Penning Trap

    Hall, D.S.; Gabrielse, G.

    1996-01-01

    Trapped protons cool via collisions with trapped electrons at 4 K.This first demonstration of sympathetic cooling by trapped species of opposite sign of charge utilizes a nested Penning trap. The demonstrated interaction of electrons and protons at very low relative velocities, where recombination is predicted to be most rapid, indicates that this may be a route towards the study of low temperature recombination. The production of cold antihydrogen is of particular interest, and electron cooling of highly stripped ions may also be possible. copyright 1996 The American Physical Society

  14. Proportional counter with uniform electric field with Penning's mixture

    Pawlowski, Z.; Marzec, J.; Zaremba, K.

    1984-01-01

    Some calculations are given and the design of proportional counters with a homogeneous electric field filled with Penning's mixtures, which ensure the best energy resolution is described. The counters with mixtures of Ne+Ar, Ne+CH 4 , Ne+CO 2 and Ar+C 2 H 2 have been checked. The admixtures (Ar, CH 4 , CO 2 , C 2 H 2 ) constitute from 0.1 to 2%, with pressure from 125 Tr to 760 Torr. The best energy resolution has been obtained for the mixture of Ne+1%CH 4 at the pressure of 190 Torr

  15. Läti hea teatri mitu nägu / Rait Avestik

    Avestik, Rait

    2007-01-01

    Läti teatri eelmise hooaja parimate uuslavastuste ülevaatefestivalist "Spelmanu Nakts 2006" ("Mängurite Ööd"). Etendustest: Albert Camus "Caligula" - lavastaja Dzh. Dzh. Dzhilindzhers (Dailes Teater), David Harrower "Noad kanade sees" - lavastaja Gatis Shmits (Dailes Teater), Umka.Iv ja Betontanc "Näita oma nägu" - lavastaja Matjazh Pograjc, Jorge Luis Borges "Hellus" - lavastaja Elina Cerpa (Riia Uus Teater), Vladimir Sorokin "Jää" - lavastaja Alvis Hermanis (Riia Uus Teater)

  16. Risk of Inflammatory Bowel Disease following Bacille Calmette-Guérin and Smallpox Vaccination

    Villumsen, Anne Marie; Jess, Tine; Sørup, Signe

    2013-01-01

    Childhood immunology has been suggested to play a role in development of inflammatory bowel disease (IBD) based on the studies of childhood vaccinations, infections, and treatment with antibiotics. Bacille Calmette-Guérin (BCG) and smallpox vaccinations were gradually phased-out in Denmark...... for children born between 1965 and 1976, hence allowing the study of subsequent risk of Crohn's disease and ulcerative colitis in a unique prospective design....

  17. Analysis of the NovoTwist pen needle in comparison with conventional screw-thread needles.

    Aye, Tandy

    2011-11-01

    Administration of insulin via a pen device may be advantageous over a vial and syringe system. Hofman and colleagues introduce a new insulin pen needle, the NovoTwist, to simplify injections to a small group of children and adolescents. Their overall preferences and evaluation of the handling of the needle are reported in the study. This new needle has the potential to ease administration of insulin via a pen device that may increase both the use of a pen device and adherence to insulin therapy. © 2011 Diabetes Technology Society.

  18. An audit of Colposcopy referrals from a GU/STD clinic.

    O'Connor, Catherine

    2008-01-01

    BACKGROUND: Cervical cancer is increasing at 1.5% per year in Ireland with 50% mortality giving 2.2% of all cancer deaths. In the Mid-West region a pilot screening programme has begun to screen all women 25-60 years. 66% of Genitourinary\\/Sexually transmitted disease (GU\\/STD) clinics\\' abnormal smears are <25 years. Requests to abandon "opportunistic" screening prompted this GU\\/STD clinic audit. METHODS: 221(8.4%) patients referred to colposcopy over 4 years were audited. Retrospective analysis was carried out on GU\\/STD clinic files, hospital files and computer records for biopsy reports. Ethical approval was prospectively granted. RESULTS: 2637 smears were carried out from November 1999 - September 2003.221 patients referred to colposcopy were audited.1%, 3%, 5% had severe, moderate and, mild dyskaryosis, respectively, on cervical screening while 0.8%, 1.2%, 1.5% had CIN3, CIN2, CIN1 abnormalities, respectively, on biopsy with 3.5% having no abnormality (Cervical Intraepithelial Neoplasia = CIN).53% referred to colposcopy were <25 years. CONCLUSION: 2% had high grade lesions. 37% of high grade lesions are <25 years.Of the high grade lesions 13% had Chlamydia trachomatis (27% of CIN3) and 44% had HPV despite Relative Risks (RR) being 0.75 and 1.09 respectively. Older women had higher grade changes. No statistical difference was found for progression, regression and persistence in those over and under 25.

  19. El lenguaje integral en el grupo interactivo II: guía pedagógica

    Jeanneth Cerdas Núñez

    2002-01-01

    Full Text Available En los últimos años la filosofía del Lenguaje Integral se ha venido promoviendo en diversas instituciones educativas, como una opción para generar procesos de construcción de lenguaje y conocimiento desde una perspectiva constructivista en los salones de clase. Con base en algunas de las experiencias desarrolladas en nuestro contexto costarricense, surgió la idea de elaborar una guía didáctica que considere algunos elementos de la filosofía del Lenguaje Integral para abordar la práctica pedagógica con niños de edades entre 4 y 5 años. Dicha guía contempla básicamente estrategias para diseñar y operacionalizar el planeamiento didáctico y lineamientos para organizar el ambiente físico del aula. Para efectos de implementar la guía didáctica elaborada, es necesario que cada usuario profundice en los diferentes aspectos de la filosofía del Lenguaje Integral y de esta manera pueda adecuar la propuesta a su contexto

  20. Guía básica para organizar un campamento recreativo y formativo

    Jorge Mejía Calderón

    2010-01-01

    Full Text Available La información expuesta en este artículo es parte de un trabajo final de investigación de maestría. Ese trabajo final tenía dos objetivos generales. El primero fue el desarrollo de un campamento para capacitar a 40 líderes de pastorales juveniles. El segundo objetivo fue la elaboración de una guía sobre la organización de un campamento recreativo y formativo. Esta guía es la que se presenta en este artículo, la cual se fundamentó en la revisión bibliográfica y la experiencia obtenida en el campamento con los grupos de pastorales juveniles. La guía comparte la importancia de esta actividad recreativa como una herramienta para reforzar en las personas áreas tales como la educación, la espiritualidad y las habilidades físicas. Además, incluye una reseña histórica con respecto a los campamentos y los elementos básicos de un programa de campamento: el inicio, la imagen, la filosofía, la estructura del programa, la selección de personas facilitadoras, la espiritualidad, el horario y la evaluación.

  1. Análisis comparativo de guías para el desarrollo web accesible

    Luis Felipe Londoño Rojas

    2018-01-01

    Full Text Available En la actualidad los sitios web no cumplen con requerimientos mínimos de accesibilidad, lo que impide que cualquier persona sin importar sus condiciones pueda acceder a los contenidos y servicios disponibles a través de estos sitios. Este problema se da en parte porque los desarrolladores no tienen conocimientos de los criterios y pautas de accesibilidad existen-tes o no saben cómo implementarlas. Como una alternativa, en este trabajo se presenta un análisis de guías para el desarrollo accesible, donde se evalúan diferentes criterios como las discapacidades que son atendidas, el nivel de conocimientos técnico que se requiere para su comprensión y la forma como se presentan los contenidos. A partir de esta evaluación se genera un cuadro comparativo y se hace la selección de las guías que pueden ser de mayor utilidad en la creación de sitios web accesibles, lo que puede servir como un apoyo a los desarrolladores al decidir cuál guía utilizar.

  2. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  3. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing

    2014-02-12

    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  4. Defining the Pen Islands Caribou Herd of southern Hudson Bay

    Kenneth F. Abraham

    1998-03-01

    Full Text Available In this paper, we describe the Pen Islands Herd of caribou, the largest aggregation of caribou in Ontario (it also occupies a portion of northeastern Manitoba. Photographic counts showed the herd had a minimum population of 2300 in 1979, 4660 in 1986, 7424 in 1987 and 10 798 in 1994. Throughout the 1980s, the Pen Islands caribou exhibited population behaviour similar to migratory barren-ground caribou herds, although morphology suggests they are woodland caribou or possibly a mixture of subspecies. The herd had well-defined traditional tundra calving grounds, formed nursery groups and large mobile post-calving aggregations, and migrated over 400 km between tundra summer habitats and boreal forest winter habitats. Its migration took it into three Canadian jurisdictions (Ontario, Manitoba, Northwest Territories and it was important to residents of both Manitoba and Ontario. It is clear that the herd should be managed as a migratory herd and the critical importance of both the coastal and variable large winter ranges should be noted in ensuring the herd's habitat needs are secure.

  5. A Penning-assisted subkilovolt coaxial plasma source

    Wang Zhehui; Beinke, Paul D.; Barnes, Cris W.; Martin, Michael W.; Mignardot, Edward; Wurden, Glen A.; Hsu, Scott C.; Intrator, Thomas P.; Munson, Carter P.

    2005-01-01

    A Penning-assisted 20 MW coaxial plasma source (plasma gun), which can achieve breakdown at sub-kV voltages, is described. The minimum breakdown voltage is about 400 V, significantly lower than previously reported values of 1-5 kV. The Penning region for electrons is created using a permanent magnet assembly, which is mounted to the inside of the cathode of the coaxial plasma source. A theoretical model for the breakdown is given. A 900 V 0.5 F capacitor bank supplies energy for gas breakdown and plasma sustainment from 4 to 6 ms duration. Typical peak gun current is about 100 kA and gun voltage between anode and cathode after breakdown is about 200 V. A circuit model is used to understand the current-voltage characteristics of the coaxial gun plasma. Energy deposited into the plasma accounts for about 60% of the total capacitor bank energy. This plasma source is uniquely suitable for studying multi-MW multi-ms plasmas with sub-MJ capacitor bank energy

  6. Vegetation survey of Pen Branch and Four Mile Creek wetlands

    1992-01-01

    One hundred-fifty plots were recently sampled (vegetational sampling study) at the Savannah River Site (SRS). An extensive characterization of the vascular flora, in four predetermined strata (overstory, Understory, shrub layer, and ground cover), was undertaken to determine dominance, co-dominance, and the importance value (I.V.) of each species. These results will be used by the Savannah River Laboratory (SRL) to evaluate the environmental status of Four Mile Creek, Pen Branch, and two upland pine stands. Objectives of this study were to: Describe in detail the plant communities previously mapped with reference to the topography and drainage, including species of plants present: Examine the successional trends within each sampling area and describe the extent to which current vegetation communities have resulted from specific earlier vegetation disturbances (e.g., logging and grazing); describe in detail the botanical field techniques used to sample the flora; describe the habitat and location of protected and/or rare species of plants; and collect and prepare plant species as herbarium quality specimens. Sampling was conducted at Four Mile Creek and Pen Branch, and in two upland pine plantations of different age growth.

  7. Vegetation survey of Pen Branch and Four Mile Creek wetlands

    1992-10-01

    One hundred-fifty plots were recently sampled (vegetational sampling study) at the Savannah River Site (SRS). An extensive characterization of the vascular flora, in four predetermined strata (overstory, Understory, shrub layer, and ground cover), was undertaken to determine dominance, co-dominance, and the importance value (I.V.) of each species. These results will be used by the Savannah River Laboratory (SRL) to evaluate the environmental status of Four Mile Creek, Pen Branch, and two upland pine stands. Objectives of this study were to: Describe in detail the plant communities previously mapped with reference to the topography and drainage, including species of plants present: Examine the successional trends within each sampling area and describe the extent to which current vegetation communities have resulted from specific earlier vegetation disturbances (e.g., logging and grazing); describe in detail the botanical field techniques used to sample the flora; describe the habitat and location of protected and/or rare species of plants; and collect and prepare plant species as herbarium quality specimens. Sampling was conducted at Four Mile Creek and Pen Branch, and in two upland pine plantations of different age growth.

  8. Design of a high field uniformity electromagnet for Penning trap

    Itteera, Janvin; Singh, Kumud; Teotia, Vikas; Ukarde, Priti; Malhotra, Sanjay; Taly, Y.K.; Joshi, Manoj; Rao, Pushpa

    2013-01-01

    An ion trap (Penning trap) facility is being developed at BARC for spectroscopy studies. This requires the design of an iron core electromagnet capable of generating high magnetic fields (∼1.7T) at the centre of an 88 mm long air gap. This electromagnet provides the requisite dipole magnetic field which when superimposed on the electrostatic quadrupoles ensures a stable trapping of ions. To conduct high precision spectroscopy studies, we need to ensure a high degree of magnetic field uniformity ( 3 volume (Trap zone). Various pole shoe profiles were studied and modelled, FEM simulation of the same were conducted to compute the magnetic field intensity and field uniformity. Owing to the large air gap and requirement of high field intensity in the GFR, the exciting coils need to handle high current densities, which require water cooled systems. Double Pan-Cake coil design is selected for powering the magnet. Electrical, thermal and hydraulic designs of the coils are completed and a prototype double pancake coil was fabricated and tested for verifying the electrical and thermal parameter. The spatial field homogeneity is achieved by shimming the pole tip. Temporal stability of magnet requires a highly stable power supply for exciting the coils and its stability class is derived from FEM simulations. This paper discusses the electromagnetic design and development of the penning trap magnet being developed at BARC. (author)

  9. Development of hollow anode penning ion source for laboratory application

    Das, B.K., E-mail: dasbabu31@gmail.com [Energetics and Electromagnetics Division, Bhabha Atomic Research Centre, Autonagar, Visakhapatnam (India); Shyam, A.; Das, R. [Energetics and Electromagnetics Division, Bhabha Atomic Research Centre, Autonagar, Visakhapatnam (India); Rao, A.D.P. [Department of Nuclear Physics, Andhra University, Visakhapatnam (India)

    2012-03-21

    The research work presented here focuses for the development of miniature penning type ion source. One hollow anode penning type ion source was developed in our laboratory. The size of the ion source is 38 mm diameter and 55 mm length. The ion source consists of two cathodes, a hollow anode and one piece of rare earth permanent magnet. The plasma was created in the plasma region between cathodes and the hollow anode. The J Multiplication-Sign B force in the region helps for efficient ionization of the gas even in the high vacuum region{approx}1 Multiplication-Sign 10{sup -5} Torr. The ions were extracted in the axial direction with help of the potential difference between the electrodes and the geometry of the extraction angle. The effect of the extraction electrode geometry for efficient extraction of the ions from the plasma region was examined. This ion source is a self extracted ion source. The self extracted phenomena reduce the cost and the size of the ion source. The extracted ion current was measured by a graphite probe. An ion current of more than 200 {mu}A was observed at the probe placed 70 mm apart from the extraction electrode. In this paper, the structure of the ion source, effect of operating pressure, potential difference and the magnetic field on the extracted ion current is reported.

  10. About the measurements systems with pen and thermoluminescent dosemeters

    Cortes I, M.E.; Ramirez G, F.P.

    1998-01-01

    In this work it is presented dosimetric data obtained with pen and thermoluminescent dosemeters, which are used by the Occupational Exposure Personnel (OEP) of the Mexican Petroleum Institute (IMP)(1). It was marked several great characteristics as for example, the differences among units which use one and another dosemeter type. Likewise, it is given to know diverse problems that were had in the IMP at relating the data obtained with these dosemeters (which utilizes OEP) and the ICRP 60 recommendations 1990. One of the most important difficulties is to satisfy the recommended limits by ICRP, particularly those that are referring to the units and their complex calculations. With respect to the unities, the ICRP makes reference at the concepts 'dose equivalent' and 'effective dose' with the sievert unit, that the General Regulations for Radiological Safety associates with 'dose equivalent' and 'effective dose equivalent'. It was illustrated the type of dosimetric statistics which are obtained with the TLD lectures and a OEP pen dosemeter during 1997. (Author)

  11. Analysis on composition and inclusions of ballpoint pen tip steel

    Yang, Qian-kun; Shen, Ping; Zhang, Dong; Wu, Yan-xin; Fu, Jian-xun

    2018-04-01

    Ballpoint pen tip steel, a super free-cutting stainless steel, exhibits excellent corrosion resistance and good machining properties. In this study, inductively coupled plasma spectroscopy, metallographic microscopy, and scanning electron microscopy were used to determine the elemental contents in five ballpoint pen tips and their components, morphologies, and inclusion distributions. The results showed that the steels were all S-Pb-Te super free-cutting ferritic stainless steel. The free-cutting phases in the steels were mainly MnS, Pb, and small amounts of PbTe. MnS inclusions were in the form of chain distributions, and the aspect ratio of each size inclusion in the chain was small. The stress concentration effect could substantially reduce the cutting force when the material was machined. Some of the Pb was distributed evenly in the steel matrix as fine particles (1-2 μm), and the rest of the Pb was distributed at the middle or at both ends of the MnS inclusions. The Pb plays a role in lubrication and melting embrittlement, which substantially increases the cutting performance. PbTe was also usually distributed in the middle and at both ends of the MnS inclusions, and Te could convert the sulfides into spindles, thereby improving the cutting performance of the steel.

  12. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  13. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  14. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  15. Tail posture predicts tail biting outbreaks at pen level in weaner pigs

    Lahrmann, Helle Pelant; Hansen, Christian Fink; D'Eath, Rick

    2018-01-01

    posture and behaviour could be detected at pen level between upcoming tail biting pens (T-pens) and control pens (C-pens). The study included 2301 undocked weaner pigs in 74 pens (mean 31.1 pigs/pen; SD 1.5). Tails were scored three times weekly (wound freshness, wound severity and tail length) between 07......Detecting a tail biting outbreak early is essential to reduce the risk of pigs getting severe tail damage. A few previous studies suggest that tail posture and behavioural differences can predict an upcoming outbreak. The aim of the present study was therefore to investigate if differences in tail......:00 h-14:00 h from weaning until a tail biting outbreak. An outbreak (day 0) occurred when at least four pigs had a tail damage, regardless of wound freshness. On average 7.6 (SD 4.3) pigs had a damaged tail (scratches + wound) in T-pens on day 0. Tail posture and behaviour (activity, eating...

  16. Flexible AMOLED display on polyethylene napthalate (PEN) foil with metal-oxide TFT backplane

    Tripathi, A.K.; Putten, B. van der; Steen, J.L. van der; Tempelaars, K.; Cobb, B.; Ameys, M.; Ke, T.H.; Myny, K.; Steudel, S.; Nag, M.; Schols, S.; Vicca, P.; Smout, S.; Genoe, J.; Heremans, P.; Yakimets, I.; Gelinck, G.H.

    2012-01-01

    We present a top emitting monochrome AMOLED display with 85dpi resolution using an amorphous Indium-Gallium-Zinc-Oxide (IGZO) TFT backplane on PEN-foil. Maximum processing temperature was limited to 150 °C in order to ensure an overlay accuracy < 3μm on PEN foil. The backplane process flow is based

  17. Rap van tong, scherp van pen. Literaire discussiecultuur in Nederlandse praatjespamfletten (circa 1600-1750)

    Dingemanse, C.W.

    2008-01-01

    In the early modern period pamphlets constituted the most important medium to influence public opinion in the Netherlands. The thesis Rap van tong, scherp van pen (Glib tongues, sharp pens) focuses on the literary and rhetorical aspects of a remarkable type of pamphlet called praatje (small-talk),

  18. Ecosystem Pen Pals: Using Place-Based Marine Science and Culture to Connect Students

    Wiener, Carlie S.; Matsumoto, Karen

    2014-01-01

    The marine environment provides a unique context for students to explore both natural and cultural connections. This paper reports preliminary findings on Ecosystem Pen Pals, an ocean literacy program for 4th and 5th graders focused on using a pen pal model for integrating traditional ecological knowledge into marine science. Surveys with…

  19. Pen-Enabled, Real-Time Student Engagement for Teaching in STEM Subjects

    Urban, Sylvia

    2017-01-01

    The introduction of pen-enabling devices has been demonstrated to increase a student's ability to solve problems, communicate, and learn during note taking. For the science, technology, engineering, and mathematics subjects that are considered to be symbolic in nature, pen interfaces are better suited for visual-spatial content and also provide a…

  20. Dynamic monitoring of weight data at the pen vs at the individual level

    Jensen, Dan; Toft, Nils; Kristensen, A. R. K.

    recorded weight data from finisher pigs. Data are collected at insertion and at the exit of the first pigs in the pen, and in few pens, the weight is recorded weekly. Dynamic linear models are fitted on the weight data, at the pig level (univariate), at the double pen level using averaged weight...... (univariate) and using individual pig values as parameters in a hierarchical (multivariate) model including section, double pen, and individual level. Variance components of the different models are estimated using the Expectation Maximization algorithm. The difference of information obtained...... at the individual vs pen level is thereafter assessed. Whereas weight data is usually monitored after a batch is being sent to the slaughter house, this method provides weekly updating of the data. Perspectives of application include dynamic monitoring of weight data in relation to events such as diarrhoea, tail...

  1. Dynamic monitoring of weight data at the pen vs at the individual level

    Jensen, Dan Børge; Toft, Nils; Kristensen, Anders Ringgaard

    recorded weight data from finisher pigs. Data are collected at insertion and at the exit of the first pigs in the pen, and in few pens, the weight is recorded weekly. Dynamic linear models are fitted on the weight data, at the pig level (univariate), at the double pen level using averaged weight...... (univariate) and using individual pig values as parameters in a hierarchical (multivariate) model including section, double pen, and individual level. Variance components of the different models are estimated using the Expectation Maximization algorithm. The difference of information obtained...... at the individual vs. pen level is thereafter assessed. Whereas weight data is usually monitored after a batch is being sent to the slaughter house, this method provides with weekly updating of the data. Perspectives of application include dynamic monitoring of weight data in relation to events such as diarrhoea...

  2. Essential Characteristics of Plasma Antennas Filled with He-Ar Penning Gases

    Sun Naifeng; Li Wenzhong; Wang Shiqing; Li Jian; Ci Jiaxiang

    2012-01-01

    Based on the essential theory of Penning gases, the discharge characteristics of He-Ar Penning gases in insulating tubes were analyzed qualitatively. The relation between the effective length of an antenna column filled with He-Ar Penning gases and the applied radio frequency (RF) power was investigated both theoretically and experimentally. The distribution of the plasma density along the antenna column in different conditions was studied. The receiving characteristics of local frequency modulated (FM) electromagnetic waves by the plasma antenna filled with He-Ar Penning gases were compared with those by an aluminum antenna with the same dimensions. Results show that it is feasible to take plasma antennas filled with He-Ar Penning gases as receiving antennas.

  3. Increasing viscosity and inertia using a robotically-controlled pen improves handwriting in children

    Ben-Pazi, Hilla; Ishihara, Abraham; Kukke, Sahana; Sanger, Terence D

    2010-01-01

    The aim of this study was to determine the effect of mechanical properties of the pen on the quality of handwriting in children. Twenty two school aged children, ages 8–14 years wrote in cursive using a pen attached to a robot. The robot was programmed to increase the effective weight (inertia) and stiffness (viscosity) of the pen. Speed, frequency, variability, and quality of the two handwriting samples were compared. Increased inertia and viscosity improved handwriting quality in 85% of children (pHandwriting quality did not correlate with changes in speed, suggesting that improvement was not due to reduced speed. Measures of movement variability remained unchanged, suggesting that improvement was not due to mechanical smoothing of pen movement by the robot. Since improvement was not explained by reduced speed or mechanical smoothing, we conclude that children alter handwriting movements in response to pen mechanics. Altered movement could be caused by changes in proprioceptive sensory feedback. PMID:19794098

  4. Commissioning of the double Penning trap system MLLTRAP

    Kolhinen, V.S.; Bussmann, M.; Gartzke, E.; Habs, D.; Neumayr, J.B.; Schuermann, C.; Szerypo, J.; Thirolf, P.G.

    2009-01-01

    A cylindrical double Penning trap system has been installed and commissioned at the Maier-Leibnitz-Laboratory (MLL) in Garching. This trap system has been designed to isobarically purify low-energy ion beams and perform highly accurate mass measurements. Technical details of the device and the first results of the commissioning measurements will be presented. The mass resolving power achieved in the first trap for 85 Rb ions is R=139(2)x10 3 , while a relative mass uncertainty of δm/m=2.9x10 -8 was reached with the second trap (no analysis of systematic uncertainties included) when using 87 Rb as a reference ion for 85 Rb.

  5. Commissioning of the double Penning trap system MLLTRAP

    Kolhinen, V.S. [Fakultaet fuer Physik, LMU Muenchen and Maier-Leibnitz Laboratory, Am Coulombwall 1, 85748 Garching (Germany)], E-mail: veli.kolhinen@physik.uni-muenchen.de; Bussmann, M. [Fakultaet fuer Physik, LMU Muenchen and Maier-Leibnitz Laboratory, Am Coulombwall 1, 85748 Garching (Germany); Forschungszentrum Dresden-Rossendorf, 01314 Dresden (Germany); Gartzke, E.; Habs, D.; Neumayr, J.B.; Schuermann, C.; Szerypo, J.; Thirolf, P.G. [Fakultaet fuer Physik, LMU Muenchen and Maier-Leibnitz Laboratory, Am Coulombwall 1, 85748 Garching (Germany)

    2009-03-01

    A cylindrical double Penning trap system has been installed and commissioned at the Maier-Leibnitz-Laboratory (MLL) in Garching. This trap system has been designed to isobarically purify low-energy ion beams and perform highly accurate mass measurements. Technical details of the device and the first results of the commissioning measurements will be presented. The mass resolving power achieved in the first trap for {sup 85}Rb ions is R=139(2)x10{sup 3}, while a relative mass uncertainty of {delta}m/m=2.9x10{sup -8} was reached with the second trap (no analysis of systematic uncertainties included) when using {sup 87}Rb as a reference ion for {sup 85}Rb.

  6. Nested Penning Trap as a Source of Singly Charged Ions

    Ordonez, C.A.

    2003-01-01

    In the work reported, the possibility of using a nested Penning trap as a high purity source of low-charge-state ions is studied. For the configuration considered, a relatively dense ion plasma is confined by a three-dimensional electric potential well. The three-dimensional well is produced by the electric field generated by both the trap electrodes and a trapped electron plasma. The ion and electron plasmas are each considered to have Maxwellian velocity distributions. However, it is shown that the electron plasma must have a temperature that is higher than that of the ion plasma when the ions have low charge states. The work reported includes a self-consistent prediction of a possible plasma equilibrium

  7. The Penning trap system used by the BASE experiment

    Marcastel, Fabienne

    2015-01-01

    A cut-away schematic of the Penning trap system used by BASE. The experiment receives antiprotons from CERN's AD; negative hydrogen ions are formed during injection into the apparatus. The set-up works with only a pair of particles at a time, while a cloud of a few hundred others are held in the reservoir trap, for future use. Here, an antiproton is in the measurement trap, while the negative hydyrogen ion is in held by the downstream park electrode. When the antiproton has been measured, it is moved to the upstream park electrode and the hydrogen ion is brought in to the measurement trap. This is repeated thousands of times, enabling a high-precision comparison of the charge-to-mass ratios of the two particles.

  8. Recent results from the Penning trap mass spectrometer JYFLTRAP

    Weber, Christine; Elomaa, Viki-Veikko; Eronen, Tommi; Hakala, Jani; Jokinen, Ari; Kankainen, Anu; Rahaman, Saidur; Rissanen, Juho; Aeystoe, Juha [Department of Physics, (YFL), University of Jyvaeskylae (Finland)

    2009-07-01

    Accurate mass determination employing Penning ion traps has gained increasing importance after the installation of several new on-line facilities at accelerator labs. These setups combine unique production possibilities for rare isotopes with elaborate ion-capture and manipulation techniques. Since the final commissioning of the JYFLTRAP setup at the IGISOL facility in Jyvaeskylae, the masses of more than 200 short-lived nuclides have been measured. Their knowledge applies to studies on nuclear structure, the modeling of nucleosynthesis processes, tests of the conserved vector current (CVC) hypothesis and the unitarity of the CKM matrix, and furthermore, can help to assist in ongoing searches of neutrinoless double-beta decays. This presentation focuses on recent highlights studied at JYFLTRAP.

  9. Bacillus Calmette-Guérin vaccination, thymic size, and thymic output in healthy newborns

    Birk, Nina Marie; Nissen, Thomas Nørrelykke; Zingmark, Vera

    2017-01-01

    Background: The Bacillus Calmette-Guérin vaccine (BCG) has been associated with beneficial nonspecific effects on infant health. We aimed to examine the effect of BCG at birth on thymic size and the associations between thymic output, circulating lymphocytes, risk of infection, and thymic size...... with a large thymic size at birth. Conclusion: We found no effect of BCG vaccination on thymic size. The positive association between thymic output, lymphocytes, reduced risk of infections, and TI/TWI suggests that assessment of TI/TWI by ultrasound may be a predictor of the immunological capacity...... in the newborn....

  10. Guía para restricción física de fauna silvestre

    Torres-Chaparro, María Yanneth; Quintero-Sánchez, Vladimir

    2016-01-01

    Esta guía presenta los protocolos y actividades que deben realizarse durante la manipulación de fauna silvestre en los Centros de Atención y Valoración (CAV). Como bien es sabido, el tráfico de fauna silvestre es una actividad ilícita que trae consigo unos problemas profundos de pérdida de biodiversidad. Dentro de las estrategias de control de tráfico de fauna se realizan actividades de control y monitoreo, presentándose situaciones en las cuales un gran número de animales son rescatados, dec...

  11. Guías de viaje 2.0: léxico y metadiscurso

    Giovanna Mapelli

    2016-04-01

    Full Text Available La guía de viaje se ha ido configurando como un género textual propio del ámbito del turismo, bien codificado y fácilmente reconocible (Baider et al., 2004; Antelmi et al., 2007, y caracterizado por un tono regulativo y un estilo objetivo e impersonal. Sin embargo, en los últimos años el género se ha reconfigurado, debido al desarrollo de la tecnología digital, que ha dado lugar al llamado Turismo 2.0. Por esta razón, se han producido cambios significativos también en las pautas textuales (Calvi y Mapelli, 2011; Sanmartín Sáez, 2012 y en la relevancia cognoscitiva de las informaciones que se transmiten (Yus Ramos, 2010. Asimismo, han nacido nuevas formas de guías en las que el usuario es también emisor de la comunicación turística dirigida a otros viajeros. Esta “recontextualización” (Linell, 1998 ha originado nuevos géneros “fronterizos” en los que se rompen los esquemas tradicionales: se mezclan rasgos preexistentes en nuevas combinaciones (Calvi, 2010, los miembros de la comunidad de viajeros cooperan entre ellos, y los contenidos se disuelven en microunidades informativas. En este trabajo, se pretende estudiar, cuantitativa y cualitativamente, el léxico y los aspectos interpersonales del metadiscurso (Hyland, 2005 en un corpus heterogéneo y representativo (Biber et al., 1998 de las diferentes tipologías de guía 2.0. Se comparará este nuevo formato con las guías tradicionales (Mapelli y Piccioni, 2011 y con otros materiales informativos de tipo promocional, con el objetivo de perfilar su identidad genérica. El corpus está formado por medio millón palabras y para su análisis se recurrirá al programa AntConc 3.2.4 (Anthony, 2014.

  12. Guías clinicas de RCP y SRI enfermería

    Donis Mulero, Elena

    2015-01-01

    La reanimación cardiopulmonar (RCP) es un procedimiento de emergencia para salvar vidas que se lleva a cabo cuando una persona se encuentra en parada cardiorrespiratoria (PCR). Tanto la técnica de RCP como la de intubación, son aspectos olvidados por los profesionales de la salud. Recopilar las últimas recomendaciones sobre RCP para poder elaborar un programa sencillo enfocado a la enfermería. Elaborar una guía sencilla de secuencia rápida de intubación (SRI). Revisión bibliográfica en la que...

  13. Guía de uso de la base de datos SPORTDiscus (EBSCOhost)

    Biblioteca de la Universidad de Málaga

    2014-01-01

    Guía de uso de la base de datos SPORTDiscus en la versión de EBSCOHost. Es una base de datos referencial de cobertura internacional gestionada por el SIRC (Sport Information Resource Centre de Canada). Ofrece información sobre: medicina deportiva, fisioterapia, rehabilitación, biomecánica, kinesiología, ciencia del movimiento, fisiología del ejercicio, técnicas de entrenamiento, personas discapacitadas, educación física, psicología del deporte y el ejercicio, fármacos, salud, e...

  14. Los líderes en las empresas como guías del conocimiento.

    Jorge Pila Prieto

    2006-03-01

    Full Text Available Nuestro trabajo realiza una reflexión sobre la función del Líder en cualquier empresa o centro de estudios en el cual se tomen sus aspectos mas especifico para cualquier directivo, sirviendo de guía al resto de sus trabajadores, de esta forma puede servir a cualquier problema presentado en cualquier lugar y desarrollar un clima laboral y organizacional en la empresa y porque no en el aula donde los docentes interpreten este trabajo y sientan, ante todo realizar los cambios que tanto se solicitan para un perfeccionamiento tanto empresarial como de la dirección del proceso docente-educativo.

  15. A redesigned follitropin alfa pen injector for infertility: results of a market research study

    Abbotts C

    2011-06-01

    Full Text Available Carole Abbotts1, Cristiana Salgado-Braga2, Céline Audibert-Gros31Pharmaceutical Marketing Research Consultancy, London, UK; 2Fertility and Endocrinology Global Business Unit, 3Business Intelligence, Merck Serono SA, Geneva, SwitzerlandBackground: The purpose of this study was to evaluate patient-learning and nurse-teaching experiences when using a redesigned prefilled, ready-to-use follitropin alfa pen injector.Methods: Seventy-three UK women of reproductive age either administering daily treatment with self-injectable gonadotropins or about to start gonadotropin treatment for infertility (aged 24–47 years; 53 self-injection-experienced and 20 self-injection-naïve and 28 nurses from UK infertility clinics were recruited for the study. Following instruction, patients and nurses used the redesigned follitropin alfa pen to inject water into an orange and completed questionnaires to evaluate their experiences with the pen immediately after the simulated injections.Results: Most (88%, n = 64 patients found it easy to learn how to use the pen. Among injection-experienced patients, 66% (n = 35 agreed that the redesigned pen was easier to learn to use compared with their current method and 70% (n = 37 also said they would prefer its use over current devices for all injectable fertility medications. All nurses considered the redesigned pen easy to learn and believed it would be easy to teach patients how to use. Eighty-six percent (n = 24 of the nurses thought it was easy to teach patients to determine the remaining dose to be dialed and injected in a second pen if the initial dose was incomplete. Compared with other injection devices, 96% (n = 27 thought it was "much easier" to "as easy" to teach patients to use the redesigned pen. Based on ease of teaching, 68% (n = 19 of nurses would choose to teach the pen in preference to any other injection method. Almost all (93%, n = 26 nurses considered that having the same pen format for a range of

  16. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  17. Phase II Practice-based Evidence in Nutrition (PEN) evaluation: interviews with key informants.

    Bowden, Fran Martin; Lordly, Daphne; Thirsk, Jayne; Corby, Lynda

    2012-01-01

    Dietitians of Canada has collaborated with experts in knowledge translation and transfer, technology, and dietetic practice to develop and implement an innovative online decision-support system called Practice-based Evidence in Nutrition (PEN). A study was conducted to evaluate the perceived facilitators and barriers that enable dietitians to use or prevent them from using PEN. As part of the overall evaluation framework of PEN, a qualitative descriptive research design was used to address the research purpose. Individual, semi-structured telephone interviews with 17 key informants were completed, and the interview transcripts underwent qualitative content analysis. Respondents identified several facilitators of and barriers to PEN use. Facilitators included specificity to dietetics, rigorous/expert review, easy accessibility, current content, credible/secure material, well-organized/easy-to-use material, material that is valuable to practice, and good value for money. Barriers included perceived high cost, fee structuring/cost to students, certain organizational aspects, and a perceived lack of training for pathway contributors. This formative evaluation has indicated areas in which PEN could be improved and strategies to make PEN the standard for dietetic education and practice. Ensuring that PEN is meeting users' knowledge needs is of the utmost importance if dietitians are to remain on the cutting edge of scientific inquiry.

  18. RESEARCHES REGARDING THE MAIN REPRODUCTION INDICATORS DETERMINATED IN SOWS, STAND GESTATION PEN TIPE

    RAMONA UNTARU

    2007-05-01

    Full Text Available Current researches were carried out with the goal to quantisize the lost from the weaning to early gestation at the sows housed in open pen gestation. In this trail we tested two pen types, different not only by size, but also by feeders’ emplacement. The main reproduction indicators that we calculated until the 28 gestation day were the proportion of sows in heat after weaning, the weaning to estrus interval and the gestation rates. The weaning to estrus interval was about 4 to 7 days, most sows were in heat in the day 5 and 6 days after weaning. The percent of heat detection after weaning was 71.42% for the small pens and 70.71% for the big pens (differences statistically non significant, chi test value was 0.983. The gestation rate at 28 days after insemination was 91.62% for the small pens and 94.72% for the large pens (chi test value 0,959, statistically non significant differences. The overpopulation for heat induction and after that chipping animals together in those pens, show that the lost are up to 40.47%, between weaning – day 28 of gestation.

  19. A flexible approach to light pen calibration for a monocular-vision-based coordinate measuring system

    Fu, Shuai; Zhang, Liyan; Ye, Nan; Liu, Shenglan; Zhang, WeiZhong

    2014-01-01

    A monocular-vision-based coordinate measuring system (MVB-CMS) obtains the 3D coordinates of the probe tip center of a light pen by analyzing the monocular image of the target points on the light pen. The light pen calibration, including the target point calibration and the probe tip center calibration, is critical to guarantee the accuracy of the MVB-CMS. The currently used method resorts to special equipment to calibrate the feature points on the light pen in a separate offsite procedure and uses the system camera to calibrate the probe tip center onsite. Instead, a complete onsite light pen calibration method is proposed in this paper. It needs only several auxiliary target points with the same visual features of the light pen targets and two or more cone holes with known distance(s). The target point calibration and the probe tip center calibration are jointly implemented by simply taking two groups of images of the light pen with the camera of the system. The proposed method requires no extra equipment other than the system camera for the calibration, so it is easier to implement and flexible for use. It has been incorporated in a large field-of-view MVB-CMS, which uses active luminous infrared LEDs as the target points. Experimental results demonstrate the accuracy and effectiveness of the proposed method. (paper)

  20. Fast and Simple Forensic Red Pen Ink Analysis Using Ultra-Performance Liquid Chromatography (UPLC)

    Lee, L.C.; Ying, S.L.; Wan Nur Syazwani Wan Mohamad Fuad; Ab Aziz Ishak; Khairul Osman

    2016-01-01

    Ultra-performance liquid chromatography (UPLC) is more effective than high performance liquid chromatography in terms of analysis speed and sensitivity. This paper presents a feasibility study on forensic red pen inks analysis using UPLC. A total of 12 varieties of red ball point pen inks were purchased from selected stationary shop. For each variety, four different individual pens were sampled to provide intra-variability within a particular variety of pen. The proposed approach is very simple that it only involved limited analysis step and chemicals. A total of 144 chromatograms were obtained from red ink entries extracted with 1.5 mL 80 % (v/v) acetonitrile. Peaks originated from pen inks were determined by comparing the chromatograms of both blank paper and blank solvent against that of ink samples. Subsequently, one-way ANOVA was conducted to discriminate all 66 possible pairs for red pen inks. Results showed that the proposed approach giving discriminating power of 95.45 %. The outcome of the study indicates that UPLC could be a fast and simple approach to red ball point pen inks analysis. (author)

  1. Festival Branding – Case Study: The Dragačevo Trumpet Festival in Guča

    Igor Stamenković

    2013-01-01

    Full Text Available The Dragačevo Trumpet Festival in Guča (The Republic of Serbia is a unique competition of folk brass bands in the world and one of the most important events of the overall national creativity and cultural amateurism in Serbia. Therefore, Guča represents an event which is used for branding of tourist offer and musical culture of Serbia at regional and international level. The paper delivers the results of a questionnaire research conducted during the 50th anniversary of The Dragačevo Trumpet Festival in Guča (DTF in August 2010. The results were based on 300 questionnaires. The questionnaire contained, in one of its parts, questions regarding festival branding and influences, i.e. effects which brands (various advertisements of great sponsors and festival donators may produce and thus leave an impression on perception of each visitor as well as on a destination itself.

  2. Contrast media for fluoroscopic examinations of the GI and GU tracts: current challenges and recommendations.

    Federle, Michael P; Jaffe, Tracy A; Davis, Peter L; Al-Hawary, Mahmoud M; Levine, Marc S

    2017-01-01

    One of the significant challenges facing radiologists who perform and interpret studies of the gastrointestinal and genitourinary systems have been periodic interruptions in the availability of barium and iodinated contrast media specially formulated for gastrointestinal (GI) and genitourinary (GU) studies. These interruptions are due to the US Food and Drug Administration's recent requirement for more stringent documentation of the safety and efficacy of contrast media and the consolidation among contrast manufacturers. Therefore, radiologists may be required to recommend an alternative means of evaluation, such as computed tomography, magnetic resonance, or endoscopy, or they may need to substitute a different formulation of a contrast agent not specifically developed for GI or GU use, for example the utilization of an agent designed and marketed for vascular use. This article reviews the current status of fluoroscopic contrast media, and provides suggestions and recommendations for the optimal and alternative use of contrast media formulations.

  3. An audit of Colposcopy referrals from a GU/STD clinic

    Ryan Ailis

    2008-06-01

    Full Text Available Abstract Background Cervical cancer is increasing at 1.5% per year in Ireland with 50% mortality giving 2.2% of all cancer deaths. In the Mid-West region a pilot screening programme has begun to screen all women 25–60 years. 66% of Genitourinary/Sexually transmitted disease (GU/STD clinics' abnormal smears are Methods 221(8.4% patients referred to colposcopy over 4 years were audited. Retrospective analysis was carried out on GU/STD clinic files, hospital files and computer records for biopsy reports. Ethical approval was prospectively granted. Results 2637 smears were carried out from November 1999 – September 2003. 221 patients referred to colposcopy were audited. 1%, 3%, 5% had severe, moderate and, mild dyskaryosis, respectively, on cervical screening while 0.8%, 1.2%, 1.5% had CIN3, CIN2, CIN1 abnormalities, respectively, on biopsy with 3.5% having no abnormality (Cervical Intraepithelial Neoplasia = CIN. 53% referred to colposcopy were Conclusion 2% had high grade lesions. 37% of high grade lesions are Of the high grade lesions 13% had Chlamydia trachomatis (27% of CIN3 and 44% had HPV despite Relative Risks (RR being 0.75 and 1.09 respectively. Older women had higher grade changes. No statistical difference was found for progression, regression and persistence in those over and under 25.

  4. Gu-4 suppresses affinity and avidity modulation of CD11b and improves the outcome of mice with endotoxemia and sepsis.

    TingTing Yan

    Full Text Available BACKGROUND: Systemic leukocyte activation and disseminated leukocyte adhesion will impair the microcirculation and cause severe decrements in tissue perfusion and organ function in the process of severe sepsis. Gu-4, a lactosyl derivative, could selectively target CD11b to exert therapeutic effect in a rat model of severe burn shock. Here, we addressed whether Gu-4 could render protective effects on septic animals. METHODOLOGY/PRINCIPAL FINDINGS: On a murine model of endotoxemia induced by lipopolysaccharide (LPS, we found that the median effective dose (ED50 of Gu-4 was 0.929 mg/kg. In vivo treatment of Gu-4 after LPS challenge prominently attenuated LPS-induced lung injury and decreased lactic acid level in lung tissue. Using the ED50 of Gu-4, we also demonstrated that Gu-4 treatment significantly improved the survival rate of animals underwent sepsis induced by cecal ligation and puncture. By adhesion and transwell migration assays, we found that Gu-4 treatment inhibited the adhesion and transendothelial migration of LPS-stimulated THP-1 cells. By flow cytometry and microscopy, we demonstrated that Gu-4 treatment inhibited the exposure of active I-domain and the cluster formation of CD11b on the LPS-stimulated polymorphonuclear leukocytes. Western blot analyses further revealed that Gu-4 treatment markedly inhibited the activation of spleen tyrosine kinase in LPS-stimulated THP-1 cells. CONCLUSIONS/SIGNIFICANCE: Gu-4 improves the survival of mice underwent endotoxemia and sepsis, our in vitro investigations indicate that the possible underlying mechanism might involve the modulations of the affinity and avidity of CD11b on the leukocyte. Our findings shed light on the potential use of Gu-4, an interacting compound to CD11b, in the treatment of sepsis and septic shock.

  5. GU81, a VEGFR2 antagonist peptoid, enhances the anti-tumor activity of doxorubicin in the murine MMTV-PyMT transgenic model of breast cancer

    Lynn, Kristi D; Udugamasooriya, D Gomika; Roland, Christina L; Castrillon, Diego H; Kodadek, Thomas J; Brekken, Rolf A

    2010-01-01

    Vascular endothelial growth factor (VEGF) is a primary stimulant of angiogenesis under physiological and pathological conditions. Anti-VEGF therapy is a clinically proven strategy for the treatment of a variety of cancers including colon, breast, lung, and renal cell carcinoma. Since VEGFR2 is the dominant angiogenic signaling receptor, it has become an important target in the development of novel anti-angiogenic therapies. We have reported previously the development of an antagonistic VEGFR2 peptoid (GU40C4) that has promising anti-angiogenic activity in vitro and in vivo. In the current study, we utilize a derivative of GU40C4, termed GU81 in therapy studies. GU81 was tested alone or in combination with doxorubicin for in vivo efficacy in the MMTV-PyMT transgenic model of breast cancer. The derivative GU81 has increased in vitro efficacy compared to GU40C4. Single agent therapy (doxorubicin or GU81 alone) had no effect on tumor weight, histology, tumor fat content, or tumor growth index. However, GU81 is able to significantly to reduce total vascular area as a single agent. GU81 used in combination with doxorubicin significantly reduced tumor weight and growth index compared to all other treatment groups. Furthermore, treatment with combination therapy significantly arrested tumor progression at the premalignant stage, resulting in increased tumor fat content. Interestingly, treatment with GU81 alone increased tumor-VEGF levels and macrophage infiltration, an effect that was abrogated when used in combination with doxorubicin. This study demonstrates the VEGFR2 antagonist peptoid, GU81, enhances the anti-tumor activity of doxorubicin in spontaneous murine MMTV-PyMT breast tumors

  6. A multivariate dynamic linear model for early warnings of diarrhea and pen fouling in slaughter pigs

    Jensen, Dan Børge; Toft, Nils; Kristensen, Anders Ringgaard

    2017-01-01

    We present a method for providing early, but indiscriminant, predictions of diarrhea and pen fouling in grower/finisher pigs. We collected data on dispensed feed amount, water flow, drinking bouts frequency, temperature at two positions per pen, and section level humidity from 12 pens (6 double...... a set threshold a sufficient number of times, consecutively. Using this method with a 7 day prediction window, we achieved an area under the receiver operating characteristics curve of 0.84. Shorter prediction windows yielded lower performances, but longer prediction windows did not affect...

  7. Guía práctica para la identificación y manejo de plagas en hortalizas

    Barrios G., Fernando; Gonzalez D., Fernando; Figueroa P., Adalberto

    2010-01-01

    Guía práctica para la identificación y manejo de plagas en hortalizas La guía práctica comprende una descripción de los insectos, ácaros y moluscos que atacan los cultivos hortícolas en nuestro país. Se registraron 33 especies hortícolas pertenecientes a 10 familias botánicas que por su afinidad bioquímica atraen las mismas plagas. Se describieron 52 plagas con las respectivas recomendaciones de manejo. También se presentan las alternativas para un control eficaz con enfoque ecológico....

  8. PyMEs : Guía de comunicación para exportación

    Barandiain, Dolores; Feiteler, Daniela Elizabeth; Longarzo, María Florencia

    2007-01-01

    Esta guía de comunicación está dirigida al empresario PyME que pretende insertarse en la actividad exportadora o que aspira a mejorar dicho proceso. Este material tiene como objetivo aportar herramientas útiles, prácticas y claras vinculadas a la comunicación, entendiendo el concepto como un valor agregado en la gestión de las PyMEs que exportan. Cualquier acción que la empresa realice va a construir un sentido en el destinatario. A partir de aquí, se plantea la Guía de Comunicación para Expo...

  9. Guía clínica de la enfermedad de Pompe de inicio tardío

    Barba-Romero, Miguel A.; Barrot, Emilia; Bautista-Lorite, Juan; Gutiérrez-Rivas, E.; Illa, Isabel; Jiménez, Luis M.; Ley-Martos, Myriam; López de Munain, Adolfo; Pardo, Julio; Pascual-Pascual, Samuel I.; Pérez-López, Jordi; Solera, Jesús; Vílchez-Padilla, Juan J.

    2012-01-01

    Hasta 2006, la enfermedad de Pompe o glucogenosis tipo II era una enfermedad incurable y con tratamiento meramente paliativo. El desarrollo de la terapia de sustitución con la enzima α-glucosidasa recombinante humana ha constituido el primer tratamiento específico para esta enfermedad. El objetivo de esta guía es servir de referencia en el manejo de la variedad de inicio tardío de la enfermedad de Pompe, es decir, la que aparece después del primer año de vida. En la guía, un grupo de exper...

  10. Polymer nanocomposite patterning by dip-pen nanolithography

    Kandemir, Ayse Cagil; Ma, Huan; Reiser, Alain; Spolenak, Ralph; Erdem, Derya

    2016-01-01

    The ultimate aim of this study is to construct polymer nanocomposite patterns by dip-pen nanolithography (DPN). Recent investigations have revealed the effect of the amount of ink (Laplace pressure) on the mechanism of liquid ink writing. In this study it is shown that not only the amount of ink, but also physisorption and surface diffusion are relevant. After a few writing steps, physisorption and surface diffusion outweigh the influence of the amount of ink, allowing consistent patterning governed by dwell times and writing speeds. Polymer matrices can be utilized as a delivery medium to deposit functional particles. DPN patterning of polymer nanocomposites allows for local tuning of the functionality and mechanical strength of the written patterns in high resolution, with the benefit of pattern flexibility. Typically polymer matrices with volatile components are used as a delivery medium for nanoparticle deposition, with subsequent removal of loosely bound matrix material by heating or oxygen plasma. In our study, nanocomposite patterns were constructed, and the differences between polymer and nanocomposite patterning were investigated. Cross-sectional SEM and TEM analysis confirmed that nanoparticles can be deposited with the liquid-polymer ink and are evenly distributed in the polymer matrix. (paper)

  11. Electrostatic modes as a diagnostic in Penning-trap experiments

    Weimer, C.S.; Bollinger, J.J.; Moore, F.L.; Wineland, D.J.

    1994-01-01

    A subset of the electrostatic modes of a cold cloud of electrons, a non-neutral electron plasma, trapped in a Penning trap has been observed and identified using a recent theoretical model. The detection of these modes is accomplished using electronic techniques which could apply to any ion species. The modes are observed in the low-density, low-rotation limit of the cloud where the cloud approaches a two-dimensional charged disk. We observe both axially symmetric and asymmetric drumhead modes. The shape, rotation frequency, and density of the cloud are found in a real-time nondestructive manner by measuring the frequency of these modes. In addition, it is found that radio-frequency sideband cooling compresses the cloud, increasing its density. The ability to measure and control the density of a trapped ion cloud might be useful for experiments on low-temperature ion--neutral-atom collisions, recombination rates, and studies of the confinement properties of non-neutral plasmas

  12. Robot Guided 'Pen Skill' Training in Children with Motor Difficulties.

    Shire, Katy A; Hill, Liam J B; Snapp-Childs, Winona; Bingham, Geoffrey P; Kountouriotis, Georgios K; Barber, Sally; Mon-Williams, Mark

    2016-01-01

    Motor deficits are linked to a range of negative physical, social and academic consequences. Haptic robotic interventions, based on the principles of sensorimotor learning, have been shown previously to help children with motor problems learn new movements. We therefore examined whether the training benefits of a robotic system would generalise to a standardised test of 'pen-skills', assessed using objective kinematic measures [via the Clinical Kinematic Assessment Tool, CKAT]. A counterbalanced, cross-over design was used in a group of 51 children (37 male, aged 5-11 years) with manual control difficulties. Improved performance on a novel task using the robotic device could be attributed to the intervention but there was no evidence of generalisation to any of the CKAT tasks. The robotic system appears to have the potential to support motor learning, with the technology affording numerous advantages. However, the training regime may need to target particular manual skills (e.g. letter formation) in order to obtain clinically significant improvements in specific skills such as handwriting.

  13. Aracnologias - As tecituras de Penélope

    Cristina Stevens

    2009-12-01

    Full Text Available Análise da personagem Penélope, de Homero, e a transformação ousada de Joyce dessa representação clássica da fidelidade feminina em Molly Bloom, a esposa infiel, sexualizada, trivial, lírica. Essas duas personagens são comparadas com sua mais recente recriação em The Penelopiad (2005, da escritora canadense Margaret Atwood. Uma importante categoria analítica dos estudos feministas e de gênero, a questão da voz é enfatizada na presente análise; essa personagem feminina é objeto da narrativa masculina (A Odisseia e Ulisses, mas no romance de Atwood essa personagem é sujeito de sua narrativa, elaborando uma tecitura “penelopeana” transgressora da versão clássica. Focalizaremos também o poder do silêncio na narrativa de autoria feminina, através do monólogo interior de Molly e da voz que fala do mundo dos mortos em The Penelopiad. Os conceitos de “abjeto” e “linguagem semiótica” de Kristeva são base para nosso trabalho, o qual problematiza a aparente imagem de passividade dessas mulheres que buscam o controle sobre suas vidas.

  14. WITCH, a Penning trap for weak interaction studies

    Kozlov, V Yu

    2005-01-01

    This work is the completion of the installation of the WITCH set-up and the first tests and commissioning of it. The first goal of the WITCH experiment is to improve the present limit on a scalar interaction in nuclear $\\beta$-decay by determining the $\\beta$-neutrino angular correlation parameter $a$ via a precise measurement of the shape of the energy spectrum of the recoil ions. The development of the WITCH set-up and its installation at ISOLDE (CERN) were recently completed. The principle of WITCH is based on a combination of a Penning trap to confine the radioactive ions and a retardation spectrometer to probe the energy of the recoil ions resulting from $\\beta$-decays in the trap. Extensive computer simulations show that for a reasonable measurement time a precision on the $a$-parameter of 0.5% can be achieved. This corresponds to an upper limit for the scalar interaction constant Cs/Cv < 9% at 95% C.L. Designing and constructing a set-up as large and complex as the WITCH set-up takes time, several y...

  15. Robot Guided 'Pen Skill' Training in Children with Motor Difficulties.

    Katy A Shire

    Full Text Available Motor deficits are linked to a range of negative physical, social and academic consequences. Haptic robotic interventions, based on the principles of sensorimotor learning, have been shown previously to help children with motor problems learn new movements. We therefore examined whether the training benefits of a robotic system would generalise to a standardised test of 'pen-skills', assessed using objective kinematic measures [via the Clinical Kinematic Assessment Tool, CKAT]. A counterbalanced, cross-over design was used in a group of 51 children (37 male, aged 5-11 years with manual control difficulties. Improved performance on a novel task using the robotic device could be attributed to the intervention but there was no evidence of generalisation to any of the CKAT tasks. The robotic system appears to have the potential to support motor learning, with the technology affording numerous advantages. However, the training regime may need to target particular manual skills (e.g. letter formation in order to obtain clinically significant improvements in specific skills such as handwriting.

  16. Design of electronic pen pocket dosimeter with wireless battery charger

    Abdelwahab, S.A.; Abdelkhalek, K.L.

    2009-01-01

    this paper presents the design of pen-thin electronic pocket dosimeter with high accuracy to measure personal accumulated quantities of gamma rays and the strength of the radiation field and display them on the integrated alphanumerical liquid crystal display (LCD). to overcome the need of removing the micro controller from the PCB to reprogram it , we use in circuit serial programming (ICSP) method which enhances the flexibility of the pocket dosimeter design as it reduces costs of field upgrades, reduces time to market, allows easy calibration of our system during manufacturing and allows adding a unique identification code (ID) to each instrument. the design of this device is based on the PIC16F876 micro controller and powered from two AAA size, 250 m Ah rechargeable batteries. recharging of these batteries is done using wireless charger which is the new trend now in charging devices. the design of this charger is based on the principle of magnetic inductive power transfer by sending the power through an air gap between a transmitting circuit in the attached docking station and receiving circuit which is built in the instrument

  17. Lipid dip-pen nanolithography on self-assembled monolayers

    Gavutis, Martynas; Navikas, Vytautas; Rakickas, Tomas; Vaitekonis, Šarūnas; Valiokas, Ramūnas

    2016-01-01

    Dip-pen nanolithography (DPN) with lipids as an ink enables functional micro/nanopatterning on different substrates at high process speeds. However, only a few studies have addressed the influence of the physicochemical properties of the surface on the structure and phase behavior of DPN-printed lipid assemblies. Therefore, by combining the scanning probe and optical imaging techniques in this work we have analyzed lipid microdomain formation on the self-assembled monolayers (SAMs) on gold as well-defined model surfaces that displayed hydrophilic (protein-repellent) or hydrophobic (protein-adhesive) characteristics. We have found that on the tri(ethylene glycol)-terminated SAM the lipid ink transfer was fast (∼10 –1 μm 3 s −1 ), quasi-linear and it yielded unstable, sparsely packed lipid microspots. Contrary to this, on the methyl-terminated SAM the lipid transfer was ∼20 times slower, nonlinear, and the obtained stable dots of ∼1 μm in diameter consisted of lipid multilayers. Our comparative analysis indicated that the measured lipid transfer was consistent with the previously reported so-called polymer transfer model (Felts et al 2012, Nanotechnology 23 215301). Further on, by employing the observed distinct contrast in the DPN ink behavior we constructed confined lipid microdomains on pre-patterned SAMs, in which the lipids assembled either into monolayer or multilamellar phases. Such microdomains can be further utilized for lipid membrane mimetics in microarray and lab-on-a-chip device formats. (paper)

  18. Testing and Evaluation of a Pen Input Device Using an Inertial/Magnetic Sensor Module

    Drakopoulos, Leonidas

    2008-01-01

    .... Before continuing to evaluate the 3-D writing, a calibration algorithm is implemented for computing the length between the nose of the pen input device and the point where the inertial/magnetic...

  19. penORNL: a parallel Monte Carlo photon and electron transport package using PENELOPE

    Bekar, Kursat B.; Miller, Thomas Martin; Patton, Bruce W.; Weber, Charles F.

    2015-01-01

    The parallel Monte Carlo photon and electron transport code package penORNL was developed at Oak Ridge National Laboratory to enable advanced scanning electron microscope (SEM) simulations on high-performance computing systems. This paper discusses the implementations, capabilities and parallel performance of the new code package. penORNL uses PENELOPE for its physics calculations and provides all available PENELOPE features to the users, as well as some new features including source definitions specifically developed for SEM simulations, a pulse-height tally capability for detailed simulations of gamma and x-ray detectors, and a modified interaction forcing mechanism to enable accurate energy deposition calculations. The parallel performance of penORNL was extensively tested with several model problems, and very good linear parallel scaling was observed with up to 512 processors. penORNL, along with its new features, will be available for SEM simulations upon completion of the new pulse-height tally implementation.

  20. Product Plan of New Generation System Camera "OLYMPUS PEN E-P1"

    Ogawa, Haruo

    "OLYMPUS PEN E-P1", which is new generation system camera, is the first product of Olympus which is new standard "Micro Four-thirds System" for high-resolution mirror-less cameras. It continues good sales by the concept of "small and stylish design, easy operation and SLR image quality" since release on July 3, 2009. On the other hand, the half-size film camera "OLYMPUS PEN" was popular by the concept "small and stylish design and original mechanism" since the first product in 1959 and recorded sale number more than 17 million with 17 models. By the 50th anniversary topic and emotional value of the Olympus pen, Olympus pen E-P1 became big sales. I would like to explain the way of thinking of the product plan that included not only the simple functional value but also emotional value on planning the first product of "Micro Four-thirds System".

  1. Noble-gas ionization in the ion source with Penning effect

    Monchka, D.; Lyatushinskij, A.; Vasyak, A.

    1982-01-01

    By additional use of that the ion source efficiency can be increased the Penning ionization. The results of estimates of certain coefficients for the processes taking place in the plasma ion sources are presented

  2. Comparison between experimental and computational measures of the sample GU3 irradiated in The Goscen NPP reactor; Comparacion entre las medidas experimentales y computacionales de la muestra GU3 irradiada en el reactor Goscen NPP

    Rodriguez Rivada, A.; Tore, C.

    2014-07-01

    For improvement and validation of neutron codes with calculated burning requires experimental measurements of the isotope inventory of irradiated fuel. The quality of these codes of calculation is fundamental to the security of the transport and storage of the same studies. The comparison was conducted between the calculated values and experimental measures MONTEBURNS and SCALE of the sample codes GU3. (Author)

  3. Organizaciones sanitarias integradas: una guía para el análisis

    Ma. Luisa Vázquez Navarrete

    2005-01-01

    Full Text Available En los últimos años se observa una tendencia a abandonar la competencia e introducir políticas que favorezcan la colaboración entre proveedores de salud como vía para mejorar la eficiencia del sistema y la continuidad de la atención sanitaria. Distintos países han desarrollado experiencias con la integración de proveedores para proporcionar el continuo asistencial a una población definida, principalmente en Estados Unidos. En Cataluña han surgido progresivamente organizaciones sanitarias integradas (OSI pero los estudios sobre integración son escasos, a diferencia con los Estados Unidos. Como parte de una investigación que se está llevando a cabo, se desarrolló una guía para el estudio de las OSI catalanas a partir de una revisión sistemática clásica de la literatura y de la elaboración de un marco teórico. La guía propone el análisis del desempeño de las OSI en relación a sus objetivos finales de mejora de la eficiencia y continuidad de la atención mediante el análisis del tipo de integración (a partir de las características clave, de elementos del entorno (existencia de otros proveedores, tipo de mecanismos de pago de la provisión e internos (modelo de gobierno, organización y gestión que influyen la integración. La evaluación de desempeño de las OSI valora las estrategias globales, así como los resultados de coordinación asistencial y eficiencia. Se evalúa la coordinación de la información a través de la red y de la gestión de la atención. El análisis de la eficiencia de la OSI se refiere a la eficiencia técnica y asignativa. El uso de esta guía en el contexto catalán puede requerir adaptación adicional.

  4. Update on insulin treatment for dogs and cats: insulin dosing pens and more

    Thompson A

    2015-04-01

    Full Text Available Ann Thompson,1 Patty Lathan,2 Linda Fleeman3 1School of Veterinary Science, The University of Queensland, Gatton, QLD, Australia; 2College of Veterinary Medicine Mississippi State University, Starkville, MS, USA; 3Animal Diabetes Australia, Melbourne, VIC, Australia Abstract: Insulin therapy is still the primary therapy for all diabetic dogs and cats. Several insulin options are available for each species, including veterinary registered products and human insulin preparations. The insulin chosen depends on the individual patient's requirements. Intermediate-acting insulin is usually the first choice for dogs, and longer-acting insulin is the first choice for cats. Once the insulin type is chosen, the best method of insulin administration should be considered. Traditionally, insulin vials and syringes have been used, but insulin pen devices have recently entered the veterinary market. Pens have different handling requirements when compared with standard insulin vials including: storage out of the refrigerator for some insulin preparations once pen cartridges are in use; priming of the pen to ensure a full dose of insulin is administered; and holding the pen device in place for several seconds during the injection. Many different types of pen devices are available, with features such as half-unit dosing, large dials for visually impaired people, and memory that can display the last time and dose of insulin administered. Insulin pens come in both reusable and disposable options. Pens have several benefits over syringes, including improved dose accuracy, especially for low insulin doses. Keywords: diabetes, mellitus, canine, feline, NPH, glargine, porcine lente

  5. The effect of sex, slaughter weight and weight gains in PEN-AR-LAN ...

    The aim of the study was to determine the effect of sex, body weight and growth rates on basic fattening and slaughter indexes in PEN-AR-LAN fatteners. The research was conducted on 274 PEN-ARLAN hybrid fatteners coming from sows of the Naïma maternal line and was sired by boars of the P-76 meat line. Recorded ...

  6. Extending Penning trap mass measurements with SHIPTRAP to the heaviest elements

    Block, M.; Ackermann, D.; Herfurth, F.; Hofmann, S.; Blaum, K.; Droese, C.; Marx, G.; Schweikhard, L.; Düllmann, Ch. E.; Eibach, M.; Eliseev, S.; Haettner, E.; Plaß, W. R.; Scheidenberger, C.; Heßberger, F. P.; Ramirez, E. Minaya; Nesterenko, D.

    2013-01-01

    Penning-trap mass spectrometry of radionuclides provides accurate mass values and absolute binding energies. Such mass measurements are sensitive indicators of the nuclear structure evolution far away from stability. Recently, direct mass measurements have been extended to the heavy elements nobelium (Z=102) and lawrencium (Z=103) with the Penning-trap mass spectrometer SHIPTRAP. The results probe nuclear shell effects at N=152. New developments will pave the way to access even heavier nuclides.

  7. A Rapid and Sensitive Assay for the Detection of Benzylpenicillin (PenG in Milk.

    Anna Pennacchio

    Full Text Available Antibiotics, such as benzyl-penicillin (PenG and cephalosporin, are the most common compounds used in animal therapy. Their massive and illegal use in animal therapy and prophylaxis inevitably causes the presence of traces in foods of animal origin (milk and meat, which creates several problems for human health. With the aim to prevent the negative impact of β-lactam and, in particular, PenG residues present in the milk on customer health, many countries have established maximum residue limits (MRLs. To cope with this problem here, we propose an effective alternative, compared to the analytical methods actually employed, to quantify the presence of penicillin G using the surface plasmon resonance (SPR method. In particular, the PenG molecule was conjugated to a protein carrier to immunize a rabbit and produce polyclonal antibodies (anti-PenG. The produced antibodies were used as molecular recognition elements for the design of a competitive immune-assay for the detection of PenG by SPR experiments. The detection limit of the developed assay was found to be 8.0 pM, a value much lower than the MRL of the EU regulation limit that is fixed at 12 nM. Thus, our results clearly show that this system could be successfully suitable for the accurate and easy determination of PenG.

  8. Pen confinement of yearling ewes with cows or heifers for 14 days to produce bonded sheep.

    Fredrickson, E L.; Anderson, D M.; Estell, R E.; Havstad, K M.; Shupe, W L.; Remmenga, M D.

    2001-06-01

    Mixed species stocking is commonly a more ecologically sound and efficient use of forage resources than single species stocking, especially in pastures having complex assemblages of forage species. However, in many environments livestock predation on especially smaller ruminants adds an extra challenge to mixed species stocking. When mixed sheep and cattle remain consistently as a cohesive group (flerd), predation risks are lessened, while fencing and herding costs are reduced. To establish a cohesive group (bond), a 30-day bonding period in which young sheep and cattle pairs are penned together is currently recommended. The purpose of this research was to test if a bond could be produced in open field test. Other behaviors were also noted and recorded during the field test. Separation distance did not differ (P=0.973) between the PC and PH treatments; however, separation distance for NC versus NH (Ptime grazing and less time walking than animals not previously penned for 14 days. Penned animals also vocalized less than non-penned animals during the open field test. The bond sheep formed to the bovines was not affected by cow age. These data suggest that inter-specific bond formation using pen confinement can be accomplished within 14 days, representing a 53% savings in time and associated costs when compared to pen confinement lasting 30 days.

  9. Guérir de la folie. La dispute sur la transfusion sanguine (1667-1668)

    Andrault , Raphaële

    2014-01-01

    International audience; La transfusion sanguine guérirait de la folie.  Ainsi, en 1668, "la transfusion du sang d'un veau avait tellement tempéré les fougues et les bouillons du sang d'un fou, qui depuis quatre mois courait jour et nuit tout nu dans les rues de Paris", qu'il en avait retrouvé la raison (J.-B. Denis). La réalité et les implications d'un tel succès thérapeutique se trouvent au cœur de violents échanges polémiques opposant transfuseurs et anti-transfuseurs pendant plus de deux a...

  10. Bacillus Calmette-Guérin vaccination, thymic size, and thymic output in healthy newborns

    Birk, Nina Marie; Nissen, Thomas Nørrelykke; Zingmark, Vera

    2017-01-01

    BACKGROUND: The Bacillus Calmette-Guérin vaccine (BCG) has been associated with beneficial nonspecific effects on infant health. We aimed to examine the effect of BCG at birth on thymic size and the associations between thymic output, circulating lymphocytes, risk of infection, and thymic size...... to age 3 mo were parent-reported. RESULTS: BCG vaccination did not affect thymic size at age 3 mo, measured as TI. At birth, the number of lymphocytes, CD4+ T cells, CD8+ T cells, and RTEs were positively associated with TI and TWI. Furthermore, a reduced risk of infections up to age 3 mo was associated...... with a large thymic size at birth. CONCLUSION: We found no effect of BCG vaccination on thymic size. The positive association between thymic output, lymphocytes, reduced risk of infections, and TI/TWI suggests that assessment of TI/TWI by ultrasound may be a predictor of the immunological capacity...

  11. A new species of genus Chorebus Haliday (Hymenoptera, Alysiinae parasitising Hexomyza caraganae Gu (Diptera, Agromyzidae from NW China

    Tao Li

    2017-03-01

    Full Text Available Chorebus (Stiphrocera hexomyzae sp. n. (Hymenoptera, Braconidae, Alysiinae, Dacnusini is described and illustrated. It was reared from twig galls of Hexomyza caraganae Gu (Diptera, Agromyzidae on Caragana korshinskii Kom. f. (Fabaceae in Ningxia and Inner Mongolia (NW China. A partial key to related or similar Chorebus species is provided.

  12. DVD. Alar Niineväli soovitab : "Läbi hägu" / Alar Niineväli

    Niineväli, Alar

    2007-01-01

    Mängufilm Philip K. Dicki romaani järgi "Läbi hägu" ("A Scanner Darkly") : režissöör Richard Linklater : Ameerika Ühendriigid, 2006. Film on näitlejatega filmitud ja siis kaaderhaaval üleanimeeritud

  13. Eliciting stakeholder values for coral reef management tasks in the Guánica Bay watershed, Puerto Rico

    The EPA is developing a valuation protocol for southwest Puerto Rico that will support the US Coral Reef Task Force’s (USCRTF) Partnership Initiative in the Guánica Bay/Rio Loco (GB/RL) Watershed. The GB/RL watershed is located in southwestern Puerto Rico and includes the urbaniz...

  14. Musicoterapia en personas con demencia: intervenciones no farmacológicas. Guía de orientación

    García Valverde, Esther

    2014-01-01

    Esta guía pretende ofrecer una visión integral de la musicoterapia especializada en personas con demencia, proporcionando estrategias de intervención basadas en la evidencia científica y en la práctica profesional. Va dirigida a musicoterapeutas que intervienen en el ámbito de la enfermedad de Alzheimer y otras demencias.

  15. A-type granites from the Guéra Massif, Central Chad: Petrology, geochemistry, geochronology, and petrogenesis.

    Pham, Ngoc Ha T.; Shellnutt, J. Gregory; Yeh, Meng-Wan; Lee, Tung-Yi

    2017-04-01

    The poorly studied Saharan Metacraton of North-Central Africa is located between the Arabian-Nubian Shield in the east, the Tuareg Shield in the west and the Central African Orogenic Belt in the south. The Saharan Metacraton is composed of Neoproterozoic juvenile crust and the relics of pre-Neoproterozoic components reactivated during the Pan-African Orogeny. The Republic of Chad, constrained within the Saharan Metacraton, comprises a Phanerozoic cover overlying Precambrian basement outcroppings in four distinct massifs: the Mayo Kebbi, Tibesti, Ouaddaï, and the Guéra. The Guéra massif is the least studied of the four massifs but it likely preserves structures that were formed during the collision between Congo Craton and Saharan Metacraton. The Guéra Massif is composed of mostly granitic rocks. The granitoids have petrologic features that are consistent with A-type granite, such as micrographic intergrowth of sodic and potassic feldspar, the presence of sodic- and iron-rich amphibole, and iron-rich biotite. Compositionally, the granitic rocks of the Guéra Massif have high silica (SiO2 ≥ 68.9 wt.%) content and are metaluminous to marginally peraluminous. The rocks are classified as ferroan calc-alkalic to alkali-calcic with moderately high to very high Fe* ratios. The first zircon U/Pb geochronology of the silicic rocks from the Guéra Massif yielded three main age groups: 590 Ma, 570 Ma, 560 Ma, while a single gabbro yielded an intermediate age ( 580 Ma). A weakly foliated biotite granite yielded two populations, in which the emplacement age is interpreted to be 590 ± 10 Ma, whereas the younger age (550 ± 11 Ma) is considered to be a deformation age. Furthermore, inherited Meso- to Paleoproterozoic zircons are found in this sample. The geochemical and geochronology data indicate that there is a temporal evolution in the composition of rocks with the old, high Mg# granitoids shifting to young, low Mg# granitoids. This reveals that the A-type granites in

  16. Guía de viaje y turismo 2.0: Los borrosos confines de un género

    Maria Vittoria Calvi

    2016-04-01

    Full Text Available La guía de viajes se configura como uno de los géneros discursivos más específicos del turismo; entre sus reglas constitutivas se destaca, además del carácter regulativo, el estilo objetivo e impersonal. En las últimas décadas, el advenimiento de la comunicación a través de la Red ha tenido importantes repercusiones en la caracterización de este género, modificando algunos de sus aspectos convencionales. El objetivo de este artículo es el de evaluar las principales transformaciones ocurridas en el género de las guías de viaje en la era del Turismo 2.0, mediante el análisis de algunos ejemplos extraídos de textos turísticos recientes. Ante todo, el entorno virtual modifica la presentación, la distribución y la cantidad de las informaciones que se transmiten; asimismo, se esfuma la frontera entre la guía descriptiva tradicional y los materiales informativos de tipo promocional. Por otra parte, las cualidades sociales de la Web 2.0 crean en el destinatario un nuevo horizonte de expectativas, propiciando la realización de guías “cooperativas”, al explotar la participación de la comunidad de los viajeros. Como consecuencia de estas innovaciones, el estilo objetivo, pretendidamente imparcial, propio de la guía tradicional, se abre a la evaluación subjetiva y al elemento experiencial, ambos procedentes de tradiciones discursivas contiguas (reportaje, literatura de viajes, así como de otros cibergéneros, tales como el foro y el blog, acentuando la hibridación genérica.

  17. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  18. Innovation & evaluation of tangible direct manipulation digital drawing pens for children.

    Lee, Tai-Hua; Wu, Fong-Gong; Chen, Huei-Tsz

    2017-04-01

    Focusing on the theme of direct manipulation, in this study, we proposed a new and innovative tangible user interface (TUI) design concept for a manipulative digital drawing pen. Based on interviews with focus groups brainstorming and experts and the results of a field survey, we selected the most suitable tangible user interface for children between 4 and 7 years of age. Using the new tangible user interface, children could choose between the brush tools after touching and feeling the various patterns. The thickness of the brush could be adjusted by changing the tilt angle. In a subsequent experimental process we compared the differences in performance and subjective user satisfaction. A total of sixteen children, aged 4-7 years participated in the experiment. Two operating system experiments (the new designed tangible digital drawing pen and traditional visual interface-icon-clicking digital drawing pens) were performed at random and in turns. We assessed their manipulation performance, accuracy, brush stroke richness and subjective evaluations. During the experimental process we found that operating functions using the direct manipulation method, and adding shapes and semantic models to explain the purpose of each function, enabled the children to perform stroke switches relatively smoothly. By using direct manipulation digital pens, the children could improve their stroke-switching performance for digital drawing. Additionally, by using various patterns to represent different brushes or tools, the children were able to make selections using their sense of touch, thereby reducing the time required to move along the drawing pens and select icons (The significant differences (p = 0.000, p drawing thick lines using the crayon function of the two (new and old) drawing pens (new 5.8750 drawing operations enhanced the drawing results, thereby increasing the children's enjoyment of drawing with tangible digital drawing pens. Copyright © 2016 Elsevier Ltd. All

  19. Role of penA polymorphisms for penicillin susceptibility in Neisseria lactamica and Neisseria meningitidis.

    Karch, André; Vogel, Ulrich; Claus, Heike

    2015-10-01

    In meningococci, reduced penicillin susceptibility is associated with five specific mutations in the transpeptidase region of penicillin binding protein 2 (PBP2). We showed that the same set of mutations was present in 64 of 123 Neisseria lactamica strains obtained from a carriage study (MIC range: 0.125-2.0mg/L). The PBP2 encoding penA alleles in these strains were genetically similar to those found in intermediate resistant meningococci suggesting frequent interspecies genetic exchange. Fifty-six N. lactamica isolates with mostly lower penicillin MICs (range: 0.064-0.38mg/L) exhibited only three of the five mutations. The corresponding penA alleles were unique to N. lactamica and formed a distinct genetic clade. PenA alleles with no mutations on the other hand were unique to meningococci. Under penicillin selective pressure, genetic transformation of N. lactamica penA alleles in meningococci was only possible for alleles encoding five mutations, but not for those encoding three mutations; the transfer resulted in MICs comparable to those of meningococci harboring penA alleles that encoded PBP2 with five mutations, but considerably lower than those of the corresponding N. lactamica donor strains. Due to a transformation barrier the complete N. lactamica penA could not be transformed into N. meningitidis. In summary, penicillin MICs in N. lactamica were associated with the number of mutations in the transpeptidase region of PBP2. Evidence for interspecific genetic transfer was only observed for penA alleles associated with higher MICs, suggesting that alleles encoding only three mutations in the transpeptidase region are biologically not effective in N. meningitidis. Factors other than PBP2 seem to be responsible for the high levels of penicillin resistance in N. lactamica. A reduction of penicillin susceptibility in N. meningitidis by horizontal gene transfer from N. lactamica is unlikely to happen. Copyright © 2015 Elsevier GmbH. All rights reserved.

  20. Pengembangan Media Ice Breaker Talking Pen pada Mata Pelajaran PAI Kelas X SMAN 100 Jakarta

    Ati Sulastri

    2017-07-01

    Full Text Available This study aims to find out how to develop media ice breaker talking pen and media feasibility on the subjects of PAI. The research method used is Borg and Gall development model which includes requirement analysis, validation test, and test phase. The result of this development research is ice breaker talking pen media product which consists of command card and music developed through data collection, planning, product development, and validation and testing. Based on the validation results obtained the average score of the material experts of 4.75 (very good, and from the media experts of 3.78 (good, and the results of student responses about this media amounted to 4.39 or very good category. Therefore the ice breaker talking media on the eyes of learning PAI class X is declared eligible for use with very good category. Keywords: Development Model  Study, Ice Breaker Talking Pen, PAI Abstrak Penelitian ini bertujuan untuk mengetahui cara mengembangkan media ice breaker talking pen dan kelayakan media tersebut pada mata pelajaran PAI. Metode yang digunakan adalah model pengembangan Borg dan Gall yang meliputi analisis kebutuhan, tahap validasi dan tahap uji coba. Hasil penelitian pengembangan ini adalah produk media ice breaker talking pen yang terdiri dari kartu perintah dan musik yang dikembangkan melalui tahap pengumpulan data, perencanaan, pengembangan produk, serta validasi dan uji coba. Berdasarkan pada hasil validasi didapat skor rata-rata dari ahli materi sebesar 4,75 (sangat baik, dan dari ahli media sebesar 3,78 (baik. Serta hasil dari tanggapan siswa mengenai media ini sebesar 4,39 atau kategori sangat baik. Maka dari itu media ice breaker talking pen pada mata pelajaran PAI kelas X dinyatakan layak untuk digunakan dengan kategori sangat baik. Kata Kunci : Pengembangan Model Pembelajaran, Ice Breaker Talking Pen, PAI

  1. [Preference for etanercept pen versus syringe in patients with chronic arthritis. Nurse education workshop].

    Garcia-Diaz, Silvia; Girabent-Farrés, Montserrat; Roig-Vilaseca, Daniel; Reina, Delia; Cerdà, Dacia; González, Marina; Torrente-Segarra, Vicenç; Fíguls, Ramon; Corominas, Hèctor

    2013-01-01

    The aims of this study are to evaluate the level of fear of post-injection pain prior to the administration, the difficulty in handling the device, and the level of satisfaction of patients using a pre-filled syringe versus an etanercept pen, as well as to evaluate the usefulness of the training given by nursing staff prior to starting with the pen, and the preferences of patients after using both devices. A prospective study was designed to follow-up a cohort of patients during a 6 months period. The data was collected using questionnaires and analyzed with SPSS 18.00. Rank and McNemar tests were performed. Statistical significance was pre-set at an α level of 0.05. A total of 29 patients were included, of whom 69% female, and with a mean age 52.5±10.9 years. Of these, 48% had rheumatoid arthritis, 28% psoriatic arthritis, 21% ankylosing spondylitis, and 3% undifferentiated spondyloarthropathy. There were no statistically significant differences either with the fear or pain or handling of the device between the syringe and the pen (P=.469; P=.812; P=.169 respectively). At 6 months, 59% of patients referred to being satisfied or very satisfied with the pen. Almost all (93%) found useful or very useful the training given by nursing staff prior to using the pen, and 55% preferred the pen over the pre-filled syringe. The etanercept pen is another subcutaneous device option for patients with chronic arthritis. According to the present study, nursing educational workshops before starting this therapy are recommended. Copyright © 2012 Elsevier España, S.L. All rights reserved.

  2. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  3. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  4. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)

    2017-03-01

    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  5. Intravesical Bacillus Calmette-Guérin therapy for murine bladder tumors: initiation of the response by fibronectin-mediated attachment of Bacillus Calmette-Guérin.

    Ratliff, T L; Palmer, J O; McGarr, J A; Brown, E J

    1987-04-01

    Intravesical Bacillus Calmette-Guérin (BCG) is considered to be one of the most effective treatments for superficial bladder cancer. Although the mechanisms by which BCG inhibits tumor growth are not known, previous studies have shown that systemic immunization to BCG and the local expression of the immune response in the bladder are associated with a favorable response to BCG therapy. We have investigated the conditions required for the initiation of an immunological response after the intravesical instillation of BCG. Initial histological studies showed that BCG attached to the bladder wall only in areas where the urothelium was damaged by electrocautery and suggested that attachment was associated with the fibrin clot. Quantitative studies verified the histological observations. Minimal BCG attachment (mean less than 10(2) colony forming units) was observed in normal bladders in contrast with a mean of 1.42 X 10(4) colony forming units/bladder in bladders damaged by electrocautery (10 separate experiments). BCG attachment to the bladder wall was durable since organisms were observed in bladders 48 h after instillation. To investigate the proteins to which BCG attached, we tested the binding of BCG to extracellular matrix and inflammatory proteins which comprise a significant portion of the fibrin clot. BCG bound in vitro to coverslips coated in vivo with extracellular matrix proteins but did not bind to control albumin-coated coverslips. BCG also bound to coverslips coated with purified plasma fibronectin but not to coverslips coated with other purified extracellular matrix proteins including laminin, fibrinogen, and type IV collagen. BCG attachment to coverslips coated with either extracellular matrix proteins or purified fibronectin was inhibited by antibodies specific for fibronectin. Moreover, BCG attachment to cauterized bladders in vivo was inhibited by antifibronectin antibodies. These results demonstrate that fibronectin mediates the attachment of BCG

  6. Microstructural control over soluble pentacene deposited by capillary pen printing for organic electronics.

    Lee, Wi Hyoung; Min, Honggi; Park, Namwoo; Lee, Junghwi; Seo, Eunsuk; Kang, Boseok; Cho, Kilwon; Lee, Hwa Sung

    2013-08-28

    Research into printing techniques has received special attention for the commercialization of cost-efficient organic electronics. Here, we have developed a capillary pen printing technique to realize a large-area pattern array of organic transistors and systematically investigated self-organization behavior of printed soluble organic semiconductor ink. The capillary pen-printed deposits of organic semiconductor, 6,13-bis(triisopropylsilylethynyl) pentacene (TIPS_PEN), was well-optimized in terms of morphological and microstructural properties by using ink with mixed solvents of chlorobenzene (CB) and 1,2-dichlorobenzene (DCB). Especially, a 1:1 solvent ratio results in the best transistor performances. This result is attributed to the unique evaporation characteristics of the TIPS_PEN deposits where fast evaporation of CB induces a morphological evolution at the initial printed position, and the remaining DCB with slow evaporation rate offers a favorable crystal evolution at the pinned position. Finally, a large-area transistor array was facilely fabricated by drawing organic electrodes and active layers with a versatile capillary pen. Our approach provides an efficient printing technique for fabricating large-area arrays of organic electronics and further suggests a methodology to enhance their performances by microstructural control of the printed organic semiconducting deposits.

  7. Using a Computer Module to Teach Use of the EpiPen®

    Amandeep Singh Rai

    2011-11-01

    Full Text Available Background: The medical literature suggests that patients and physicians are deficient in their ability to use a self-injectable epinephrine device (EpiPen® for management of anaphylaxis. This study aims to determine whether a computer module is an effective tool for the instruction of a technical skill to medical trainees. Methods: We conducted a two group comparison study of 35 Post-Graduate Year 1 and 2 Family Medicine residents. Participants were instructed on use of the EpiPen® using either a written module or a computer module. Participants were evaluated on use of the EpiPen® using standardized objective outcome measures by a blinded assessor. Assessments took place prior to and following instruction, using the assigned learning modality. Results: There were 34 participants who completed the study. Both groups demonstrated significant improvement in demonstrating use of the EpiPen® following training (p <0.001 for both. A significant post-training difference favouring the computer module learners over the written module learners was observed (p = 0.035. However, only 53% and 18% of candidates (computer module and written module, respectively were able to correctly perform all of the checklist steps. Conclusion: While our findings suggest computer modules represent an effective modality for teaching use of the EpiPen® to medical trainees, the low number of candidates who were able to perform all the checklist items regardless of modality needs to be addressed.

  8. The Possible Role of Penning Ionization Processes in Planetary Atmospheres

    Stefano Falcinelli

    2015-03-01

    Full Text Available In this paper we suggest Penning ionization as an important route of formation for ionic species in upper planetary atmospheres. Our goal is to provide relevant tools to researchers working on kinetic models of atmospheric interest, in order to include Penning ionizations in their calculations as fast processes promoting reactions that cannot be neglected. Ions are extremely important for the transmission of radio and satellite signals, and they govern the chemistry of planetary ionospheres. Molecular ions have also been detected in comet tails. In this paper recent experimental results concerning production of simple ionic species of atmospheric interest are presented and discussed. Such results concern the formation of free ions in collisional ionization of H2O, H2S, and NH3 induced by highly excited species (Penning ionization as metastable noble gas atoms. The effect of Penning ionization still has not been considered in the modeling of terrestrial and extraterrestrial objects so far, even, though metastable helium is formed by radiative recombination of He+ ions with electrons. Because helium is the second most abundant element of the universe, Penning ionization of atomic or molecular species by He*(23S1 is plausibly an active route of ionization in relatively dense environments exposed to cosmic rays.

  9. Cómo elaborar Guías de Recomendaciones de Autocuidado para Pacientes y Cuidadores (GRAPyC

    Sandra Milena Hernández Zambrano

    2015-12-01

    Full Text Available Objetivo: Obtener una estructura estandarizada para la elaboración y publicación de Guías de Recomendaciones de Autocuidado para Pacientes y Cuidadores siguiendo la metodología de la Investigación Acción Participativa. Metodología: La guía se elabora a partir de tres etapas: Emergencia, Interacción y Modelización. En la emergencia, se identifica y analiza el problema principal que afecta a la población diana, se conforma el equipo elaborador, y se realiza una búsqueda de literatura científica que dé respuesta al problema. En la interacción, se establece un diálogo de saberes entre profesionales y ciudadanos para analizar y seleccionar aquellas recomendaciones que se consideran prioritarias para la población diana; se adaptan al nivel de comprensión y entorno cultural de pacientes o cuidadores y se implementan con el objetivo de evaluar su efectividad. Finalmente, en la modelización, se elabora el documento final, considerando tres elementos: diseño de la guía, contenidos y estructura. Estructura de la guía de recomendaciones: El formato establecido consta de 7 apartados: presentación del documento, información general del problema objeto de la guía, recomendaciones por temáticas, recursos web para pacientes y cuidadores, autores e instituciones que participaron en la elaboración y bibliografía. Utilidad esperada: La información contenida en estas guías se ajustada al lenguaje de los ciudadanos, es rigurosa pero fácil de comprender y favorece la toma de decisiones a partir de las mejores evidencias disponibles. Para las enfermeras clínicas se convierte en un instrumento novedoso orientado al diseño de materiales educativos basados en la evidencia científica.

  10. Guía práctica para la identificación y manejo de plagas en hortalizas Guía práctica para la identificación y manejo de plagas en hortalizas

    Figueroa P. Adalberto; Gonzalez D. Fernando; Barrios G. Fernando

    1986-01-01

    Guía práctica para la identificación y manejo de plagas en hortalizas La guía práctica comprende una descripción de los insectos, ácaros y moluscos que atacan los cultivos hortícolas en nuestro país. Se registraron 33 especies hortícolas pertenecientes a 10 familias botánicas que por su afinidad bioquímica atraen las mismas plagas. Se describieron 52 plagas con las respectivas recomendaciones de manejo. También se presentan las alternativas para un control eficaz con enfoque ecológico.This wo...

  11. An EPR at Penly: an outline from the SFEN to feed the public debate

    Anon.

    2010-01-01

    Penly-3 is the project to build an EPR reactor as a third unit on the Penly site (France). The authors have reviewed 5 reasons to back it: 1) nuclear power is a useful source of energy at the world scale, 2) nuclear power is an adequate solution to meet our future needs of energy, 3) the EPR is at the top of today's nuclear technology, 4) nuclear power is an efficient tool to diminish CO 2 releases, and 5) The EPR is a valuable asset to maintain France in the top group of world actors in the nuclear sector. A public debate will be held soon concerning the Penly-3 project. (A.C.)

  12. Control of the conformations of ion Coulomb crystals in a Penning trap

    Mavadia, Sandeep; Goodwin, Joseph F.; Stutter, Graham; Bharadia, Shailen; Crick, Daniel R.; Segal, Daniel M.; Thompson, Richard C.

    2013-01-01

    Laser-cooled atomic ions form ordered structures in radiofrequency ion traps and in Penning traps. Here we demonstrate in a Penning trap the creation and manipulation of a wide variety of ion Coulomb crystals formed from small numbers of ions. The configuration can be changed from a linear string, through intermediate geometries, to a planar structure. The transition from a linear string to a zigzag geometry is observed for the first time in a Penning trap. The conformations of the crystals are set by the applied trap potential and the laser parameters, and agree with simulations. These simulations indicate that the rotation frequency of a small crystal is mainly determined by the laser parameters, independent of the number of ions and the axial confinement strength. This system has potential applications for quantum simulation, quantum information processing and tests of fundamental physics models from quantum field theory to cosmology. PMID:24096901

  13. A Prototype of Mathematical Treatment of Pen Pressure Data for Signature Verification.

    Li, Chi-Keung; Wong, Siu-Kay; Chim, Lai-Chu Joyce

    2018-01-01

    A prototype using simple mathematical treatment of the pen pressure data recorded by a digital pen movement recording device was derived. In this study, a total of 48 sets of signature and initial specimens were collected. Pearson's correlation coefficient was used to compare the data of the pen pressure patterns. From the 820 pair comparisons of the 48 sets of genuine signatures, a high degree of matching was found in which 95.4% (782 pairs) and 80% (656 pairs) had rPA > 0.7 and rPA > 0.8, respectively. In the comparison of the 23 forged signatures with their corresponding control signatures, 20 of them (89.2% of pairs) had rPA values prototype could be used as a complementary technique to improve the objectivity of signature examination and also has a good potential to be developed as a tool for automated signature identification. © 2017 American Academy of Forensic Sciences.

  14. CRESU studies of electron attachment and Penning ionization at temperatures down to 48 K

    Le Garrec, J.L.; Mitchell, J.B.A.; Rowe, B.R.

    1996-01-01

    The object of the present report is to present results obtained for electron attachment and Penning ionization, obtained with the addition of a Langmuir probe to the measurement apparatus. Measurements of the rate coefficients for electron attachment and Penning ionization are performed using the standard techniques for the flow reactors. Rate coefficients for the Penning ionisation of argon, nitrogen molecule, oxygen molecule by helium metastable are presented. The results obtained concerning the attachment of electrons to SF 6 (non-dissociative), CCl 2 F 2 (producing Cl - ), and CF 3 Br as a function of temperature are presented. The differences observed, and the variation of the value of β below 100 K, provides evidence of the strong influence of the internal state (probably vibrational) of the CF 3 Br molecule on its dissociative attachment

  15. Guía para el diagnóstico, seguimiento y tratamiento de la enfermedad de Fabry

    Pablo Neumann

    2013-10-01

    Full Text Available La enfermedad de Fabry es un trastorno de almacenamiento lisosomal hereditario ligado al cromosoma X, ocasionado por el déficit de la enzima alfa galactosidasa A. El conocimiento sobre esta patología, y en particular su manejo médico, ha progresado notablemente en la última década, incluyendo el desarrollo de su tratamiento específico. La presente guía fue desarrollada por profesionales médicos de diversas especialidades involucrados en la atención de pacientes con enfermedad de Fabry. La discusión y análisis de las evidencias científicas disponibles, sumado a la experiencia de cada uno de los participantes, ha permitido desarrollar los conceptos vertidos en esta guía con el objetivo de brindar una herramienta útil para todos los profesionales que asisten a pacientes con enfermedad de Fabry.

  16. Study on the effect of Huo Xue Bo Gu Pill on secretion of endogenous bFGF after fracture

    Li Qiang; Wang Xiping; Guo E; Ye Liyan; Liu Yingjie

    2006-01-01

    Objective: To study the effect of a Chinese traditional preparation Huo Xue Bo Gu Pill on the serum contents of basic fibroblast growth factor (bFGF) after forearm fractures. Method: Serum bFGF contents were measured (with ELISA) in 62 patients with forearm fractures on d1, d8, d14 and d20 after the accident. Thirty-two of the patients were treated with Huo Xue Bo Gu Pills and thirty patients were not. Results: The serum contents of bFGF on d8 and d14 were significantly higher in the patients treated with the pills than those in patients not treated with the pills (P<0.05). Conclusion: This pill could promote the secretion of endogenous bFGF with proliferation of capillaries at the fracture site. (authors)

  17. Nacjonalizm zwyczajnych ludzi. Etnicy­zowanie tradycji muzycznej na przykładzie festiwalu w Gučy

    Waldemar Kuligowski

    2015-08-01

    In this paper, I discuss a few contradictions in the relationship between tradition, nationalism and music. An excellent example illustrating specific nature of these contradictions is Dragačevski sabor trubača (Guča Trumpet Festival in Guča, Serbia and particular music genre – brass music. In my opinion there are three distinctive discourses/narrations about history and meaning this festival and specific kind of music: dominating Serbian discourse, ‘weak’ Gypsy discourse, and researcher’s discourse. This study is effect an ethnographic fieldwork conducted in 2010 by an author and large group of students from Institute of Ethnology and Cultural Anthropology Adam Mickiewicz University Poznań, Poland.

  18. Dosing Accuracy of Insulin Aspart FlexPens After Transport Through the Pneumatic Tube System.

    Ward, Leah G; Heckman, Michael G; Warren, Amy I; Tran, Kimberly

    2013-01-01

    The purpose of this study was to evaluate whether transporting insulin aspart FlexPens via a pneumatic tube system affects the dosing accuracy of the pens. A total of 115 Novo Nordisk FlexPens containing insulin aspart were randomly assigned to be transported via a pneumatic tube system (n = 92) or to serve as the control (n = 23). Each pen was then randomized to 10 international unit (IU) doses (n = 25) or 30 IU doses (n = 67), providing 600 and 603 doses, respectively, for the pneumatic tube group. The control group also received random assignment to 10 IU doses (n = 6) or 30 IU doses (n = 17), providing 144 and 153 doses, respectively. Each dose was expelled using manufacturer instructions. Weights were recorded, corrected for specific gravity, and evaluated based on acceptable International Organization for Standardization (ISO) dosing limits. In the group of pens transported through the pneumatic tube system, none of the 600 doses of 10 IU (0.0%; 95% CI, 0.0 to 0.6) and none of the 603 doses of 30 IU (0.0%; 95% CI, 0.0 to 0.6) fell outside of the range of acceptable weights. Correspondingly, in the control group, none of the 144 doses at 10 IU (0.0%; 95% CI, 0.0 to 2.5) and none of the 153 doses at 30 IU (0.0%; 95% CI, 0.0 to 2.4) were outside of acceptable ISO limits. Transportation via pneumatic tube system does not appear to compromise dosing accuracy. Hospital pharmacies may rely on the pneumatic tube system for timely and accurate transport of insulin aspart FlexPens.

  19. Cost minimization analysis of different growth hormone pen devices based on time-and-motion simulations

    Kim Jaewhan

    2010-04-01

    Full Text Available Abstract Background Numerous pen devices are available to administer recombinant Human Growth Hormone (rhGH, and both patients and health plans have varying issues to consider when selecting a particular product and device for daily use. Therefore, the present study utilized multi-dimensional product analysis to assess potential time involvement, required weekly administration steps, and utilization costs relative to daily rhGH administration. Methods Study objectives were to conduct 1 Time-and-Motion (TM simulations in a randomized block design that allowed time and steps comparisons related to rhGH preparation, administration and storage, and 2 a Cost Minimization Analysis (CMA relative to opportunity and supply costs. Nurses naïve to rhGH administration and devices were recruited to evaluate four rhGH pen devices (2 in liquid form, 2 requiring reconstitution via TM simulations. Five videotaped and timed trials for each product were evaluated based on: 1 Learning (initial use instructions, 2 Preparation (arrange device for use, 3 Administration (actual simulation manikin injection, and 4 Storage (maintain product viability between doses, in addition to assessment of steps required for weekly use. The CMA applied micro-costing techniques related to opportunity costs for caregivers (categorized as wages, non-drug medical supplies, and drug product costs. Results Norditropin® NordiFlex and Norditropin® NordiPen (NNF and NNP, Novo Nordisk, Inc., Bagsværd, Denmark took less weekly Total Time (p ® Pen (GTP, Pfizer, Inc, New York, New York or HumatroPen® (HTP, Eli Lilly and Company, Indianapolis, Indiana. Time savings were directly related to differences in new package Preparation times (NNF (1.35 minutes, NNP (2.48 minutes GTP (4.11 minutes, HTP (8.64 minutes, p Conclusions Time-and-motion simulation data used to support a micro-cost analysis demonstrated that the pen device with the greater time demand has highest net costs.

  20. El área transdisciplinar en las guías docentes

    Carmen Moral Ruíz

    2016-11-01

    Full Text Available La educación artística sufre una fuerte devaluación, patente en los numerosos cambios legislativos cuya importancia es poco relevante. Se podrían recoger numerosos ejemplos que, a lo largo de la historia, han tomado como base el arte en correlación con la ciencia para el desarrollo del ser humano, comprobándose su importancia y su fuerte relación con el resto de disciplinas que ahora se muestran como principales. Comprender las consecuencias de esta devaluación y proponer una mayor transdisciplinariedad a través de las guías docentes, sería el fin de esta investigación para promover una menor separación de los contenidos en las materias, dando lugar al incremento del aprendizaje significativo, relacionado en mayor medida con la sociedad en la que vivimos, preparando al alumnado para vivir en sociedad y desarrollando todo su potencial creativo.

  1. Fotografía digital: una guía sencilla de actualización

    C.A. Soto-Medina

    2014-03-01

    Full Text Available La fotografía digital se encuentra en un periodo en el que tecnológicamente ha sufrido un gran avance; no sólo las cámaras de hoy capturan imágenes increíbles con muy poca luz, sino que también esta tecnología se ha abaratado hasta estar al alcance de todos. En el campo de la Cirugía Plástica, el llevar un expediente digital fotográfico del paciente quirúrgico de manera ordenada es crucial para poder seguir su evolución. Resulta por lo tanto indispensable estandarizar el lugar y la técnica empleados para fotografiar a los pacientes y así poder obtener imágenes de mayor credibilidad y confiabilidad a lo largo del tiempo. En este trabajo, presentamos una guía de actualización entendible, sencilla, pero a la vez completa, de fotografía digital en base a revisión bibliográfica combinada con la experiencia personal. Creemos que estos conocimientos básicos de fotografía, iluminación y cómputo son necesarios para la práctica diaria de nuestra especialidad.

  2. Latitudinal gradient effect on the wing geometry of Auca coctei (Guérin(Lepidoptera, Nymphalidae

    María-José Sanzana

    2013-12-01

    Full Text Available Latitudinal gradient effect on the wing geometry of Auca coctei (Guérin (Lepidoptera, Nymphalidae. When the environmental conditions change locally, the organisms and populations may also change in response to the selection pressure, so that the development of individuals may become affected in different degrees. There have been only a few studies in which the patterns of wing morphology variation have been looked into along a latitudinal gradient by means of geometric morphometrics. The aim of this work was to assess the morphologic differentiation of wing among butterfly populations of the species Auca coctei. For this purpose, 9 sampling locations were used which are representative of the distribution range of the butterfly and cover a wide latitudinal range in Chile. The wing morphology was studied in a total of 202 specimens of A. coctei (150 males and 52 females, based on digitization of 17 morphologic landmarks. The results show variation of wing shape in both sexes; however, for the centroid size there was significant variation only in females. Females show smaller centroid size at higher latitudes, therefore in this study the Bergmann reverse rule is confirmed for females of A. coctei. Our study extends morphologic projections with latitude, suggesting that wing variation is an environmental response from diverse origins and may influence different characteristics of the life history of a butterfly.

  3. Modulating the internalization of bacille Calmette-Guérin by cathelicidin in bladder cancer cells.

    Choi, Se Young; Kim, Soon-Ja; Chi, Byung Hoon; Kwon, Jong Kyou; Chang, In Ho

    2015-04-01

    To confirm the role of cathelicidin (LL-37) in the internalization of bacille Calmette-Guérin (BCG) into bladder cancer cells. Enzyme-linked immunosorbent assay and reverse transcription polymerase chain reaction analysis evaluated the changes in protein and messenger ribonucleic acid (RNA) expression with BCG incubation after LL-37 pretreatment in 5637 and T24 human bladder cancer cells. The internalization rate was evaluated by a double immunofluorescence assay, and confocal microscopy confirmed the function of LL-37 in BCG internalization. We also investigated the difference in internalization rates and cell viability between LL-37, anti-LL-37 antibody, and LL-37 plus anti-LL-37 antibody. The levels of LL-37 increased after BCG exposure in bladder cancer cells in dose- and time-dependent manners. Increasing LL-37 levels using recombinant LL-37 protein further dose dependently decreased BCG internalization in both cell lines. The internalization rates of BCG after LL-37 instillation were lower compared with the controls, and the internalization rate of BCG after anti-LL-37 antibody instillation was significantly higher compared with the controls in both cell lines (P internalization. Blocking the action of cathelicidin may increase the internalization and effectiveness of BCG in reducing bladder cancer cell proliferation. Copyright © 2015 Elsevier Inc. All rights reserved.

  4. Discovery of a wide planetary-mass companion to the young M3 star GU PSC

    Naud, Marie-Eve; Artigau, Étienne; Malo, Lison; Albert, Loïc; Doyon, René; Lafrenière, David; Gagné, Jonathan; Boucher, Anne [Département de physique and Observatoire du Mont-Mégantic, Université de Montréal, Montréal H3C 3J7 (Canada); Saumon, Didier [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Morley, Caroline V. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Allard, France; Homeier, Derek [Centre de Recherche Astrophysique de Lyon, UMR 5574 CNRS, Université de Lyon, École Normale Supérieure de Lyon, 46 Allée d' Italie, F-69364 Lyon Cedex 07 (France); Beichman, Charles A.; Gelino, Christopher R., E-mail: naud@astro.umontreal.ca [Infrared Processing and Analysis Center, MS 100-22, California Institute of Technology, Pasadena, CA 91125 (United States)

    2014-05-20

    We present the discovery of a comoving planetary-mass companion ∼42'' (∼2000 AU) from a young M3 star, GU Psc, a likely member of the young AB Doradus Moving Group (ABDMG). The companion was first identified via its distinctively red i – z color (>3.5) through a survey made with Gemini-S/GMOS. Follow-up Canada-France-Hawaii Telescope/WIRCam near-infrared (NIR) imaging, Gemini-N/GNIRS NIR spectroscopy and Wide-field Infrared Survey Explorer photometry indicate a spectral type of T3.5 ± 1 and reveal signs of low gravity which we attribute to youth. Keck/Adaptive Optics NIR observations did not resolve the companion as a binary. A comparison with atmosphere models indicates T {sub eff} = 1000-1100 K and log g = 4.5-5.0. Based on evolution models, this temperature corresponds to a mass of 9-13 M {sub Jup} for the age of ABDMG (70-130 Myr). The relatively well-constrained age of this companion and its very large angular separation to its host star will allow its thorough characterization and will make it a valuable comparison for planetary-mass companions that will be uncovered by forthcoming planet-finder instruments such as Gemini Planet Imager and SPHERE 9.

  5. Comportamento de forrageio de Camponotus sericeiventris Guérin, 1838 (Hymenoptera, Formicidae em ambiente urbano

    Thiago Elisei

    2012-07-01

    Abstract. Camponotus sericeiventris Guérin are described as omnivorous, their diet including floral and extrafloral nectar, exudates of hemipteran and lepidopteran, prey, seed and fruit foraged in the environment. The aim of this study was to examine the foraging behavior of C. sericeiventris, correlating the foraging activity and climatic factors as well as quantify and identify the resources exploited by the species and time of the foraging and action range. The specie studied was influenced positively by variations in the temperature. In most of the returns (94.81%, n = 7,072 the ants did not carry a load visible. Only 5.19% (n = 387 of the returns were identified and distributed as feces (35.40%, n = 137, animal protein (27.65%, n = 107 and vegetable fiber (36, 95%, n = 143. Two foraging trails, from colony to trees where ants were seeking resources, were measured (73 and 86 m representing an average of the distance of 79.5 ± 9.19 m, resulting in 19,596 m² of colony action. The duration of foraging of the C. sericeiventris had an average of 67 ± 16’97’’ (37’03’’- 101’ minutes. The results of this study provide important insights into understanding the dynamics of foraging activity of the C. sericeiventris in the human environment. Moreover, it shows the interaction of this specie with the environmental.

  6. The immunological effect of revaccination with Bacille Calmette-Guérin vaccine at 19 months of age

    Andersen, Andreas; Roth, Adam; Jensen, Kristoffer Jarlov

    2013-01-01

    Bacille Calmette-Guérin (BCG) vaccination has important non-specific immune effects. In a randomized trial in Guinea-Bissau, BCG revaccination was associated with significantly increased survival in children who received diphtheria-tetanus-pertussis (DTP)-booster vaccine before enrolment and in c...... and in children who did not receive micronutrient supplementation (MN). Within the trial we assessed the immunological effects of BCG revaccination....

  7. Sanãtana dharma / René Guénon ; tõlkinud ja kommenteerinud Haljand Udam

    Guénon, René

    2004-01-01

    René Guénoni essee "Sanãtana dharma" ilmus 1949. a. ja uuesti 1989. a. raamatus "Études sur ľhindouisme" lk. 105-116 ja käsitleb mõiste "sanãtana dharma" ja "philosophia perennis" tõlgendusi ja tähendust. Esseele on lisatud põhjalik tõlkijapoolne kommentaar

  8. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.

    2013-01-01

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  9. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)

    2013-12-15

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  10. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Curie Virág

    2014-10-01

    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  11. From Pen-and-Paper Sketches to Prototypes: The Advanced Interaction Design Environment

    Störrle, Harald

    2014-01-01

    Pen and paper is still the best tool for sketching GUIs. How-ever, sketches cannot be executed, at best we have facilitated or animated scenarios. The Advanced User Interaction Environment facilitates turn-ing hand-drawn sketches into executable prototypes.......Pen and paper is still the best tool for sketching GUIs. How-ever, sketches cannot be executed, at best we have facilitated or animated scenarios. The Advanced User Interaction Environment facilitates turn-ing hand-drawn sketches into executable prototypes....

  12. Precise mass measurements of exotic nuclei--the SHIPTRAP Penning trap mass spectrometer

    Herfurth, F.; Ackermann, D.; Block, M.; Dworschak, M.; Eliseev, S.; Hessberger, F.; Hofmann, S.; Kluge, H.-J.; Maero, G.; Martin, A.; Mazzocco, M.; Rauth, C.; Vorobjev, G.; Blaum, K.; Ferrer, R.; Neidherr, D.; Chaudhuri, A.; Marx, G.; Schweikhard, L.; Neumayr, J.

    2007-01-01

    The SHIPTRAP Penning trap mass spectrometer has been designed and constructed to measure the mass of short-lived, radioactive nuclei. The radioactive nuclei are produced in fusion-evaporation reactions and separated in flight with the velocity filter SHIP at GSI in Darmstadt. They are captured in a gas cell and transfered to a double Penning trap mass spectrometer. There, the cyclotron frequencies of the radioactive ions are determined and yield mass values with uncertainties ≥4.5·10 -8 . More than 50 nuclei have been investigated so far with the present overall efficiency of about 0.5 to 2%

  13. A Survey of Pen name semantic Applications in Rumis Sonnets (Ghazals

    Zohre AhmadiPoor anari

    2015-04-01

    Full Text Available Abstract The pen name in sonnet is the poet’s poetic name which most of the poets mention it in their verses. Jalāl ad-Dīn Muhammad Balkhī also known as Jalāl ad-Dīn Rumi lived in 13th-century was a Persian Moslem poet, theologian, and Sufi mystic. He has written more than 3229 sonnets and dedicated to Shams Tabrizi. Thus mentioned, names such “Shams”, “Shams od-Din” and “Shams al-Haq” in the ending lines of his sonnets.    One of the points which could be studied about pen name is study of theme or concepts which are mentioned alongside that. Entirely it has been said that the same theme which comes with the pen name “Shams” in 992 sonnets. In this study, we pay attention to mentioning the poets desired name which is not necessarily the pen name in Rumis’ sonnets, what theme does it carry and what is relationship of it with the previous lines?    Themes which the poets apply in their sonnets beside pen name is mostly what that has been mentioned in the previous lines. However, in times the concept mentioned along side with the pen name is independent from the sonnet concepts, mostly eulogy. Studying Hafiz and Saadi sonnets shows that the most important themes existing are: love declaration, advice, eulogizing and sometimes a mischievous concept.    Rumis’ sonnets are lover-based. Therefore, there is much talk of the lover in the whole sonnet. But in other poet’s sonnets, the lover (the poet is the main theme is the sonnet. The poet may find a way to praise his own poem or stays in his dreamy world and focuses on the romantic feelings. Considering the fact that unlike other poets Rumi has not mentioned his own pen name but his lover “Shams”, the study focuses on the themes which are mentioned by the pen name “Shams” as the following: 1-Eulogy: One third of the Shams pen names are eulogies. The sufist approach has given the lines a special color. The similes and metaphors used for him are heavenly and

  14. Fabrication of a pen-shaped portable biochemical reaction system based on magnetic bead manipulation

    Shikida, Mitsuhiro; Inagaki, Noriyuki; Okochi, Mina; Honda, Hiroyuki; Sato, Kazuo

    2011-01-01

    A pen-shaped platform that is similar to a mechanical pencil is proposed for producing a portable reaction system. A reaction unit, as the key component in the system, was produced by using a heat shrinkable tube. A mechanical pencil supplied by Mitsubishi Pencil Co. Ltd was used as the pen-shaped platform for driving the reaction cylinder. It was actuated using an inchworm motion. We confirmed that the magnetic beads were successfully manipulated in the droplet in the cylinder-shaped reaction units. (technical note)

  15. Assessment of Pen Branch delta and corridor vegetation changes using multispectral scanner data 1992--1994

    1996-01-01

    Airborne multispectral scanner data were used to monitor natural succession of wetland vegetation species over a three-year period from 1992 through 1994 for Pen Branch on the Savannah River Site in South Carolina. Image processing techniques were used to identify and measure wetland vegetation communities in the lower portion of the Pen Branch corridor and delta. The study provided a reliable means for monitoring medium- and large-scale changes in a diverse environment. Findings from the study will be used to support decisions regarding remediation efforts following the cessation of cooling water discharge from K reactor at the Department of Energy's Savannah River Site in South Carolina

  16. CrossRef Space-charge effects in Penning ion traps

    Porobić, T; Breitenfeldt, M; Couratin, C; Finlay, P; Knecht, A; Fabian, X; Friedag, P; Fléchard, X; Liénard, E; Ban, G; Zákoucký, D; Soti, G; Van Gorp, S; Weinheimer, Ch; Wursten, E; Severijns, N

    2015-01-01

    The influence of space-charge on ion cyclotron resonances and magnetron eigenfrequency in a gas-filled Penning ion trap has been investigated. Off-line measurements with View the MathML source using the cooling trap of the WITCH retardation spectrometer-based setup at ISOLDE/CERN were performed. Experimental ion cyclotron resonances were compared with ab initio Coulomb simulations and found to be in agreement. As an important systematic effect of the WITCH experiment, the magnetron eigenfrequency of the ion cloud was studied under increasing space-charge conditions. Finally, the helium buffer gas pressure in the Penning trap was determined by comparing experimental cooling rates with simulations.

  17. Infarto agudo de miocardio. Guía de práctica clínica

    Yanier Coll Muñoz

    2011-08-01

    Full Text Available

    La elaboración de esta Guía de Práctica Clínica se justifica, en primer lugar, por la elevada frecuencia de presentación y mortalidad del infarto agudo del miocardio en la población general. Las enfermedades cardiovasculares constituyen en la actualidad la principal causa de muerte en los países industrializados, y se espera que también lo sean en los países en vías de desarrollo en el año 2020.  La presente guía se refiere a los pacientes que presentan síntomas isquémicos o sus equivalentes, y una elevación persistente del segmento ST en el electrocardiograma, o cambios del electrocardiograma de infradesnivel del ST o de la onda T, compatibles con el diagnóstico de IAM sin elevación del ST. Esta Guía no aborda los elementos relacionados directamente con los procedimientos de intervencionismo coronario percutáneo ni la revascularización miocárdica quirúrgica.

  18. Macroeconomía I. Guía de trabajos prácticos Nº5: el modelo de oferta agregada-demanda agregada

    Gentile, Natacha

    2011-01-01

    Esta guía forma parte de un conjunto de guías de trabajos prácticos, elaboradas para la cátedra de Macroeconomía I de la Facultad de Ciencias Económicas y Sociales de la Universidad Nacional de Mar del Plata, durante los años que me tocó desempeñarme como Jefe de Trabajos Prácticos (años 2007-2011).

  19. Smartphone Versus Pen-and-Paper Data Collection of Infant Feeding Practices in Rural China

    Zhang, Shuyi; Wu, Qiong; van Velthoven, Michelle HMMT; Chen, Li; Car, Josip; Rudan, Igor; Li, Ye; Scherpbier, Robert W

    2012-01-01

    Background Maternal, Newborn, and Child Health (MNCH) household survey data are collected mainly with pen-and-paper. Smartphone data collection may have advantages over pen-and-paper, but little evidence exists on how they compare. Objective To compare smartphone data collection versus the use of pen-and-paper for infant feeding practices of the MNCH household survey. We compared the two data collection methods for differences in data quality (data recording, data entry, open-ended answers, and interrater reliability), time consumption, costs, interviewers’ perceptions, and problems encountered. Methods We recruited mothers of infants aged 0 to 23 months in four village clinics in Zhaozhou Township, Zhao County, Hebei Province, China. We randomly assigned mothers to a smartphone or a pen-and-paper questionnaire group. A pair of interviewers simultaneously questioned mothers on infant feeding practices, each using the same method (either smartphone or pen-and-paper). Results We enrolled 120 mothers, and all completed the study. Data recording errors were prevented in the smartphone questionnaire. In the 120 pen-and-paper questionnaires (60 mothers), we found 192 data recording errors in 55 questionnaires. There was no significant difference in recording variation between the groups for the questionnaire pairs (P = .32) or variables (P = .45). The smartphone questionnaires were automatically uploaded and no data entry errors occurred. We found that even after double data entry of the pen-and-paper questionnaires, 65.0% (78/120) of the questionnaires did not match and needed to be checked. The mean duration of an interview was 10.22 (SD 2.17) minutes for the smartphone method and 10.83 (SD 2.94) minutes for the pen-and-paper method, which was not significantly different between the methods (P = .19). The mean costs per questionnaire were higher for the smartphone questionnaire (¥143, equal to US $23 at the exchange rate on April 24, 2012) than for the pen

  20. 9 CFR 309.7 - Livestock affected with anthrax; cleaning and disinfection of infected livestock pens and driveways.

    2010-01-01

    ...; cleaning and disinfection of infected livestock pens and driveways. 309.7 Section 309.7 Animals and Animal... INSPECTION § 309.7 Livestock affected with anthrax; cleaning and disinfection of infected livestock pens and... followed immediately by a thorough disinfection of the exposed premises by soaking the ground, fences...

  1. Digital assist: A comparison of two note-taking methods (traditional vs. digital pen) for students with emotional behavioral disorders

    Rody, Carlotta A.

    High school biology classes traditionally follow a lecture format to disseminate content and new terminology. With the inclusive practices of No Child Left Behind, the Common Core State Standards, and end-of-course exam requirement for high school diplomas, classes include a large range of achievement levels and abilities. Teachers assume, often incorrectly, that students come to class prepared to listen and take notes. In a standard diploma, high school biology class in a separate school for students with emotional and behavioral disorders, five students participated in a single-subject, alternating treatment design study that compared the use of regular pens and digital pens to take notes during 21 lecture sessions. Behavior measures were threefold between the two interventions: (a) quantity of notes taken per minute during lectures, (b) quantity of notes or notations taken during review pauses, and (c) percent of correct responses on the daily comprehension quizzes. The study's data indicated that two students were inclined to take more lecture notes when using the digital pen. Two students took more notes with the regular pen. One student demonstrated no difference in her performance with either pen type. Both female students took more notes per minute, on average, than the three males regardless of pen type. During the review pause, three of the five students only added notes or notations to their notes when using the regular pen. The remaining two students did not add to their notes. Quiz scores differed in favor of the regular pen. All five participants earned higher scores on quizzes given during regular pen sessions. However, the differences were minor, and recommendations are made for specific training in note-taking, the pause strategy, and digital pen fluency which may produce different results for both note-taking and quiz scores.

  2. Quantification of Tissue Trauma following Insulin Pen Needle Insertions in Skin

    Jensen, Casper Bo; Larsen, Rasmus; Vestergaard, Jacob Schack

    Objective: Within the field of pen needle development, most research on needle design revolves around mechanical tensile testing and patient statements. Only little has been published on the actual biological skin response to needle insertions. The objective of this study was to develop a computa......Objective: Within the field of pen needle development, most research on needle design revolves around mechanical tensile testing and patient statements. Only little has been published on the actual biological skin response to needle insertions. The objective of this study was to develop...... a computational method to quantify tissue trauma based on skin bleeding and immune response. Method: Two common sized pen needles of 28G (0.36mm) and 32G (0.23mm) were inserted into skin of sedated LYD pigs prior to termination. Four pigs were included and a total of 32 randomized needle insertions were conducted...... diameter. Conclusion: A computational and quantitative method has been developed to assess tissue trauma following insulin pen needle insertions. Application of the method is tested by conduction of a needle diameter study. The obtained quantitative measures of tissue trauma correlate positively to needle...

  3. No between-pen transmission of foot-and-mouth disease virus in vaccinated pigs

    Roermund, van H.J.W.; Eblé, P.L.; Jong, de M.C.M.; Dekker, A.

    2010-01-01

    Many studies have shown transmission of foot-and-mouth disease virus (FMDV) within groups of pigs, even when vaccinated, but only limited information is available on transmission between pens. Three new experiments were carried out in two replicates, which consisted of infectious pigs housed in a

  4. Counting on the mental number line to make a move: Sensorimotor ('pen') control and numerical processing

    Sheridan, R.; Rooijen, M. van; Giles, O.; Mushtaq, F.; Steenbergen, B.; Mon-Williams, M.; Waterman, A.H.

    2017-01-01

    Mathematics is often conducted with a writing implement. But is there a relationship between numerical processing and sensorimotor 'pen' control? We asked participants to move a stylus so it crossed an unmarked line at a location specified by a symbolic number (1-9), where number colour indicated

  5. The Pen Branch Project: Restoration of a Forested Wetland in South Carolina

    Randall K. Kolka; Eric A. Nelson; Ronald E. Bonar; Neil C. Dulohery; David Gartner

    1998-01-01

    The Pen Branch Project is a program to restore a forested riparian wetland that has been subject to thermal disturbance caused by nuclear reactor operations at the Department of Energy's (DOE) Savannah River Site (SRS), an 80,200-hectare nuclear facility located in South Carolina. Various levels of thermal discharges to streams located across the US. have occurred...

  6. Effects of straw processing and pen stocking density on holstein dairy heifers: ii) behavior and hygiene

    The effects of pen-stocking density and straw processing on the daily behavior traits and hygiene of Holstein dairy heifers housed in a freestall system are not understood. Our objective was to evaluate these factors in a trial with a 2 × 3 factorial arrangement of straw-processing (GOOD or POOR) an...

  7. Reaction of calves to two flooring materials offered simultaneously in one pen.

    Stefanowska, J.; Swierstra, D.; Smits, A.C.; Berg, van den J.V.; Metz, J.H.M.

    2002-01-01

    Now that group housing is replacing individual crates, so that calves can lie, stand and walk on the pen floor, the quality of the floor for group-housed calves has become the focus of attention. The reaction of two groups of four calves to a double area of floor made from two materials (wooden

  8. Effects of different flooring options in outside pens of hutches on dairy calf growth

    Growth rates of dairy calves may vary due to many different factors, including housing. The objective of this study was to determine if calf growth was affected by different flooring options in the outside penned area of a calf hutch. For this study, 33 hutches were blocked in groups of 3 by locatio...

  9. Structural modifications of swift heavy ion irradiated PEN probed by optical and thermal measurements

    Devgan, Kusum; Singh, Lakhwant; Samra, Kawaljeet Singh

    2013-01-01

    Highlights: • The present paper reports the effect of swift heavy ion irradiation on Polyethylene Naphthalate (PEN). • Swift heavy ion irradiation introduces structural modification and degradation of PEN at different doses. • Lower irradiation doses in PEN result in modification of structural properties and higher doses lead to complete degradation. • Strong correlation between structural, optical, and thermal properties. - Abstract: The effects of swift heavy ion irradiation on the structural characteristics of Polyethylene naphthalate (PEN) were studied. Samples were irradiated in vacuum at room temperature by lithium (50 MeV), carbon (85 MeV), nickel (120 MeV) and silver (120 MeV) ions with the fluence in the range of 1×10 11 –3×10 12 ions cm −2 . Ion induced changes were analyzed using X-ray diffraction (XRD), Fourier transform infra red (FT-IR), UV–visible spectroscopy, thermo-gravimetric analysis (TGA) and differential scanning calorimetry (DSC) techniques. Cross-linking was observed at lower doses resulting in modification of structural properties, however higher doses lead to the degradation of the investigated polymeric samples

  10. Fourier Transform Infrared (FTIR Spectroscopy with Chemometric Techniques for the Classification of Ballpoint Pen Inks

    Muhammad Naeim Mohamad Asri

    2015-12-01

    Full Text Available FTIR spectroscopic techniques have been shown to possess good abilities to analyse ballpoint pen inks. These in-situ techniques involve directing light onto ballpoint ink samples to generate an FTIR spectrum, providing “molecular fingerprints” of the ink samples thus allowing comparison by direct visual comparison. In this study, ink from blue (n=15 and red (n=15 ballpoint pens of five different brands: Kilometrico®, G-Soft®, Stabilo®, Pilot® and Faber Castell® was analysed using the FTIR technique with the objective of establishing a distinctive differentiation according to the brand. The resulting spectra were first compared and grouped manually. Due to the similarities in terms of colour and shade of the inks, distinctive differentiation could not be achieved by means of direct visual comparison. However, when the same spectral data was analysed by Principal Component Analysis (PCA software, distinctive grouping of the ballpoint pen inks was achieved. Our results demonstrate that PCA can be used objectively to investigate ballpoint pen inks of similar colour and more importantly of different brands.

  11. Students’ Attention when Using Touchscreens and Pen Tablets in a Mathematics Classroom

    Chiung-Hui Chiu

    2017-03-01

    Full Text Available Aim/Purpose: The present study investigated and compared students’ attention in terms of time-on-task and number of distractors between using a touchscreen and a pen tablet in mathematical problem-solving activities with virtual manipulatives. Background: Although there is an increasing use of these input devices in educational practice, little research has focused on assessing student attention while using touchscreens or pen tablets in a mathematics classroom. Methodology: A qualitative exploration was conducted in a public elementary school in New Taipei, Taiwan. Six fifth-grade students participated in the activities. Video recordings of the activities and the students’ actions were analyzed. Findings: The results showed that students in the activity using touchscreens maintained greater attention and, thus, had more time-on-task and fewer distractors than those in the activity using pen tablets. Recommendations for Practitioners: School teachers could employ touchscreens in mathematics classrooms to support activities that focus on students’ manipulations in relation to the attention paid to the learning content. Recommendation for Researchers: The findings enhance our understanding of the input devices used in educational practice and provide a basis for further research. Impact on Society: The findings may also shed light on the human-technology interaction process involved in using pen and touch technology conditions. Future Research: Activities similar to those reported here should be conducted using more participants. In addition, it is important to understand how students with different levels of mathematics achievement use the devices in the activities.

  12. Random Walk Model for the Growth of Monolayer in Dip Pen Nanolithography

    Kim, H; Ha, S; Jang, J

    2013-01-01

    By using a simple random-walk model, we simulate the growth of a self-assembled monolayer (SAM) pattern generated in dip pen nanolithography (DPN). In this model, the SAM pattern grows mainly via the serial pushing of molecules deposited from the tip. We examine various SAM patterns, such as lines, crosses, and letters by changing the tip scan speed.

  13. Influence of pen area and trough space on feedlot performance of ...

    performance. There was no advantage in allowing more than 170 mm trough space or more than 5,5 m2 floor area per animal with the conditions and climate under which these trials were conducted ... pen area on feed intake and feedlot performance. A total of 196 dehorned ... Standard deviation (kg). 0,19. 0,18. 0,19. 0,15.

  14. Applicability of surface-enhanced resonance Raman scattering for the direct discrimination of ballpoint pen inks

    Seifar, R.M.; Verheul, J.M.; Ariese, F.; Brinkman, U.A.T.; Gooijer, C.

    2001-01-01

    In situ surface-enhanced resonance Raman spectroscopy (SERRS) with excitation at 685 nm is suitable for the direct discrimination of blue and black ballpoint pen inks on paper. For black inks, shorter excitation wavelengths can also be used. For blue inks, SERRS at 514.5 and 457.9 nm does not

  15. Human factors engineering and design validation for the redesigned follitropin alfa pen injection device.

    Mahony, Mary C; Patterson, Patricia; Hayward, Brooke; North, Robert; Green, Dawne

    2015-05-01

    To demonstrate, using human factors engineering (HFE), that a redesigned, pre-filled, ready-to-use, pre-asembled follitropin alfa pen can be used to administer prescribed follitropin alfa doses safely and accurately. A failure modes and effects analysis identified hazards and harms potentially caused by use errors; risk-control measures were implemented to ensure acceptable device use risk management. Participants were women with infertility, their significant others, and fertility nurse (FN) professionals. Preliminary testing included 'Instructions for Use' (IFU) and pre-validation studies. Validation studies used simulated injections in a representative use environment; participants received prior training on pen use. User performance in preliminary testing led to IFU revisions and a change to outer needle cap design to mitigate needle stick potential. In the first validation study (49 users, 343 simulated injections), in the FN group, one observed critical use error resulted in a device design modification and another in an IFU change. A second validation study tested the mitigation strategies; previously reported use errors were not repeated. Through an iterative process involving a series of studies, modifications were made to the pen design and IFU. Simulated-use testing demonstrated that the redesigned pen can be used to administer follitropin alfa effectively and safely.

  16. Een nieuw voersysteem voor versgras : Netwerk: Vers en veilig in de pens

    Philipsen, A.P.; Duinkerken, van G.

    2006-01-01

    De melkveehouders binnen het netwerk 'Vers en veilig in de pens' staan voor het voeren van vers gras, willen dat graag blijven doen, maar willen liever niet twee maal per dag hoeven te voeren. Daarvoor moet het gras wel langer vers blijven. Nu kan het met een halve dag al warm worden door broei. Het

  17. Evaluation of drop versus trickle-feeding systems for crated or group-penned gestating sows.

    Hulbert, L E; McGlone, J J

    2006-04-01

    A total of 160 gilts were used to evaluate the effects of pen vs. crated housing systems and drop- vs. trickle-fed feeding systems on sow productivity, occurrence of lesions during farrowing and weaning, immune measures, and behavioral responses during 2 consecutive gestation periods. Of the 160 eligible gilts, 117 farrowed in parity 1, and of those, 72 farrowed in parity 2. The gilts were randomly assigned to represent 1 of 4 factorially arranged treatment groups: pen drop-fed, crate drop-fed, pen trickle-fed, or crate trickle-fed. Replicate blocks were used for each parity with 5 sows per block initially in each treatment. At weaning, sows housed in pens had greater (P trickle-feeding system. Lesions scores and all other productivity measures did not differ among treatments. An interaction was observed for percentage of neutrophil phagocytosis (P trickle-fed sows, but in crates, drop-fed sows had a tendency for lower phagocytosis than trickle-fed sows. All other immune measures were not different among treatments. The occurrence of oral-nasal-facial (ONF) behaviors (chewing, rooting, and rubbing) and active behaviors increased, and lying behavior decreased (P trickle-feeding systems. None of the environments evaluated were associated with significant physiological stress responses among the sows. Thus, sows were able to adapt within each environment through behavioral mechanisms without the need to invoke major physiological adjustments.

  18. Studying the variability in the Raman signature of writing pen inks.

    Braz, André; López-López, María; García-Ruiz, Carmen

    2014-12-01

    This manuscript aims to study the inter and intra brand, model and batch variability in the Raman spectral signature among modern pen inks that will help forensic document examiners during the interpretation process. Results showed that most oil-based samples have similar Raman signatures that are characteristic of the Crystal Violet dye, independently of the brand. Exception was the Pilot samples that use Victoria Pure Blue BO instead. This small inter-brand variability makes oil-based pens difficult to discriminate by brand. On the contrary, gel and liquid-based samples use different colorants such as Rhodamine B, Copper Phthalocyanine, Ethyl Violet and Victoria Blue B. No particular pattern was observed regarding the colorants used by each brand, except the Pilot samples that were the only brand using the Victoria Blue B dye, which is a clear distinct feature. Additionally, the intra-brand variability was also large among gel-based Pilot samples. The small spectral differences observed among several batches of Bic Crystal Medium samples demonstrated that changes were introduced in their chemical formula over the years. The intra-batch variability was small and no spectral differences were observed within batches. This manuscript demonstrates the potential of Raman spectroscopy for discriminating pens inks from different brands and models and even, batches. Additionally, the main colorants used in modern pens were also identified. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  19. The mechanical design and simulation of a scaled H⁻ Penning ion source.

    Rutter, T; Faircloth, D; Turner, D; Lawrie, S

    2016-02-01

    The existing ISIS Penning H(-) source is unable to produce the beam parameters required for the front end test stand and so a new, high duty factor, high brightness scaled source is being developed. This paper details first the development of an electrically biased aperture plate for the existing ISIS source and second, the design, simulation, and development of a prototype scaled source.

  20. The mechanical design and simulation of a scaled H- Penning ion source

    Rutter, T.; Faircloth, D.; Turner, D.; Lawrie, S.

    2016-02-01

    The existing ISIS Penning H- source is unable to produce the beam parameters required for the front end test stand and so a new, high duty factor, high brightness scaled source is being developed. This paper details first the development of an electrically biased aperture plate for the existing ISIS source and second, the design, simulation, and development of a prototype scaled source.

  1. Pen size and parity effects on maternal behaviour of Small-Tail Han sheep.

    Lv, S-J; Yang, Y; Dwyer, C M; Li, F-K

    2015-07-01

    The aim of this experiment was to study the effects of pen size and parity on maternal behaviour of twin-bearing Small-Tail Han ewes. A total of 24 ewes were allocated to a 2×2 design (six per pen), with parity (primiparous or multiparous) and pen size (large: 6.0×3.0 m; small: 6.0×1.5 m) as main effects at Linyi University, Shandong Province, China. Behaviour was observed from after parturition until weaning. All ewes were observed for 6 h every 5 days from 0700 to1000 h and from 1400 to 1700 h. Continuous focal animal sampling was used to quantify the duration of maternal behaviours: sucking, grooming and following as well as the frequency of udder accepting, udder refusing and low-pitched bleating. Oestradiol and cortisol concentrations in the faeces (collected in the morning every 5 days) were detected using EIA kits. All lambs were weighed 24 h after parturition and again at weaning at 35 days of age. The small pen size significantly reduced following (Pbehaviour in sheep during lactation. The study is also the first to report on the maternal behaviour of Chinese native sheep breeds (Small-Tail Han sheep), with implications for the production of sheep in China.

  2. Touch the Page and Mimic Me: Evaluation of a Talking-Pen Learning Tool

    Odakura, Abigail

    2013-01-01

    The purpose of this paper is to evaluate the talking-pen device called the Mimic Me, an educational technology product of a large English conversation school in Japan, as an educational learning tool. The product will be reviewed in terms of its developmental appropriateness for the target audience based on current research. Although the Mimic Me…

  3. The role of self-esteem and gender in pen scores and risk-taking ...

    The role of self-esteem and gender in pen scores and risk-taking behaviour of learners in a South African school. ... RTB to some extent but not on the moderation effects of self-esteem (SE) and gender on RTB ... AJOL African Journals Online.

  4. Conversion of Squid Pens to Chitosanases and Proteases via Paenibacillus sp. TKU042

    Chien Thang Doan

    2018-03-01

    Full Text Available Chitosanases and proteases have received much attention due to their wide range of applications. Four kinds of chitinous materials, squid pens, shrimp heads, demineralized shrimp shells and demineralized crab shells, were used as the sole carbon and nitrogen (C/N source to produce chitosanases, proteases and α-glucosidase inhibitors (αGI by four different strains of Paenibacillus. Chitosanase productivity was highest in the culture supernatants using squid pens as the sole C/N source. The maximum chitosanase activity of fermented squid pens (0.759 U/mL was compared to that of fermented shrimp heads (0.397 U/mL, demineralized shrimp shells (0.201 U/mL and demineralized crab shells (0.216 U/mL. A squid pen concentration of 0.5% was suitable for chitosanase, protease and αGI production via Paenibacillus sp. TKU042. Multi-purification, including ethanol precipitation and column chromatography of Macro-Prep High S as well as Macro-Prep DEAE (diethylaminoethyl, led to the isolation of Paenibacillus sp. TKU042 chitosanase and protease with molecular weights of 70 and 35 kDa, respectively. For comparison, 16 chitinolytic bacteria, including strains of Paenibacillus, were investigated for the production of chitinase, exochitinase, chitosanase, protease and αGI using two kinds of chitinous sources.

  5. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  6. The Recombinant Bacille Calmette–Guérin Vaccine VPM1002: Ready for Clinical Efficacy Testing

    Natalie E. Nieuwenhuizen

    2017-09-01

    Full Text Available The only licensed vaccine against tuberculosis (TB, bacille Calmette–Guérin (BCG, protects against severe extrapulmonary forms of TB but is virtually ineffective against the most prevalent form of the disease, pulmonary TB. BCG was genetically modified at the Max Planck Institute for Infection Biology to improve its immunogenicity by replacing the urease C encoding gene with the listeriolysin encoding gene from Listeria monocytogenes. Listeriolysin perturbates the phagosomal membrane at acidic pH. Urease C is involved in neutralization of the phagosome harboring BCG. Its depletion allows for rapid phagosome acidification and promotes phagolysosome fusion. As a result, BCGΔureC::hly (VPM1002 promotes apoptosis and autophagy and facilitates release of mycobacterial antigens into the cytosol. In preclinical studies, VPM1002 has been far more efficacious and safer than BCG. The vaccine was licensed to Vakzine Projekt Management and later sublicensed to the Serum Institute of India Pvt. Ltd., the largest vaccine producer in the world. The vaccine has passed phase I clinical trials in Germany and South Africa, demonstrating its safety and immunogenicity in young adults. It was also successfully tested in a phase IIa randomized clinical trial in healthy South African newborns and is currently undergoing a phase IIb study in HIV exposed and unexposed newborns. A phase II/III clinical trial will commence in India in 2017 to assess efficacy against recurrence of TB. The target indications for VPM1002 are newborn immunization to prevent TB as well as post-exposure immunization in adults to prevent TB recurrence. In addition, a Phase I trial in non-muscle invasive bladder cancer patients has been completed, and phase II trials are ongoing. This review describes the development of VPM1002 from the drawing board to its clinical assessment.

  7. MRI findings of granulomatous prostatitis developing after intravesical Bacillus Calmette–Guérin therapy

    Suzuki, T.; Takeuchi, M.; Naiki, T.; Kawai, N.; Kohri, K.; Hara, M.; Shibamoto, Y.

    2013-01-01

    Aim: To evaluate magnetic resonance imaging (MRI) findings of granulomatous prostatitis (GP) developing after intravesical Bacillus Calmette–Guérin (BCG) therapy. Materials and methods: Ten patients with pathologically proven GP underwent prostatic MRI. Lesion shape and signal intensity (SI) were evaluated on T2-weighted (T2WI), T1WI, and diffusion-weighted imaging (DWI). Results: Polygonal nodular lesions with notches, diffuse lesions, and cystic lesions with mural nodules were seen in two, six, and one patients, respectively. The remaining patient had a diffuse and cystic lesion. All diffuse lesions showed higher SI than muscle on T1WI and higher SI than the normal peripheral zone (PZ) on DWI. On T2WI, six of seven diffuse lesions showed a slightly lower SI than bone marrow and the remaining one lesion was iso-intense. All nodular lesions showed a low SI similar to muscle on T2WI and were iso-intense to muscle on T1WI. On DWI, two each of the four nodular lesions showed slightly lower SI and slightly higher SI than the normal PZ, respectively. All contents within the cyst and mural nodules showed markedly high and low SI on T2WI, respectively. On DWI, all fluids within cysts showed markedly high SI. One each of the mural nodules showed slightly higher SI and slightly lower SI than the normal PZ on DWI. Conclusion: Three main MRI patterns of GP were identified: diffuse, nodular, and cystic with mural nodule; among them, the diffuse type was the most common. Cystic lesions with mural nodules could accompany the lesion

  8. Validación de guías de autoaprendizaje en simulación clínica para estudiantes de enfermería

    Julián Barragán Becerra

    2017-05-01

    Full Text Available Introducción: Las guías de autoaprendizaje constituyen una estrategia pedagógica que permite abordar e integrar conocimientos, actitudes y prácticas de los enfermeros en formación. Objetivo: Validar las guías de autoaprendizaje del laboratorio de procedimientos y simulación del Programa de Enfermería de la Universidad Pedagógica y Tecnológica de Colombia. Materiales y Métodos: Se realizó validez facial y de contenido de 40 guías por comité de expertos con base en la guía de evaluación de material educativo de la Organización Panamericana de la Salud. Resultados: La mitad de las guías requieren ajustes de estructura, presentación e imágenes. Según el juicio de los expertos el 50% de las guías obtuvo una puntuación del índice de validez de contenido (IVC mayor de 0.6, lo cual indica que el proceso de elaboración de diseño y el contenido son pertinentes para el autoaprendizaje de los estudiantes de enfermería; 16 guías correspondieron a puntajes entre 0.64 y 0.8, es decir una validez buena con necesidad de ajustes de los aspectos evaluados y 4 guías obtuvieron IVC superior a 0.8, es decir muy buena validez. Discusión: La evaluación de guías construidas y evaluadas es fundamental para la facilitación del aprendizaje y mejoramiento de habilidades y conocimientos clínicos, tanto para la práctica en escenarios, como para el futuro desempeño profesional. Conclusiones: La validez facial y de contenido de material educativo para el uso actual de la simulación clínica, requiere de evaluación y de procesos metodológicos fundamentados en pedagogías motivadoras en un contexto de aprendizaje autónomo y cercano a la realidad. Cómo citar este artículo: Barragán J, Hernández NE, Medina A. Validación de guías de autoaprendizaje en simulación clínica para estudiantes de enfermería. Rev Cuid. 2017; 8(2: 1582-90. http://dx.doi.org/10.15649/cuidarte.v8i2.377

  9. Effects of lignite application on ammonia and nitrous oxide emissions from cattle pens

    Sun, Jianlei, E-mail: su@unimelb.edu.au [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia); Bai, Mei [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia); Shen, Jianlin [Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha 410125 (China); Griffith, David W.T. [Department of Chemistry, University of Wollongong, NSW 2522 (Australia); Denmead, Owen T. [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia); Hill, Julian [Ternes Agricultural Consulting Pty Ltd, Upwey, VIC 3158 (Australia); Lam, Shu Kee; Mosier, Arvin R. [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia); Chen, Deli, E-mail: delichen@unimelb.edu.au [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia)

    2016-09-15

    Beef cattle feedlots are a major source of ammonia (NH{sub 3}) emissions from livestock industries. We investigated the effects of lignite surface applications on NH{sub 3} and nitrous oxide (N{sub 2}O) emissions from beef cattle feedlot pens. Two rates of lignite, 3 and 6 kg m{sup −2}, were tested in the treatment pen. No lignite was applied in the control pen. Twenty-four Black Angus steers were fed identical commercial rations in each pen. We measured NH{sub 3} and N{sub 2}O concentrations continuously from 4th Sep to 13th Nov 2014 using Quantum Cascade Laser (QCL) NH{sub 3} analysers and a closed-path Fourier Transform Infrared Spectroscopy analyser (CP-FTIR) in conjunction with the integrated horizontal flux method to calculate NH{sub 3} and N{sub 2}O fluxes. During the feeding period, 16 and 26% of the excreted nitrogen (N) (240 g N head{sup −1} day{sup −1}) was lost via NH{sub 3} volatilization from the control pen, while lignite application decreased NH{sub 3} volatilization to 12 and 18% of the excreted N, for Phase 1 and Phase 2, respectively. Compared to the control pen, lignite application decreased NH{sub 3} emissions by approximately 30%. Nitrous oxide emissions from the cattle pens were small, 0.10 and 0.14 g N{sub 2}O-N head{sup −1} day{sup −1} (< 0.1% of excreted N) for the control pen, for Phase 1 and Phase 2, respectively. Lignite application increased direct N{sub 2}O emissions by 40 and 57%, to 0.14 and 0.22 g N{sub 2}O-N head{sup −1} day{sup −1}, for Phase 1 and Phase 2, respectively. The increase in N{sub 2}O emissions resulting from lignite application was counteracted by the lower indirect N{sub 2}O emission due to decreased NH{sub 3} volatilization. Using 1% as a default emission factor of deposited NH{sub 3} for indirect N{sub 2}O emissions, the application of lignite decreased total N{sub 2}O emissions. - Graphical abstract: Lignite application substantially decreased NH{sub 3} emissions from cattle feedlots and increased

  10. Transport of three veterinary antimicrobials from feedlot pens via simulated rainfall runoff.

    Sura, Srinivas; Degenhardt, Dani; Cessna, Allan J; Larney, Francis J; Olson, Andrew F; McAllister, Tim A

    2015-07-15

    Veterinary antimicrobials are introduced to wider environments by manure application to agricultural fields or through leaching or runoff from manure storage areas (feedlots, stockpiles, windrows, lagoons). Detected in manure, manure-treated soils, and surface and ground water near intensive cattle feeding operations, there is a concern that environmental contamination by these chemicals may promote the development of antimicrobial resistance in bacteria. Surface runoff and leaching appear to be major transport pathways by which veterinary antimicrobials eventually contaminate surface and ground water, respectively. A study was conducted to investigate the transport of three veterinary antimicrobials (chlortetracycline, sulfamethazine, tylosin), commonly used in beef cattle production, in simulated rainfall runoff from feedlot pens. Mean concentrations of veterinary antimicrobials were 1.4 to 3.5 times higher in surface material from bedding vs. non-bedding pen areas. Runoff rates and volumetric runoff coefficients were similar across all treatments but both were significantly higher from non-bedding (0.53Lmin(-1); 0.27) than bedding areas (0.40Lmin(-1); 0.19). In keeping with concentrations in pen surface material, mean concentrations of veterinary antimicrobials were 1.4 to 2.5 times higher in runoff generated from bedding vs. non-bedding pen areas. Water solubility and sorption coefficient of antimicrobials played a role in their transport in runoff. Estimated amounts of chlortetracycline, sulfamethazine, and tylosin that could potentially be transported to the feedlot catch basin during a one in 100-year precipitation event were 1.3 to 3.6ghead(-1), 1.9ghead(-1), and 0.2ghead(-1), respectively. This study demonstrates the magnitude of veterinary antimicrobial transport in feedlot pen runoff and supports the necessity of catch basins for runoff containment within feedlots. Crown Copyright © 2015. Published by Elsevier B.V. All rights reserved.

  11. Field-scale evaluation of water fluxes and manure solution leaching in feedlot pen soils.

    García, Ana R; Maisonnave, Roberto; Massobrio, Marcelo J; Fabrizio de Iorio, Alicia R

    2012-01-01

    Accumulation of beef cattle manure on feedlot pen surfaces generates large amounts of dissolved solutes that can be mobilized by water fluxes, affecting surface and groundwater quality. Our objective was to examine the long-term impacts of a beef cattle feeding operation on water fluxes and manure leaching in feedlot pens located on sandy loam soils of the subhumid Sandy Pampa region in Argentina. Bulk density, gravimetric moisture content, and chloride concentration were quantified. Rain simulation trials were performed to estimate infiltration and runoff rates. Using chloride ion as a tracer, profile analysis techniques were applied to estimate the soil moisture flux and manure conservative chemical components leaching rates. An organic stratum was found over the surface of the pen soil, separated from the underlying soil by a highly compacted thin layer (the manure-soil interface). The soil beneath the organic layer showed greater bulk density in the A horizon than in the control soil and had greater moisture content. Greater concentrations of chloride were found as a consequence of the partial sealing of the manure-soil interface. Surface runoff was the dominant process in the feedlot pen soil, whereas infiltration was the main process in control soil. Soil moisture flux beneath pens decreased substantially after 15 yr of activity. The estimated minimum leaching rate of chloride was 13 times faster than the estimated soil moisture flux. This difference suggests that chloride ions are not exclusively transported by advective flow under our conditions but also by solute diffusion and preferential flow. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  12. Preparation and characterisation of irradiated crab chitosan and New Zealand Arrow squid pen chitosan

    Shavandi, Amin; Bekhit, Adnan A.; Bekhit, Alaa El-Din A.; Sun, Zhifa; Ali, M. Azam

    2015-01-01

    The properties of chitosan from Arrow squid (Nototodarus sloanii) pen (CHS) and commercial crab shell (CHC) were investigated using FTIR, DSC, SEM and XRD before and after irradiation at the dose of 28 kGy in the presence or absence of 5% water. Also, the viscosity, deacetylation degree, water and oil holding capacities, colour and antimicrobial activities of the chitosan samples were determined. Irradiation decreased (P < 0.05) the viscosity of CHC from 0.21 to 0.03 Pa s and of CHS from 1.71 to 0.23 Pa s. The inclusion of water had no effect on the viscosity of irradiated chitosan. Irradiation did not affect the degree of deacetylation of CHC, but increased the deacetylation degree of CHS from 72.78 to 82.29% in samples with 5% water. Water and oil holding capacities of CHS (1197.30% and 873.3%, respectively) were higher (P < 0.05) than those found in CHC (340.70% and 264.40%, respectively). The water and oil holding capacities were decreased for both types of chitosan irradiation, but were not affected by the addition of water. Squid pen chitosan was whiter in colour (White Index = 90.06%) compared to CHC (White Index = 83.70%). Generally, the CHC samples (control and irradiated) exhibited better antibacterial activity compared to CHS, but the opposite was observed with antifungal activity. - Highlights: • Chitosan prepared from Arrow squid pens (Nototodarus sloanii). • Chitosan samples were gamma irradiated at 28 kGy. • Squid pen chitosan showed high fat and water uptake capacities compared to crab shell chitosan. • Gamma irradiation enhanced the DDA of squid pen chitosan but not crab shell chitosan.

  13. Carcass traits and meat quality of growing rabbits in pens with and without different multilevel platforms

    M. Martino

    2016-06-01

    Full Text Available The aim of this trial was to determine the effect of the presence of wire or plastic mesh elevated platforms on carcass traits and meat quality characteristics, with particular attention to the oxidative status of growing rabbits. A total of 174 five-week old rabbits were randomly divided into 3 groups with 2 replications (6 pens; 29 rabbits/pen: pens without platforms (NoP with a stocking density of 16 rabbits/m2 and pens with wire-mesh platforms (WP or plastic-mesh platforms (PP that were placed on 2 levels, with a stocking density of 16 rabbits/m2 on the floor or 9.14 rabbits/m2 when the platform were included. At 84 d rabbits were slaughtered. The slaughter traits and Longissimus lumborum (LL physical and chemical compositition were not affected by treatments. Rabbits from the PP group showed the highest retinol and γ-tocotrienol content on LL muscle, whereas the NoP ones showed a higher α-tocotrienol and α-tocopherol level. The absence of platforms led to decreased (P<0.001 thiobarbituric acid-reactive substances values and induced an improvement in n-3 polyunsaturated fatty acids. Levels of linoleic, linolenic and docosahexaenoic acids were equal to those of the WP group (23.45, 3.75, 0.64% in NoP and 22.6, 4.14, 0.53% in WP, respectively but higher than in PP rabbits (20.86, 3.05, 0.45%, respectively. It can be concluded that the pens with elevated platforms provide greater possibilities for movement, which is beneficial from the viewpoint of animal welfare. However, this greater activity influences the oxidative status of the meat, decreasing the antioxidant content and worsening the lipid oxidation of rabbit meat.

  14. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  15. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  16. Chemically stable Au nanorods as probes for sensitive surface enhanced scattering (SERS) analysis of blue BIC ballpoint pens

    Alyami, Abeer; Saviello, Daniela; McAuliffe, Micheal A. P.; Cucciniello, Raffaele; Mirabile, Antonio; Proto, Antonio; Lewis, Liam; Iacopino, Daniela

    2017-08-01

    Au nanorods were used as an alternative to commonly used Ag nanoparticles as Surface Enhanced Raman Scattering (SERS) probes for identification of dye composition of blue BIC ballpoint pens. When used in combination with Thin Layer Chromatography (TLC), Au nanorod colloids allowed identification of the major dye components of the BIC pen ink, otherwise not identifiable by normal Raman spectroscopy. Thanks to their enhanced chemical stability compared to Ag colloids, Au nanorods provided stable and reproducible SERS signals and allowed easy identification of phthalocyanine and triarylene dyes in the pen ink mixture. These findings were supported by FTIR and MALDI analyses, also performed on the pen ink. Furthermore, the self-assembly of Au nanorods into large area ordered superstructures allowed identification of BIC pen traces. SERS spectra of good intensity and high reproducibility were obtained using Au nanorod vertical arrays, due to the high density of hot spots and morphological reproducibility of these superstructures. These results open the way to the employment of SERS for fast screening analysis and for quantitative analysis of pens and faded pens which are relevant for the fields of forensic and art conservation sciences.

  17. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  18. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  19. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  20. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  1. Biodiversité et santé : Tuons-nous les plantes qui peuvent nous guérir

    1 févr. 2011 ... En outre, le déboisement et la désertification, réduisant tant la qualité du bois que la quantité, ont eu des effets néfastes sur la demande, tandis que la ... La popularité des guérisseurs traditionnels et de leurs remèdes repose en partie sur le faible coût des services et des médicaments, affirme Messanvi ...

  2. Guía para la práctica clínica de las enfermedades diarreicas agudas

    Freijoso Santiesteban, Elsie; Cires Pujol, María Miriam; Silva Herrera, Lázaro; Delgado Martínez, Ibis; Riverón Corteguera, Raúl; Ramírez, Margarita

    2003-01-01

    Se presenta una guía para la práctica clínica de las enfermedades diarreicas agudas (EDA), cuyo objetivo principal es el de establecer recomendaciones para el manejo terapéutico de pacientes con EDA. En la misma se abordan las definiciones y causas de las EDA, los objetivos del tratamiento, la evaluación del paciente con diarreas y las características clínico epidemiológicas, así como las consideraciones terapéuticas y tratamientos para las diarreas causadas por diferentes microorganismos.A c...

  3. The Effect of Starspots on Accurate Radius Determination of the Low-Mass Double-Lined Eclipsing Binary Gu Boo

    Windmiller, G.; Orosz, J. A.; Etzel, P. B.

    2010-04-01

    GU Boo is one of only a relatively small number of well-studied double-lined eclipsing binaries that contain low-mass stars. López-Morales & Ribas present a comprehensive analysis of multi-color light and radial velocity curves for this system. The GU Boo light curves presented by López-Morales & Ribas had substantial asymmetries, which were attributed to large spots. In spite of the asymmetry, López-Morales & Ribas derived masses and radii accurate to sime2%. We obtained additional photometry of GU Boo using both a CCD and a single-channel photometer and modeled the light curves with the ELC software to determine if the large spots in the light curves give rise to systematic errors at the few percent level. We also modeled the original light curves from the work of López-Morales & Ribas using models with and without spots. We derived a radius of the primary of 0.6329 ± 0.0026 R sun, 0.6413 ± 0.0049 R sun, and 0.6373 ± 0.0029 R sun from the CCD, photoelectric, and López-Morales & Ribas data, respectively. Each of these measurements agrees with the value reported by López-Morales & Ribas (R 1 = 0.623 ± 0.016 R sun) at the level of ≈2%. In addition, the spread in these values is ≈1%-2% from the mean. For the secondary, we derive radii of 0.6074 ± 0.0035 R sun, 0.5944 ± 0.0069 R sun, and 0.5976 ± 0.0059 R sun from the three respective data sets. The López-Morales & Ribas value is R 2 = 0.620 ± 0.020 R sun, which is ≈2%-3% larger than each of the three values we found. The spread in these values is ≈2% from the mean. The systematic difference between our three determinations of the secondary radius and that of López-Morales & Ribas might be attributed to differences in the modeling process and codes used. Our own fits suggest that, for GU Boo at least, using accurate spot modeling of a single set of multi-color light curves results in radii determinations accurate at the ≈2% level.

  4. Guías para el diagnóstico y tratamiento de acromegalia, prolactinomas y enfermedad de Cushing

    Chih Hao, Chen-Ku

    2004-01-01

    Los tumores hipofisiarios funcionantes más frecuentes son los productores de prolactina (prolactinomas), hormona de crecimiento (acromegalia) y ACTH (síndrome de Cushing). Existe mucha controversia con respecto al diagnóstico y manejo de estas patologías. Este artículo presenta una guía para el diagnóstico y tratamiento de tales tumores hipofisiarios, y ha sido elaborado por la Asociación Costarricense de Endocrinología, Diabetes y Nutrición. La causa más frecuente de acromegalia son los tumo...

  5. THE EFFECT OF STARSPOTS ON ACCURATE RADIUS DETERMINATION OF THE LOW-MASS DOUBLE-LINED ECLIPSING BINARY GU Boo

    Windmiller, G.; Orosz, J. A.; Etzel, P. B.

    2010-01-01

    GU Boo is one of only a relatively small number of well-studied double-lined eclipsing binaries that contain low-mass stars. Lopez-Morales and Ribas present a comprehensive analysis of multi-color light and radial velocity curves for this system. The GU Boo light curves presented by Lopez-Morales and Ribas had substantial asymmetries, which were attributed to large spots. In spite of the asymmetry, Lopez-Morales and Ribas derived masses and radii accurate to ≅2%. We obtained additional photometry of GU Boo using both a CCD and a single-channel photometer and modeled the light curves with the ELC software to determine if the large spots in the light curves give rise to systematic errors at the few percent level. We also modeled the original light curves from the work of Lopez-Morales and Ribas using models with and without spots. We derived a radius of the primary of 0.6329 ± 0.0026 R sun , 0.6413 ± 0.0049 R sun , and 0.6373 ± 0.0029 R sun from the CCD, photoelectric, and Lopez-Morales and Ribas data, respectively. Each of these measurements agrees with the value reported by Lopez-Morales and Ribas (R 1 = 0.623 ± 0.016 R sun ) at the level of ∼2%. In addition, the spread in these values is ∼1%-2% from the mean. For the secondary, we derive radii of 0.6074 ± 0.0035 R sun , 0.5944 ± 0.0069 R sun , and 0.5976 ± 0.0059 R sun from the three respective data sets. The Lopez-Morales and Ribas value is R 2 = 0.620 ± 0.020 R sun , which is ∼2%-3% larger than each of the three values we found. The spread in these values is ∼2% from the mean. The systematic difference between our three determinations of the secondary radius and that of Lopez-Morales and Ribas might be attributed to differences in the modeling process and codes used. Our own fits suggest that, for GU Boo at least, using accurate spot modeling of a single set of multi-color light curves results in radii determinations accurate at the ∼2% level.

  6. Guía de actividades manuales y grafoplásticas para maestros/as hospitalarias Activ Arte.

    Villavicencio Alzamora, Ana Lucía

    2011-01-01

    El presente producto llamado Guía de Actividades Manuales y Grafoplásticas para Maestros/as Hospitalarias “ActivArte”, radica en la importancia de ofrecer una educación y ayuda los niños/as que se encuentran hospitalizados, con la adaptación de una pedagogía adecuada para ellos, definida como Pedagogía Hospitalaria. La Pedagogía Hospitalaria, debe proporcionar bienestar emocional al niño y a la familia, disminuyendo la ansiedad, mejorando su adaptación y ajuste a la hospitaliza...

  7. Mycotic Aneurysm after Bacillus Calmette-Guérin Treatment: Case Report and Review of the Literature

    Nathaniel D. Coddington

    2017-01-01

    Full Text Available Background. Intravesicular Bacillus Calmette-Guérin (BCG is an effective adjunctive therapy for superficial bladder cancer that has been shown to delay recurrence and progression of disease. Serious side effects are relatively rare but are difficult to diagnosis and commonly overlooked. Case Presentation. We report the case of a patient who was found to have mycotic aortic aneurysms secondary to treatment with BCG after a prolonged course with multiple intervening hospitalizations. Conclusion. Through this report, we discuss our present understanding of BCG infection following treatment and review the literature regarding this particular rare manifestation.

  8. Guía clínica de la enfermedad de Pompe de inicio tardío

    Barba-Romero, Miguel A.; Barrot, Emilia; Bautista-Lorite, Juan; Gutiérrez-Rivas, Eduardo; Illa, Isabel; Jiménez, Luis M.; Ley-Martos, Myriam; López de Munain, Adolfo; Pardo, Julio; Pascual-Pascual, Samuel I.; Pérez-López, Jordi; Solera, Jesús; Vílchez-Padilla, Juan J.

    2012-01-01

    English version available at www.neurologia.com Hasta 2006, la enfermedad de Pompe o glucogenosis tipo II era una enfermedad incurable y con tratamiento meramente paliativo. El desarrollo de la terapia de sustitución con la enzima α-glucosidasa recombinante humana ha constituido el primer tratamiento específico para esta enfermedad. El objetivo de esta guía es servir de referencia en el manejo de la variedad de inicio tardío de la enfermedad de Pompe, es decir, la que aparece d...

  9. Second Generation Electronic Nicotine Delivery System Vape Pen Exposure Generalizes as a Smoking Cue.

    King, Andrea C; Smith, Lia J; McNamara, Patrick J; Cao, Dingcai

    2018-01-05

    Second generation electronic nicotine delivery systems (ENDS; also known as e-cigarettes, vaporizers or vape pens) are designed for a customized nicotine delivery experience and have less resemblance to regular cigarettes than first generation "cigalikes." The present study examined whether they generalize as a conditioned cue and evoke smoking urges or behavior in persons exposed to their use. Data were analyzed in N = 108 young adult smokers (≥5 cigarettes per week) randomized to either a traditional combustible cigarette smoking cue or a second generation ENDS vaping cue in a controlled laboratory setting. Cigarette and e-cigarette urge and desire were assessed pre- and post-cue exposure. Smoking behavior was also explored in a subsample undergoing a smoking latency phase after cue exposure (N = 26). The ENDS vape pen cue evoked both urge and desire for a regular cigarette to a similar extent as that produced by the combustible cigarette cue. Both cues produced similar time to initiate smoking during the smoking latency phase. The ENDS vape pen cue elicited smoking urge and desire regardless of ENDS use history, that is, across ENDS naїve, lifetime or current users. Inclusion of past ENDS or cigarette use as covariates did not significantly alter the results. These findings demonstrate that observation of vape pen ENDS use generalizes as a conditioned cue to produce smoking urge, desire, and behavior in young adult smokers. As the popularity of these devices may eventually overtake those of first generation ENDS cigalikes, exposure effects will be of increasing importance. This study shows that passive exposure to a second generation ENDS vape pen cue evoked smoking urge, desire, and behavior across a range of daily and non-daily young adult smokers. Smoking urge and desire increases after vape pen exposure were similar to those produced by exposure to a first generation ENDS cigalike and a combustible cigarette, a known potent cue. Given the increasing

  10. Una nueva generación de guías de práctica clínica confiables a través de Magic

    Per Olav Vandvik

    Full Text Available El diagnóstico y el tratamiento seguro y eficaz de enfermedades en la consulta requieren que el personal de salud pueda acceder a la mejor evidencia, preferentemente a través de guías de práctica clínica confiables. La mayoría de guías sufren debilidades metodológicas, formatos de presentación subóptimos y frecuente falta de actualización de su contenido. Nuevos estándares desarrollados por el Institute of Medicine de los Estados Unidos y el Guideline International Network and Systems for Trustworthy Guidelines, ofrecen mejores oportunidades para el éxito en el desarrollo de guías, pero también aumentan la demanda de competencia metodológica, experiencia clínica y tiempo. Tan importante como proporcionar un contenido fiable de guías de práctica clínica es lograr la difusión y actualización de estas. En este artículo describimos cómo aplicar nuevos estándares, métodos y herramientas para la creación, difusión y actualización de las guías de práctica clínica confiables. Trazamos pasos clave para el desarrollo de guías a través de la utilización del sistema Grading of Recommendations Assessment, Development and Evaluation (GRADE. Explicamos cómo un programa de investigación innovador, MAking GRADE the Irresistible Choice (MAGIC (www.magicproject.org a través de su plataforma autoría y publicación (MAGICapp ofrece nuevas soluciones para facilitar la producción, la difusión y la actualización dinámica de guías de práctica clínica confiables. Describimos un ejemplo práctico de una guía noruega publicada recientemente sobre los nuevos anticoagulantes orales para fibrilación auricular, mostrando cómo una guía publicada en el MAGICapp se puede utilizar la consulta médica

  11. Adherencia a las guías de informe sobre investigaciones en revistas biomédicas en América Latina y el Caribe

    Demián Glujovsky

    2014-10-01

    Full Text Available OBJETIVO: Evaluar el conocimiento que los editores de las revistas indizadas en la base de datos LILACS tienen acerca de las Guías para informar y publicar sobre investigaciones -promovidas por la Red EQUATOR (Enhancing Quality and Transparency of Health Research-, los requisitos de las revistas para su uso y el conocimiento de los editores sobre los motivos de la baja tasa de uso. MÉTODOS: Se encuestó por correo electrónico a editores de LILACS sobre las Guías y su disponibilidad en el sitio web de EQUATOR y los requerimientos y dificultades para su uso. RESULTADOS: De los 802 editores, 16,4% respondieron la encuesta, más de la mitad dijeron no conocer las Guías (en especial STROBE y PRISMA y 30% tenían conocimiento sobre la Red EQUATOR. CONCLUSIONES: El primer estudio en América Latina y el Caribe sobre el conocimiento que tienen los editores de LILACS sobre las Guías revela que más de la mitad no conoce las Guías ni la Red EQUATOR.

  12. Guía práctica para la identificación y manejo de plagas en hortalizas Guía práctica para la identificación y manejo de plagas en hortalizas

    Figueroa P. Adalberto

    1986-03-01

    Full Text Available Guía práctica para la identificación y manejo de plagas en hortalizas La guía práctica comprende una descripción de los insectos, ácaros y moluscos que atacan los cultivos hortícolas en nuestro país. Se registraron 33 especies hortícolas pertenecientes a 10 familias botánicas que por su afinidad bioquímica atraen las mismas plagas. Se describieron 52 plagas con las respectivas recomendaciones de manejo. También se presentan las alternativas para un control eficaz con enfoque ecológico.This work is proposed as a practical guide for the identification and management of the vegetables pests. It comprises a description of insects, acarimolluscs that attack the vegetable crops in our country. The 33 horticultural especies here registered as attacked by insect pest belong to 10 botanical families, which due to their biochemical affinity, attract the same insects. 52 insect pests are described management, with the corresponding recommendations for the han dling of each one, also alternative for the efficacious control are given, from an ecological point of view.

  13. Comparison of bacterial culture and qPCR testing of rectal and pen floor samples as diagnostic approaches to detect enterotoxic Escherichia coli in nursery pigs

    Weber, N. R.; Nielsen, J. P.; Hjulsager, Charlotte Kristiane

    2017-01-01

    Enterotoxigenic E. coli (ETEC) are a major cause of diarrhoea in weaned pigs. The objective of this study was to evaluate the agreement at pen level among three different diagnostic approaches for the detection of ETEC in groups of nursery pigs with diarrhoea. The diagnostic approaches used were......: bacterial culturing of faecal samples from three pigs (per pen) with clinical diarrhoea and subsequent testing for virulence genes in E. coli isolates; bacterial culturing of pen floor samples and subsequent testing for virulence genes in E. coli isolates; qPCR testing of pen floor samples in order...... to determine the quantity of F18 and F4 genes. The study was carried out in three Danish pig herds and included 31 pens with a pen-level diarrhoea prevalence of > 25%, as well as samples from 93 diarrhoeic nursery pigs from these pens. All E. coli isolates were analysed by PCR and classified as ETEC when genes...

  14. The effects of pen partitions and thermal pig simulators on airflow in a livestock test room

    Bjerg, B.; Svidt, Kjeld; Zhang, G.

    2000-01-01

    measurements and CFD simulations showed that the introduction of pen partitions and thermal pig simulators reduced the air velocities in the occupied zone of the test room. Detailed geometric modelling of the animals might often be unnecessary for simulation of airflow in livestock rooms. This will especially......The aim of this work was to investigate the influence of pen partitions and heated simulated pigs on airflow in a slot ventilated test room and to evaluate computer fluid dynamics (CFD) as a tool to predict airflow in livestock rooms. To obtain two-dimensional flow in the occupied zone, four...... guiding plates were mounted beneath the ceiling in the test room. Experiments were carried out in three arrangements: (a) the room with guiding plates; (b) the room with guiding plates and eight heated pig simulators; and (c) the room with guiding plates, eight heated pig simulators and 0.8 m high...

  15. Pervasive liquid metal based direct writing electronics with roller-ball pen

    Yi Zheng

    2013-11-01

    Full Text Available A roller-ball pen enabled direct writing electronics via room temperature liquid metal ink was proposed. With the rolling to print mechanism, the metallic inks were smoothly written on flexible polymer substrate to form conductive tracks and electronic devices. The contact angle analyzer and scanning electron microscope were implemented to disclose several unique inner properties of the obtained electronics. An ever high writing resolution with line width and thickness as 200 μm and 80 μm, respectively was realized. Further, with the administration of external writing pressure, GaIn24.5 droplets embody increasing wettability on polymer which demonstrates the pervasive adaptability of the roller-ball pen electronics.

  16. Status and outlook of CHIP-TRAP: The Central Michigan University high precision Penning trap

    Redshaw, M.; Bryce, R. A.; Hawks, P.; Gamage, N. D.; Hunt, C.; Kandegedara, R. M. E. B.; Ratnayake, I. S.; Sharp, L.

    2016-06-01

    At Central Michigan University we are developing a high-precision Penning trap mass spectrometer (CHIP-TRAP) that will focus on measurements with long-lived radioactive isotopes. CHIP-TRAP will consist of a pair of hyperbolic precision-measurement Penning traps, and a cylindrical capture/filter trap in a 12 T magnetic field. Ions will be produced by external ion sources, including a laser ablation source, and transported to the capture trap at low energies enabling ions of a given m / q ratio to be selected via their time-of-flight. In the capture trap, contaminant ions will be removed with a mass-selective rf dipole excitation and the ion of interest will be transported to the measurement traps. A phase-sensitive image charge detection technique will be used for simultaneous cyclotron frequency measurements on single ions in the two precision traps, resulting in a reduction in statistical uncertainty due to magnetic field fluctuations.

  17. Particle-in-cell simulations of anomalous transport in a Penning discharge

    Carlsson, Johan; Kaganovich, Igor; Powis, Andrew; Raitses, Yevgeny; Romadanov, Ivan; Smolyakov, Andrei

    2018-06-01

    Electrostatic particle-in-cell simulations of a Penning discharge are performed in order to investigate azimuthally asymmetric, spoke-like structures previously observed in experiments. Two-dimensional simulations show that for Penning-discharge conditions, a persistent nonlinear spoke-like structure forms readily and rotates in the direction of E × B and electron diamagnetic drifts. The azimuthal velocity is within about a factor of 2 of the ion acoustic speed. The spoke frequency follows the experimentally observed scaling with ion mass, which indicates the importance of ion inertia in spoke formation. The spoke provides enhanced (anomalous) radial electron transport, and the effective cross-field conductivity is several times larger than the classical (collisional) value. The level of anomalous current obtained in the simulations is in good agreement with the experimental data. The rotating spoke channels most of the radial current, observable by an edge probe as short pulses.

  18. The early behaviour of cow and calf in an individual calving pen

    Jensen, Margit Bak

    2011-01-01

    The aim was to investigate the early behaviour in dairy cows and their calves. Thirty-eight multiparous Danish Holstein Frisian cows and their calves were housed in individual calving pens during the first twelve days post-partum and their behaviour was observed during 24 h on days 3, 7 and 11....... Cows gradually reduced the time spent sniffing and licking their calves from 59 to 49 min over the days studied (P cow from less than half a minute on days 3 and 7 to 1 min on day 11 (P ... studied (P cows’ behavioural priorities, the cows were tested on either day 4, 8 or 12 after calving by removing them from their pens during 3 h and subsequently reintroducing them. Behavioural observations during 3 h after reintroduction showed...

  19. Improvements in the injection system of the Canadian Penning trap mass spectrometer

    Clark, J; Boudreau, C; Buchinger, F; Crawford, J E; Gulick, S; Hardy, J C; Heinz, A; Lee, J K P; Moore, R B; Savard, G; Seweryniak, D; Sharma, K S; Sprouse, G; Vaz, J; Wang, J C; Zhou, Z

    2003-01-01

    The Canadian Penning Trap (CPT) mass spectrometer is designed to make precise mass measurements on a variety of stable and short-lived isotopes. Modifications to the injection system of the CPT have been implemented in recent months, the purpose being to more efficiently collect and transfer weakly-produced reaction products from the target to the Penning trap. These include a magnetic triplet situated after the target chamber to increase the acceptance of the Enge spectrograph, a velocity filter to more effectively separate the beam from the reaction products and the replacement of the Paul trap with a linear trap resulting in more efficient capture and accumulation of ions from the ion cooler. This paper will discuss these recent modifications and how they have increased our ability in making mass measurements on isotopes of low abundance, including those from a sup 2 sup 5 sup 2 Cf fission source.

  20. Penning traps with unitary architecture for storage of highly charged ions

    Tan, Joseph N.; Guise, Nicholas D.; Brewer, Samuel M.

    2012-01-01

    Penning traps are made extremely compact by embedding rare-earth permanent magnets in the electrode structure. Axially-oriented NdFeB magnets are used in unitary architectures that couple the electric and magnetic components into an integrated structure. We have constructed a two-magnet Penning trap with radial access to enable the use of laser or atomic beams, as well as the collection of light. An experimental apparatus equipped with ion optics is installed at the NIST electron beam ion trap (EBIT) facility, constrained to fit within 1 meter at the end of a horizontal beamline for transporting highly charged ions. Highly charged ions of neon and argon, extracted with initial energies up to 4000 eV per unit charge, are captured and stored to study the confinement properties of a one-magnet trap and a two-magnet trap. Design considerations and some test results are discussed.

  1. Penning traps with unitary architecture for storage of highly charged ions.

    Tan, Joseph N; Brewer, Samuel M; Guise, Nicholas D

    2012-02-01

    Penning traps are made extremely compact by embedding rare-earth permanent magnets in the electrode structure. Axially-oriented NdFeB magnets are used in unitary architectures that couple the electric and magnetic components into an integrated structure. We have constructed a two-magnet Penning trap with radial access to enable the use of laser or atomic beams, as well as the collection of light. An experimental apparatus equipped with ion optics is installed at the NIST electron beam ion trap (EBIT) facility, constrained to fit within 1 meter at the end of a horizontal beamline for transporting highly charged ions. Highly charged ions of neon and argon, extracted with initial energies up to 4000 eV per unit charge, are captured and stored to study the confinement properties of a one-magnet trap and a two-magnet trap. Design considerations and some test results are discussed.

  2. Dynamics of a single ion in a perturbed Penning trap: Octupolar perturbation

    Lara, Martin; Salas, J. Pablo

    2004-01-01

    Imperfections in the design or implementation of Penning traps may give rise to electrostatic perturbations that introduce nonlinearities in the dynamics. In this paper we investigate, from the point of view of classical mechanics, the dynamics of a single ion trapped in a Penning trap perturbed by an octupolar perturbation. Because of the axial symmetry of the problem, the system has two degrees of freedom. Hence, this model is ideal to be managed by numerical techniques like continuation of families of periodic orbits and Poincare surfaces of section. We find that, through the variation of the two parameters controlling the dynamics, several periodic orbits emanate from two fundamental periodic orbits. This process produces important changes (bifurcations) in the phase space structure leading to chaotic behavior

  3. Novel methods for improvement of a Penning ion source for neutron generator applications.

    Sy, A; Ji, Q; Persaud, A; Waldmann, O; Schenkel, T

    2012-02-01

    Penning ion source performance for neutron generator applications is characterized by the atomic ion fraction and beam current density, providing two paths by which source performance can be improved for increased neutron yields. We have fabricated a Penning ion source to investigate novel methods for improving source performance, including optimization of wall materials and electrode geometry, advanced magnetic confinement, and integration of field emitter arrays for electron injection. Effects of several electrode geometries on discharge characteristics and extracted ion current were studied. Additional magnetic confinement resulted in a factor of two increase in beam current density. First results indicate unchanged proton fraction and increased beam current density due to electron injection from carbon nanofiber arrays.

  4. Skin Blood Perfusion and Cellular Response to Insertion of Insulin Pen Needles With Different Diameters

    Præstmark, Kezia Ann; Stallknecht, Bente Merete; Bo Jensen, Casper

    2014-01-01

    skin blood perfusion response around needle insertion sites. Three common sized pen needles of 28G, 30G, and 32G as well as hooked 32G needles, were inserted into the neck skin of pigs and then removed. Laser Speckle Contrast Analysis was used to measure skin blood perfusion for 20 minutes after...... blood perfusion recording and grouped according to needle type, skin blood perfusion response relates to needle diameter. The response was significantly higher after insertions with 28G and hooked 32G needles than with 30G (P ..., but there was a trend of an increased response with increasing needle diameter. Skin blood perfusion response to pen needle insertions rank according to needle diameter, and the tissue response caused by hooked 32G needles corresponds to that of 28G needles. The relation between needle diameter and trauma when...

  5. The Ramsey method in high-precision mass spectrometry with Penning traps Experimental results

    George, S; Herfurth, F; Herlert, A; Kretzschmar, M; Nagy, S; Schwarz, S; Schweikhard, L; Yazidjian, C

    2007-01-01

    The highest precision in direct mass measurements is obtained with Penning trap mass spectrometry. Most experiments use the interconversion of the magnetron and cyclotron motional modes of the stored ion due to excitation by external radiofrequency-quadrupole fields. In this work a new excitation scheme, Ramsey's method of time-separated oscillatory fields, has been successfully tested. It has been shown to reduce significantly the uncertainty in the determination of the cyclotron frequency and thus of the ion mass of interest. The theoretical description of the ion motion excited with Ramsey's method in a Penning trap and subsequently the calculation of the resonance line shapes for different excitation times, pulse structures, and detunings of the quadrupole field has been carried out in a quantum mechanical framework and is discussed in detail in the preceding article in this journal by M. Kretzschmar. Here, the new excitation technique has been applied with the ISOLTRAP mass spectrometer at ISOLDE/CERN fo...

  6. Discrimination of Black Ball-point Pen Inks by High Performance Liquid Chromatography (HPLC)

    Mohamed Izzharif Abdul Halim; Norashikin Saim; Rozita Osman; Halila Jasmani; Nurul Nadhirah Zainal Abidin

    2013-01-01

    In this study, thirteen types of black ball-point pen inks of three major brands were analyzed using high performance liquid chromatography (HPLC). Separation of the ink components was achieved using Bondapak C-18 column with gradient elution using water, ethanol and ethyl acetate. The chromatographic data obtained at wavelength 254.8 nm was analyzed using agglomerative hierarchical clustering (AHC) and principle component analysis (PCA). AHC was able to group the inks into three clusters. This result was supported by PCA, whereby distinct separation of the three different brands was achieved. Therefore, HPLC in combination with chemometric methods may be a valuable tool for the analysis of black ball-point pen inks for forensic purposes. (author)

  7. Computational prediction of the effective temperature in the lying area of pig pens

    Bjerg, Bjarne; Rong, Li; Zhang, Guoqiang

    2018-01-01

    Using solid floor instead of drained or slatted floor in the lying areas of pig pens has distinct advantages in relation to animal welfare, odour abatement and ammonia emission, energy consumption and reduced building costs. However, pig producers often opt out of providing a solid floor due......, individually contribute to the combined effect of the thermal condition raising pigs are exposed to. Computational Fluid Dynamics (CFD) simulations were conducted to estimate the relevant parameters and, finally, the ET. Furthermore, the developed ET equation was implemented in the CFD model as a Custom Field...... Function to calculate the distribution of ET in the animal occupied zone. It was assumed that a traditional diffuse ceiling air inlet would deliver the required airflow rate as long as the outdoor temperature was below 10. °C. At higher outdoor temperature, a ceiling-jet inlet above each pen was opened...

  8. Optimal design of a 7 T highly homogeneous superconducting magnet for a Penning trap

    Wu Wei; He Yuan; Ma Lizhen; Huang Wenxue; Xia Jiawen

    2010-01-01

    A Penning trap system called Lanzhou Penning Trap (LPT) is now being developed for precise mass measurements at the Institute of Modern Physics(IMP). One of the key components is a 7 T actively shielded superconducting magnet with a clear warm bore of 156 mm. The required field homogeneity is 3 x 10 -7 over two 1 cubic centimeter volumes lying 220 mm apart along the magnet axis. We introduce a two-step method which combines linear programming and a nonlinear optimization algorithm for designing the multi-section superconducting magnet. This method is fast and flexible for handling arbitrary shaped homogeneous volumes and coils. With the help of this method an optimal design for the LPT superconducting magnet has been obtained. (authors)

  9. Prevalence of digital dermatitis in young stock in Alberta, Canada, using pen walks.

    Jacobs, C; Orsel, K; Barkema, H W

    2017-11-01

    Digital dermatitis (DD), an infectious bacterial foot lesion prevalent in dairy cattle worldwide, reduces both animal welfare and production. This disease was recently identified in replacement dairy heifers, with implications including increased risk of DD and decreased milk production in first lactation, poor reproductive performance, and altered hoof conformation. Therefore, a simple and effective method is needed to identify DD in young stock and to determine risk factors for DD in this group so that effective control strategies can be implemented. The objectives of this study were to (1) determine prevalence of DD in young stock (based on pen walks); and (2) identify potential risk factors for DD in young stock. A cross-sectional study was conducted on 28 dairy farms in Alberta, Canada; pen walks were used to identify DD (present/absent) on the hind feet of group-housed, young dairy stock. A subset of 583 young stock on 5 farms were selected for chute inspection of feet to determine the accuracy of pen walks for DD detection. Pen walks as a means of identifying DD lesions on the hind feet in young stock had sensitivity and specificity at the animal level of 65 and 98%, with positive and negative predictive values of 94 and 83%, respectively, at a prevalence of 37%. At the foot level, pen walks had sensitivity and specificity of 62 and 98%, respectively, with positive and negative predictive values of 92 and 88%, respectively, at a prevalence of 26%. Pen walks identified DD in 79 [2.9%; 95% confidence interval (95% CI): 2.3-3.6%] of 2,815 young stock on 11 (39%; 95% CI: 22-59%) of 28 farms, with all 79 DD-positive young stock ≥309 d of age. Apparent within-herd prevalence estimates ranged from 0 to 9.3%, with a mean of 1.4%. True within-herd prevalence of DD in young stock, calculated using the sensitivity and specificity of the pen walks, ranged from 0 to 12.6%, with a mean of 1.4%. On the 11 DD-positive farms, the proportion of young stock >12 mo of age

  10. Properties of H- and D- beams from magnetron and Penning sources

    Sluyters, T.; Kovarik, V.

    1979-01-01

    The quality of negative hydrogen isotope beams are evaluated after extraction from magnetron and Penning sources. The general conclusions of these measurements are that: (a) the beam quality from these plasma sources are adequate for the transport of high current negative ion beams in bending magnets; (b) there is evidence of practically complete space charge neutralization in the drift space beyond the extractor; (c) the beam performance from the Penning source appears to be better compared with the magnetron source; and (d) it is likely that the high electric field gradient and a concave ion emission boundary are responsible for a beam cross-over near the anode aperture, which causes beam divergence practically independent of the extraction geometry

  11. Feedlot- and Pen-Level Prevalence of Enterohemorrhagic Escherichia coli in Feces of Commercial Feedlot Cattle in Two Major U.S. Cattle Feeding Areas.

    Cull, Charley A; Renter, David G; Dewsbury, Diana M; Noll, Lance W; Shridhar, Pragathi B; Ives, Samuel E; Nagaraja, Tiruvoor G; Cernicchiaro, Natalia

    2017-06-01

    The objective of this study was to determine feedlot- and pen-level fecal prevalence of seven enterohemorrhagic Escherichia coli (EHEC) belonging to serogroups (O26, O45, O103, O111, O121, O145, and O157, or EHEC-7) in feces of feedlot cattle in two feeding areas in the United States. Cattle pens from four commercial feedlots in each of the two major U.S. beef cattle areas were sampled. Up to 16 pen-floor fecal samples were collected from each of 4-6 pens per feedlot, monthly, for a total of three visits per feedlot, from June to August, 2014. Culture procedures including fecal enrichment in E. coli broth, immunomagnetic separation, and plating on selective media, followed by confirmation through polymerase chain reaction (PCR) testing, were conducted. Generalized linear mixed models were fitted to estimate feedlot-, pen-, and sample-level fecal prevalence of EHEC-7 and to evaluate associations between potential demographic and management risk factors with feedlot and within-pen prevalence of EHEC-7. All study feedlots and 31.0% of the study pens had at least one non-O157 EHEC-positive fecal sample, whereas 62.4% of pens tested positive for EHEC O157; sample-level prevalence estimates ranged from 0.0% for EHEC O121 to 18.7% for EHEC O157. Within-pen prevalence of EHEC O157 varied significantly by sampling month; similarly within-pen prevalence of non-O157 EHEC varied significantly by month and by the sex composition of the pen (heifer, steer, or mixed). Feedlot management factors, however, were not significantly associated with fecal prevalence of EHEC-7. Intraclass correlation coefficients for EHEC-7 models indicated that most of the variation occurred between pens, rather than within pens, or between feedlots. Hence, the potential combination of preharvest interventions and pen-level management strategies may have positive food safety impacts downstream along the beef chain.

  12. Particle-In-Cell simulations of the Ball-pen probe

    Komm, M.; Adámek, Jiří; Pekárek, Z.; Pánek, Radomír

    2010-01-01

    Roč. 50, č. 9 (2010), s. 814-818 ISSN 0863-1042 R&D Projects: GA AV ČR KJB100430901 Institutional research plan: CEZ:AV0Z20430508 Keywords : Ball- pen * tokamak * plasma * plasma potential * PIC * simulation * I-V characteristics Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.006, year: 2010 http://onlinelibrary.wiley.com/doi/10.1002/ctpp.201010137/pdf

  13. Profile measurements in the plasma edge of mega amp spherical tokamak using a ball pen probe

    Walkden, N.R.; Adámek, Jiří; Allan, S.; Dudson, B.D.; Elmore, S.; Fishpool, G.; Harrison, J.; Kirk, A.; Komm, Michael

    2015-01-01

    Roč. 86, č. 2 (2015), č. článku 023510. ISSN 0034-6748 R&D Projects: GA ČR(CZ) GAP205/12/2327; GA MŠk(CZ) LM2011021 Institutional support: RVO:61389021 Keywords : plasma * tokamak * ball pen probe Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: 2.11 Other engineering and technologies Impact factor: 1.336, year: 2015 http://dx.doi.org/10.1063/1.4908572

  14. Application of the CO2-PENS risk analysis tool to the Rock Springs Uplift, Wyoming

    Stauffer, P.H.; Pawar, R.J.; Surdam, R.C.; Jiao, Z.; Deng, H.; Lettelier, B.C.; Viswanathan, H.S.; Sanzo, D.L.; Keating, G.N.

    2011-01-01

    We describe preliminary application of the CO2-PENS performance and risk analysis tool to a planned geologic CO2 sequestration demonstration project in the Rock Springs Uplift (RSU), located in south western Wyoming. We use data from the RSU to populate CO2-PENS, an evolving system-level modeling tool developed at Los Alamos National Laboratory. This tool has been designed to generate performance and risk assessment calculations for the geologic sequestration of carbon dioxide. Our approach follows Systems Analysis logic and includes estimates of uncertainty in model parameters and Monte-Carlo simulations that lead to probabilistic results. Probabilistic results provide decision makers with a range in the likelihood of different outcomes. Herein we present results from a newly implemented approach in CO 2-PENS that captures site-specific spatially coherent details such as topography on the reservoir/cap-rock interface, changes in saturation and pressure during injection, and dip on overlying aquifers that may be impacted by leakage upward through wellbores and faults. We present simulations of CO 2 injection under different uncertainty distributions for hypothetical leaking wells and faults. Although results are preliminary and to be used only for demonstration of the approach, future results of the risk analysis will form the basis for a discussion on methods to reduce uncertainty in the risk calculations. Additionally, we present ideas on using the model to help locate monitoring equipment to detect potential leaks. By maintaining site-specific details in the CO2-PENS analysis we provide a tool that allows more logical presentations to stakeholders in the region. ?? 2011 Published by Elsevier Ltd.

  15. Simulating Pension Income Scenarios with penCalc : An Illustration for India's National Pension System

    Sane, Renuka; Price, William J.

    2018-01-01

    This paper sets out initial results from a new modeling exercise for Defined Contribution (DC) pensions. It develops a package called penCalc based on the open source software language R, which is popular in the academic and modeling communities. All the coding is made freely available. The tool is illustrated for India's DC National Pension System. The aim is not to present the perfect mo...

  16. The mechanical design and simulation of a scaled H{sup −} Penning ion source

    Rutter, T., E-mail: theo.rutter@stfc.ac.uk; Faircloth, D.; Turner, D.; Lawrie, S. [Rutherford Appleton Laboratory, Didcot OX110QX (United Kingdom)

    2016-02-15

    The existing ISIS Penning H{sup −} source is unable to produce the beam parameters required for the front end test stand and so a new, high duty factor, high brightness scaled source is being developed. This paper details first the development of an electrically biased aperture plate for the existing ISIS source and second, the design, simulation, and development of a prototype scaled source.

  17. Study of argon-based Penning gas mixtures for use in proportional counters

    Agrawal, P.C.; Ramsey, B.D.; Weisskopf, M.C.

    1989-01-01

    Results from an experimental investigation of three Penning gas mixtures, namely argon-acetylene (Ar-C 2 H 2 ), argon-xenon (Ar-Xe) and argon-xenon-trimethylamine (Ar-Xe-TMA), are reported. The measurements, carried out in cylindrical geometry as well as parallel plate geometry detectors, demonstrate that the Ar-C 2 H 2 mixtures show a significant Penning effect even at an acetylene concentration of 10% and provide the best energy resolution among all the argon-based gas mixtures (≤13% FWHM at 5.9 keV and 6.7% at 22.2 keV). In the parallel plate detector the Ar-C 2 H 2 fillings provide a resolution of ≅7% FWHM at 22.2 keV up to a gas gain of at least ≅10 4 . The nonmetastable Penning mixture Ar-Xe provides the highest gas gain among all the argon-based gas mixtures and is well suited for use in long-duration space-based experiments. Best results are obtained with 5% and 20% Xe in Ar, the energy resolution being ≅7% FWHM at 22.2 keV and ≅4.5% at 59.6 keV for gas gain 3 . Addition of ≥1% TMA to an 80% Ar-20% Xe mixture produces a dramatic increase in gas gain but the energy resolution remains unaffected (≅7% FWHM at 22.2 keV). This increase in gas gain is attributed to the occurrence of a Penning effect between Xe and TMA, the ionization potential of TMA being 8.3 eV, just below the xenon metastable potential of 8.39 eV. (orig.)

  18. Growth of long triisopropylsilylethynyl pentacene (TIPS-PEN) nanofibrils in a polymer thin film during spin-coating.

    Park, Minwoo; Min, Yuho; Lee, Yu-Jeong; Jeong, Unyong

    2014-03-01

    This study demonstrates the growth of long triisopropylsilyethynyl pentacene (TIPS-PEN) nanofibrils in a thin film of a crystalline polymer, poly(ε-caprolactone) (PCL). During spin-coating, TIPS-PEN molecules are locally extracted around the PCL grain boundaries and they crystallize into [010] direction forming long nanofibrils. Molecular weight of PCL and weight fraction (α) of TIPS-PEN in PCL matrix are key factors to the growth of nanofibrils. Long high-quality TIPS-PEN nanofibrils are obtained with high-molecular-weight PCL and at the α values in the range of 0.03-0.1. The long nanofibrils are used as an active layer in a field-effect organic transistor. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Reducing alarms and prioritising interventions in pig production by simultaneous monitoring of water consumption in multiple pens

    Dominiak, Katarina Nielsen; Hindsborg, Jeff; Pedersen, L. J.

    to be generated at pen level or merged at section or herd level to reduce the number of alarms. Information on which specific pens or sections are of higher risk of stress or diseases is communicated to the farmer and target work effort to pens at risk. For Herd A, all model parameters defined at section level...... resulted in the best fit (MSE =13.85 litres2/hour). For Herd B, parameters defined at both pen and section level resulted in the best fit (MSE = 1.47 litres2/hour). For both Herd A and Herd B, preliminary results support the spatial approach by generating a reduced number of alarms when comparing section...

  20. Evaluación neuropsicológica en adicciones: guía clínica

    Antonio Verdejo-García

    Full Text Available Resumen El objetivo de este artículo de opinión es proporcionar pautas para la evaluación neuropsicológica en el contexto terapéutico de las adicciones. Se proponen guías básicas para la evaluación neuropsicológica en dos contextos: (1 la determinación de los perfiles neuropsicológicos de usuarios consumidores de drogas; (2 la predicción de los resultados del tratamiento de las adicciones, en términos de retención y adherencia a las recomendaciones terapéuticas y de riesgo de recaídas en el consumo. Se describen también nuevas aproximaciones terapéuticas derivadas de una comprensión neuropsicológica de los trastornos por uso de sustancias. Las pautas recogidas en este artículo pretenden servir para facilitar la transición entre el descubrimiento científico y la implementación asistencial, proporcionando guías básicas para incorporar estas herramientas en la práctica clínica con pacientes drogodependientes.

  1. Dose measurement in periapical radiographic exams using dosemeter pen: a look at the radioprotection

    Oliveira, Renato; Ferreira, Vanessa; Pereira, Claubia; Oliveira, Arno H.; Veloso, M.A.F.

    2011-01-01

    The use of radiology has been a large increase with the crescent accessibility to dental care, orthodontics and aesthetic. Besides the increase in the number of exams, there was an increase in radiation dose during dental exams such as computed tomography. The objective of this work is to evaluate the radiation dose to which the patient is subjected in a peri apical dental radiography. The dose values were measured with a dosimeter pen during radiographs in real exams peri apical with the X-ray equipment Timex 70 C Gnatus. During the exams realization, was maintained, in the holder, the dosimeter pen near to the region of interest. The values collected were recorded in dosimeter pen. These values were compared with the reference doses of the Portaria 453 of ANVISA, this procedure allows to verify if the recommended dose limits for this exam are being respected. These data indicates if the used equipment is calibrated and in good condition of use. It was performed a comparison between the obtained experimental dose values and the values found from computer simulation with the code MCNPX 2.6.0. (author)

  2. Dose measurement in periapical radiographic exams using dosemeter pen: a look at the radioprotection

    Oliveira, Renato; Ferreira, Vanessa, E-mail: vanessamachado@ufmg.br [Curso Superior de Tecnologia em Radiologia. Faculdade de Medicina. Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil); Pereira, Claubia; Oliveira, Arno H.; Veloso, M.A.F., E-mail: gbarros@nuclear.ufmg.br, E-mail: claubia@nuclear.ufmg.br, E-mail: heeren@nuclear.ufmg.br, E-mail: Dora@nuclear.ufmg.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear

    2011-07-01

    The use of radiology has been a large increase with the crescent accessibility to dental care, orthodontics and aesthetic. Besides the increase in the number of exams, there was an increase in radiation dose during dental exams such as computed tomography. The objective of this work is to evaluate the radiation dose to which the patient is subjected in a peri apical dental radiography. The dose values were measured with a dosimeter pen during radiographs in real exams peri apical with the X-ray equipment Timex 70 C Gnatus. During the exams realization, was maintained, in the holder, the dosimeter pen near to the region of interest. The values collected were recorded in dosimeter pen. These values were compared with the reference doses of the Portaria 453 of ANVISA, this procedure allows to verify if the recommended dose limits for this exam are being respected. These data indicates if the used equipment is calibrated and in good condition of use. It was performed a comparison between the obtained experimental dose values and the values found from computer simulation with the code MCNPX 2.6.0. (author)

  3. Forensic analysis of ballpoint pen inks using paper spray mass spectrometry.

    da Silva Ferreira, Priscila; Fernandes de Abreu e Silva, Débora; Augusti, Rodinei; Piccin, Evandro

    2015-02-07

    A novel analytical approach based on paper spray mass spectrometry (PS-MS) is developed for a fast and effective forensic analysis of inks in documents. Ink writings made in ordinary paper with blue ballpoint pens were directly analyzed under ambient conditions without any prior sample preparation. Firstly, the method was explored on a set of distinct pens and the results obtained in the positive ion mode, PS(+)-MS, demonstrated that pens from different brands provide typical profiles. Simple visual inspection of the PS(+)-MS led to the distinction of four different combinations of dyes and additives in the inks. Further discrimination was performed by using the concept of relative ion intensity (RII), owing to the large variability of dyes BV3 and BB26 regarding their demethylated homologues. Following screening and differentiation studies, the composition changes of ink entries subjected to light exposure were also monitored by PS-MS. The results of these tests revealed distinct degradation behaviors which were reflected on the typical chemical profiles of the studied inks, attesting that PS-MS may be also useful to verify the fading of dyes thus allowing the discrimination of entries on a document. As proof of concept experiments, PS-MS was successfully utilized for the analysis of archived documents and characterization of overlapped ink lines made on simulated forged documents.

  4. Micro Penning Trap for Continuous Magnetic Field Monitoring in High Radiation Environments

    Latorre, Javiera; Bollen, Georg; Gulyuz, Kerim; Ringle, Ryan; Bado, Philippe; Dugan, Mark; Lebit Team; Translume Collaboration

    2016-09-01

    As new facilities for rare isotope beams, like FRIB at MSU, are constructed, there is a need for new instrumentation to monitor magnetic fields in beam magnets that can withstand the higher radiation level. Currently NMR probes, the instruments used extensively to monitor magnetic fields, do not have a long lifespans in radiation-high environments. Therefore, a radiation-hard replacement is needed. We propose to use Penning trap mass spectrometry techniques to make high precision magnetic field measurements. Our Penning microtrap will be radiation resistant as all of the vital electronics will be at a safe distance from the radiation. The trap itself is made from materials not subject to radiation damage. Penning trap mass spectrometers can determine the magnetic field by measuring the cyclotron frequency of an ion with a known mass and charge. This principle is used on the Low Energy Beam Ion Trap (LEBIT) minitrap at NSCL which is the foundation for the microtrap. We have partnered with Translume, who specialize in glass micro-fabrication, to develop a microtrap in fused-silica glass. A microtrap is finished and ready for testing at NSCL with all of the electronic and hardware components setup. DOE Phase II SBIR Award No. DE-SC0011313, NSF Award Number 1062410 REU in Physics, NSF under Grant No. PHY-1102511.

  5. A feature based comparison of pen and swipe based signature characteristics.

    Robertson, Joshua; Guest, Richard

    2015-10-01

    Dynamic Signature Verification (DSV) is a biometric modality that identifies anatomical and behavioral characteristics when an individual signs their name. Conventionally signature data has been captured using pen/tablet apparatus. However, the use of other devices such as the touch-screen tablets has expanded in recent years affording the possibility of assessing biometric interaction on this new technology. To explore the potential of employing DSV techniques when a user signs or swipes with their finger, we report a study to correlate pen and finger generated features. Investigating the stability and correlation between a set of characteristic features recorded in participant's signatures and touch-based swipe gestures, a statistical analysis was conducted to assess consistency between capture scenarios. The results indicate that there is a range of static and dynamic features such as the rate of jerk, size, duration and the distance the pen traveled that can lead to interoperability between these two systems for input methods for use within a potential biometric context. It can be concluded that this data indicates that a general principle is that the same underlying constructional mechanisms are evident. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Technical developments for an upgrade of the LEBIT Penning trap mass spectrometry facility for rare isotopes

    Redshaw, M.; Barquest, B. R.; Bollen, G.; Bustabad, S. E.; Campbell, C. M.; Ferrer, R.; Gehring, A.; Kwiatkowski, A. A.; Lincoln, D. L.; Morrissey, D. J.; Pang, G. K.; Ringle, R.; Schwarz, S.

    2011-07-01

    The LEBIT (Low Energy Beam and Ion Trap) facility is the only Penning trap mass spectrometry (PTMS) facility to utilize rare isotopes produced via fast-beam fragmentation. This technique allows access to practically all elements lighter than uranium, and in particular enables the production of isotopes that are not available or that are difficult to obtain at isotope separation on-line facilities. The preparation of the high-energy rare-isotope beam produced by projectile fragmentation for low-energy PTMS experiments is achieved by gas stopping to slow down and thermalize the fast-beam ions, along with an rf quadrupole cooler and buncher and rf quadrupole ion guides to deliver the beam to the Penning trap. During its first phase of operation LEBIT has been very successful, and new developments are now underway to access rare isotopes even farther from stability, which requires dealing with extremely short lifetimes and low production rates. These developments aim at increasing delivery efficiency, minimizing delivery and measurement time, and maximizing use of available beam time. They include an upgrade to the gas-stopping station, active magnetic field monitoring and stabilization by employing a miniature Penning trap as a magnetometer, the use of stored waveform inverse Fourier transform (SWIFT) to most effectively remove unwanted ions, and charge breeding.

  7. Technical developments for an upgrade of the LEBIT Penning trap mass spectrometry facility for rare isotopes

    Redshaw, M.; Barquest, B. R.; Bollen, G.; Bustabad, S. E.; Campbell, C. M.; Ferrer, R.; Gehring, A.; Kwiatkowski, A. A.; Lincoln, D. L.; Morrissey, D. J.; Pang, G. K.; Ringle, R.; Schwarz, S.

    2011-01-01

    The LEBIT (Low Energy Beam and Ion Trap) facility is the only Penning trap mass spectrometry (PTMS) facility to utilize rare isotopes produced via fast-beam fragmentation. This technique allows access to practically all elements lighter than uranium, and in particular enables the production of isotopes that are not available or that are difficult to obtain at isotope separation on-line facilities. The preparation of the high-energy rare-isotope beam produced by projectile fragmentation for low-energy PTMS experiments is achieved by gas stopping to slow down and thermalize the fast-beam ions, along with an rf quadrupole cooler and buncher and rf quadrupole ion guides to deliver the beam to the Penning trap. During its first phase of operation LEBIT has been very successful, and new developments are now underway to access rare isotopes even farther from stability, which requires dealing with extremely short lifetimes and low production rates. These developments aim at increasing delivery efficiency, minimizing delivery and measurement time, and maximizing use of available beam time. They include an upgrade to the gas-stopping station, active magnetic field monitoring and stabilization by employing a miniature Penning trap as a magnetometer, the use of stored waveform inverse Fourier transform (SWIFT) to most effectively remove unwanted ions, and charge breeding.

  8. Possibilities for achieving antihydrogen recombination and trapping using a nested Penning trap and a magnetic well

    Ordonez, C.A.; Dolliver, D.D.; Chang Yongbin; Correa, J. R.

    2002-01-01

    A theoretical study is presented regarding some possibilities for achieving antihydrogen recombination and trapping using a nested Penning trap and a magnetic well. The work reported consists of a review, an extension, and applications of the relevant knowledge base. A nested Penning trap produces a magnetic field, which provides plasma confinement perpendicular to the magnetic field, and an electric field associated with a nested-well potential profile. The nested-well potential profile provides plasma confinement parallel to the magnetic field for oppositely signed plasma species that can have overlapping confinement regions. A configuration is considered in which the electric field is applied in two regions of uniform magnetic field that reside on opposite sides of a magnetic well region. The electric field confines overlapping positron and antiproton plasmas, which thread the magnetic well region. The magnetic well region would serve to trap a fraction of any antihydrogen atoms that are formed. Two different methods are considered for achieving overlap of positron and antiproton plasmas. For each, a set of conditions is predicted for achieving antihydrogen recombination and trapping. Although the study reported specifically considers simultaneous confinement of positron and antiproton plasmas in nested Penning traps, much of the information presented is also relevant to the prospect of merging other pairs of oppositely signed plasmas (e.g., electron and positron plasmas)

  9. Development of compact size penning ion source for compact neutron generator.

    Das, Basanta Kumar; Shyam, Anurag

    2008-12-01

    For long-life operation, easy to mount and compact in size penning type ion sources are widely used in different fields of research such as neutron generators, material research, and surface etching. One penning type ion source has been developed in our laboratory. Applying high voltage of 2 kV between two oppositely biased electrodes and using permanent magnet of 500 gauss magnetic field along the axis, we had produced the glow discharge in the plasma region. The performance of this source was investigated using nitrogen gas. Deuterium ions were produced and extracted on the basis of chosen electrodes and the angle of extraction. Using a single aperture plasma electrode, the beam was extracted along the axial direction. The geometry of plasma electrode is an important factor for the efficient extraction of the ions from the plasma ion source. The extracted ion current depends upon the shape of the plasma meniscus. A concave shaped plasma meniscus produces converged ion beam. The convergence of extracted ions is related to the extraction electrode angle. The greater the angle, the more the beam converges. We had studied experimentally this effect with a compact size penning ion source. The detailed comparison among the different extraction geometry and different electrode angle are discussed in this paper.

  10. Nest building and posture changes and activity budget of gilts housed in pens and crates

    Andersen, Inger Lise; Vasdal, Guro; Pedersen, Lene Juul

    2014-01-01

    was born until 8 h after the birth of the first piglet. There was no significant effect of the sows breeding value on any of the sow behaviours. Sows housed in pens spent significantly more time nest building than crated sows from 4 to 12 h prepartum (P ...The aim of the present work was to study nest building, posture changes and the overall activity budget of gilts in pens vs. crates. Twenty-three HB gilts (high piglet survival day 5) and 21 LB gilts (low piglet survival day 5) were video recorded from day 110 in pregnancy to four days after...... farrowing in either a farrowing pen or farrowing crate. The gilts were provided with 2 kg of chopped straw daily from day 113 of pregnancy until farrowing in both environments. Nest building and other activity measures of the sows were analysed using continuous sampling the last 12 h before the first piglet...

  11. Chitinolytic Bacteria-Assisted Conversion of Squid Pen and Its Effect on Dyes and Pigments Adsorption

    Tzu-Wen Liang

    2015-07-01

    Full Text Available The aim of this work was to produce chitosanase by fermenting from squid pen, and recover the fermented squid pen for dye removal by adsorption. One chitosanase induced from squid pen powder (SPP-containing medium by Bacillus cereus TKU034 was purified in high purification fold (441 and high yield of activity recovery (51% by ammonium sulfate precipitation and combined column chromatography. The SDS-PAGE results showed its molecular mass to be around 43 kDa. The TKU034 chitosanase used for the chitooligomers preparation was studied. The enzyme products revealed that the chitosanase could degrade chitosan with various degrees of polymerization, ranging from 3 to 9, as well as the chitosanase in an endolytic manner. Besides, the fermented SPP was recovered and displayed a better adsorption rate (up to 99.5% for the disperse dyes (red, yellow, blue, and black than the water-soluble food colorants, Allura Red AC (R40 and Tartrazine (Y4. The adsorbed R40 on the unfermented SPP and the fermented SPP was eluted by distilled water and 1 M NaOH to confirm the dye adsorption mechanism. The fermented SPP had a slightly higher adsorption capacity than the unfermented, and elution of the dye from the fermented SPP was easier than from the unfermented. The main dye adsorption mechanism of fermented SPP was physical adsorption, while the adsorption mechanism of unfermented SPP was chemical adsorption.

  12. Chitinolytic Bacteria-Assisted Conversion of Squid Pen and Its Effect on Dyes and Pigments Adsorption.

    Liang, Tzu-Wen; Lo, Bo-Chang; Wang, San-Lang

    2015-07-23

    The aim of this work was to produce chitosanase by fermenting from squid pen, and recover the fermented squid pen for dye removal by adsorption. One chitosanase induced from squid pen powder (SPP)-containing medium by Bacillus cereus TKU034 was purified in high purification fold (441) and high yield of activity recovery (51%) by ammonium sulfate precipitation and combined column chromatography. The SDS-PAGE results showed its molecular mass to be around 43 kDa. The TKU034 chitosanase used for the chitooligomers preparation was studied. The enzyme products revealed that the chitosanase could degrade chitosan with various degrees of polymerization, ranging from 3 to 9, as well as the chitosanase in an endolytic manner. Besides, the fermented SPP was recovered and displayed a better adsorption rate (up to 99.5%) for the disperse dyes (red, yellow, blue, and black) than the water-soluble food colorants, Allura Red AC (R40) and Tartrazine (Y4). The adsorbed R40 on the unfermented SPP and the fermented SPP was eluted by distilled water and 1 M NaOH to confirm the dye adsorption mechanism. The fermented SPP had a slightly higher adsorption capacity than the unfermented, and elution of the dye from the fermented SPP was easier than from the unfermented. The main dye adsorption mechanism of fermented SPP was physical adsorption, while the adsorption mechanism of unfermented SPP was chemical adsorption.

  13. Chitinolytic Bacteria-Assisted Conversion of Squid Pen and Its Effect on Dyes and Pigments Adsorption

    Liang, Tzu-Wen; Lo, Bo-Chang; Wang, San-Lang

    2015-01-01

    The aim of this work was to produce chitosanase by fermenting from squid pen, and recover the fermented squid pen for dye removal by adsorption. One chitosanase induced from squid pen powder (SPP)-containing medium by Bacillus cereus TKU034 was purified in high purification fold (441) and high yield of activity recovery (51%) by ammonium sulfate precipitation and combined column chromatography. The SDS-PAGE results showed its molecular mass to be around 43 kDa. The TKU034 chitosanase used for the chitooligomers preparation was studied. The enzyme products revealed that the chitosanase could degrade chitosan with various degrees of polymerization, ranging from 3 to 9, as well as the chitosanase in an endolytic manner. Besides, the fermented SPP was recovered and displayed a better adsorption rate (up to 99.5%) for the disperse dyes (red, yellow, blue, and black) than the water-soluble food colorants, Allura Red AC (R40) and Tartrazine (Y4). The adsorbed R40 on the unfermented SPP and the fermented SPP was eluted by distilled water and 1 M NaOH to confirm the dye adsorption mechanism. The fermented SPP had a slightly higher adsorption capacity than the unfermented, and elution of the dye from the fermented SPP was easier than from the unfermented. The main dye adsorption mechanism of fermented SPP was physical adsorption, while the adsorption mechanism of unfermented SPP was chemical adsorption. PMID:26213948

  14. Relationship between New Allelic Types of Helicobacter pylori vacA Gene and cagA Status and Risk of GU or DU in Iran

    S Bakhti

    2015-09-01

    Full Text Available Background & objectives: Several studies have described VacA and CagA as the two important virulence determinants of Helicobacter pylori, which are associated with gastric ulcer (GU and duodenal ulcer (DU. The aim of present study was to determine the associations of the i and d regions genotypes of H. pylori vacA gene and cagA status with GU and DU risk. Methods: A total of 177 isolates were cultured from the biopsies of Iranian patients with different geographic origins and genotyped. Data were collected and analyzed. Results: Frequency of the vacA i1, i2, i1i2, d1, and d2 alleles and cagA in all patients was 42.9%, 55.4%, 1.7%, 41.8%, 58.2% and 68.4%, respectively. There was a significant difference between the frequencies of vacA i1 in isolates from GU than those from non-atrophic gastritis (p<0.05. When the GU was considered as a dependant factor by the multiple logistic regression analysis, the vacA i1 genotype was significantly associated with the age- and sex-adjusted risk for GU (p=0.006, odds ratio [OR]=3.56 95% confidence interval [CI]=1.45–8.75. Statistical analysis showed no significant association between vacA d genotype and digestive diseases. After controlling for age and sex variables, the cagA genotype remained in the final model when the DU was considered as a dependant factor by the the multiple logistic regression analysis (p=0.021, OR=3.77 95% CI=1.22-11.60. Conclusion: We have proposed that the H. pylori vacA i1 and cagA genotypes could be considered as benefit biomarkers for prediction of risk of GU and DU in Iran, respectively.

  15. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  16. Forensic Analysis of Blue Ball point Pen Inks Using Ultraviolet-Visible Spectrometer and Ultra-Performance Liquid Chromatograph

    Lee, L.C.; Shandu, K.T.S.; Nor Syahirah Mohamad Razi; Ab Aziz Ishak; Khairul Osman

    2015-01-01

    Twelve varieties of blue ball point pens were selected and analyzed using UV-Vis spectrometer and ultra-performance liquid chromatography (UPLC). The aim of the study was to determine discrimination power (DP) of these methods in differentiating pen inks collected from the market in Malaysia. Discrimination analysis of 66 possible pen-pair of blue ball point pens was carried out via one-way ANOVA based on obtained chromatogram and spectra. A total of 18 peaks were determined as coming from inks based on the chromatographic data extracted at three different wavelengths (279, 370 and 400 nm). While for the UV-Vis spectrometer analysis, presence of peaks at 303, 545, 577 and 584 nm wavelengths were recorded. UV-Vis spectral data were mainly produced by the colorant components (for example, dyes) found in inks and UPLC may detect ink components other than dyes, for example, additives. As conclusion, the DP for UV-Vis and UPLC were determined to be 72.12 % and 98.48 %, respectively. This manuscript demonstrates the potential of UPLC for discriminating pen inks based on non-dye components. Additionally, the dye components in inks do not seem to play important role in discrimination of pen inks. (author)

  17. Comment on “Time-changed geometric fractional Brownian motion and option pricing with transaction costs” by Hui Gu et al.

    Guo, Zhidong; Song, Yukun; Zhang, Yunliang

    2013-05-01

    The purpose of this comment is to point out the inappropriate assumption of “3αH>1” and two problems in the proof of “Theorem 3.1” in section 3 of the paper “Time-changed geometric fractional Brownian motion and option pricing with transaction costs” by Hui Gu et al. [H. Gu, J.R. Liang, Y. X. Zhang, Time-changed geometric fractional Brownian motion and option pricing with transaction costs, Physica A 391 (2012) 3971-3977]. Then we show the two problems will be solved under our new assumption.

  18. Guía de Intervención para el Desarrollo Comunicativo - Lingüístico de los alumnos con Trastorno Del Espectro Autista

    Escribano Tébar, Inmaculada

    2015-01-01

    El presente Trabajo Fin de Grado está basado en el estudio de los Trastornos del Espectro Autista (TEA). Se realiza una revisión bibliográfica sobre el tema utilizando libros, artículos, guías y otras fuentes relacionadas con el tema, los cuales se pueden ver reflejados en la bibliografía de este trabajo. A partir de este estudio, se pretende que pueda servir de guía de intervención sobre alumnos con TEA pertenecientes al segundo ciclo de Educación Infantil y dirigida principalmente a maes...

  19. A review of the powderpost beetle genus, Xylopertha Guérin-Méneville, 1845, with a new species and new synonymy (Coleoptera: Bostrichidae: Bostrichinae: Xyloperthini

    Lan-Yu Liu

    2017-12-01

    Full Text Available We review the three species currently placed in the genus Xylopertha Guérin-Méneville, 1845, and describe a new species, Xylopertha elegans sp. nov., from Turkey. We propose the following new synonymy: Xylopertha Guérin-Méneville, 1845 (= Paraxylogenes Damoiseau, 1968; Xylopertha reflexicauda (Lesne, 1937 (= Paraxylogenes pistaciae Damoiseau, 1968. We give details of the sexual dimorphism, and summarise information on the distribution and biology of all species. A key to the species of Xylopertha is provided.

  20. Grado de Conocimiento de la Guía de Práctica Clínica de Trastornos Hipertensivos durante el Embarazo en una Empresa Social del Estado en Barranquilla (Atl. – Col durante el 2014

    C Beleño Agudelo

    2015-01-01

    Conclusión: se llegó al punto que a mayor nivel académico mayor conocimiento de las guías de práctica clínica y que como barreras se encuentran la falta de tiempo y falta de difusión de las guías.

  1. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  2. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  3. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  4. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  5. Neisseria gonorrhoeae and extended-spectrum cephalosporins in California: surveillance and molecular detection of mosaic penA.

    Gose, Severin; Nguyen, Duylinh; Lowenberg, Daniella; Samuel, Michael; Bauer, Heidi; Pandori, Mark

    2013-12-04

    The spread of Neisseria gonorrhoeae strains with mosaic penA alleles and reduced susceptibility to extended-spectrum cephalosporins is a major public health problem. While much work has been performed internationally, little is known about the genetics or molecular epidemiology of N. gonorrhoeae isolates with reduced susceptibility to extended-spectrum cephalosporins in the United States. The majority of N. gonorrhoeae infections are diagnosed without a live culture. Molecular tools capable of detecting markers of extended-spectrum cephalosporin resistance are needed. Urethral N. gonorrhoeae isolates were collected from 684 men at public health clinics in California in 2011. Minimum inhibitory concentrations (MICs) to ceftriaxone, cefixime, cefpodoxime and azithromycin were determined by Etest and categorized according to the U.S. Centers for Disease Control 2010 alert value breakpoints. 684 isolates were screened for mosaic penA alleles using real-time PCR (RTPCR) and 59 reactive isolates were subjected to DNA sequencing of their penA alleles and Neisseria gonorrhoeae multi-antigen sequence typing (NG-MAST). To increase the specificity of the screening RTPCR in detecting isolates with alert value extended-spectrum cephalosporin MICs, the primers were modified to selectively amplify the mosaic XXXIV penA allele. Three mosaic penA alleles were detected including two previously described alleles (XXXIV, XXXVIII) and one novel allele (LA-A). Of the 29 isolates with an alert value extended-spectrum cephalosporin MIC, all possessed the mosaic XXXIV penA allele and 18 were sequence type 1407, an internationally successful strain associated with multi-drug resistance. The modified RTPCR detected the mosaic XXXIV penA allele in urethral isolates and urine specimens and displayed no amplification of the other penA alleles detected in this study. N. gonorrhoeae isolates with mosaic penA alleles and reduced susceptibility to extended-spectrum cephalosporins are currently

  6. Propylthiouracil Attenuates Experimental Pulmonary Hypertension via Suppression of Pen-2, a Key Component of Gamma-Secretase.

    Ying-Ju Lai

    Full Text Available Gamma-secretase-mediated Notch3 signaling is involved in smooth muscle cell (SMC hyper-activity and proliferation leading to pulmonary arterial hypertension (PAH. In addition, Propylthiouracil (PTU, beyond its anti-thyroid action, has suppressive effects on atherosclerosis and PAH. Here, we investigated the possible involvement of gamma-secretase-mediated Notch3 signaling in PTU-inhibited PAH. In rats with monocrotaline-induced PAH, PTU therapy improved pulmonary arterial hypertrophy and hemodynamics. In vitro, treatment of PASMCs from monocrotaline-treated rats with PTU inhibited their proliferation and migration. Immunocyto, histochemistry, and western blot showed that PTU treatment attenuated the activation of Notch3 signaling in PASMCs from monocrotaline-treated rats, which was mediated via inhibition of gamma-secretase expression especially its presenilin enhancer 2 (Pen-2 subunit. Furthermore, over-expression of Pen-2 in PASMCs from control rats increased the capacity of migration, whereas knockdown of Pen-2 with its respective siRNA in PASMCs from monocrotaline-treated rats had an opposite effect. Transfection of PASMCs from monocrotaline-treated rats with Pen-2 siRNA blocked the inhibitory effect of PTU on PASMC proliferation and migration, reflecting the crucial role of Pen-2 in PTU effect. We present a novel cell-signaling paradigm in which overexpression of Pen-2 is essential for experimental pulmonary arterial hypertension to promote motility and growth of smooth muscle cells. Propylthiouracil attenuates experimental PAH via suppression of the gamma-secretase-mediated Notch3 signaling especially its presenilin enhancer 2 (Pen-2 subunit. These findings provide a deep insight into the pathogenesis of PAH and a novel therapeutic strategy.

  7. Characteristics of Handwriting of People With Cerebellar Ataxia: Three-Dimensional Movement Analysis of the Pen Tip, Finger, and Wrist.

    Fujisawa, Yuhki; Okajima, Yasutomo

    2015-11-01

    There are several functional tests for evaluating manual performance; however, quantitative manual tests for ataxia, especially those for evaluating handwriting, are limited. This study aimed to investigate the characteristics of cerebellar ataxia by analyzing handwriting, with a special emphasis on correlation between the movement of the pen tip and the movement of the finger or wrist. This was an observational study. Eleven people who were right-handed and had cerebellar ataxia and 17 people to serve as controls were recruited. The Scale for the Assessment and Rating of Ataxia was used to grade the severity of ataxia. Handwriting movements of both hands were analyzed. The time required for writing a character, the variability of individual handwriting, and the correlation between the movement of the pen tip and the movement of the finger or wrist were evaluated for participants with ataxia and control participants. The writing time was longer and the velocity profile and shape of the track of movement of the pen tip were more variable in participants with ataxia than in control participants. For participants with ataxia, the direction of movement of the pen tip deviated more from that of the finger or wrist, and the shape of the track of movement of the pen tip differed more from that of the finger or wrist. The severity of upper extremity ataxia measured with the Scale for the Assessment and Rating of Ataxia was mostly correlated with the variability parameters. Furthermore, it was correlated with the directional deviation of the trajectory of movement of the pen tip from that of the finger and with increased dissimilarity of the shapes of the tracks. The results may have been influenced by the scale and parameters used to measure movement. Ataxic handwriting with increased movement noise is characterized by irregular pen tip movements unconstrained by the finger or wrist. The severity of ataxia is correlated with these unconstrained movements. © 2015 American

  8. The influence of facility and home pen design on the welfare of the laboratory-housed dog.

    Scullion Hall, Laura E M; Robinson, Sally; Finch, John; Buchanan-Smith, Hannah M

    We have an ethical and scientific obligation to Refine all aspects of the life of the laboratory-housed dog. Across industry there are many differences amongst facilities, home pen design and husbandry, as well as differences in features of the dogs such as strain, sex and scientific protocols. Understanding how these influence welfare, and hence scientific output is therefore critical. A significant proportion of dogs' lives are spent in the home pen and as such, the design can have a considerable impact on welfare. Although best practice guidelines exist, there is a paucity of empirical evidence to support the recommended Refinements and uptake varies across industry. In this study, we examine the effect of modern and traditional home pen design, overall facility design, husbandry, history of regulated procedures, strain and sex on welfare-indicating behaviours and mechanical pressure threshold. Six groups of dogs from two facilities (total n=46) were observed in the home pen and tested for mechanical pressure threshold. Dogs which were housed in a purpose-built modern facility or in a modern design home pen showed the fewest behavioural indicators of negative welfare (such as alert or pacing behaviours) and more indicators of positive welfare (such as resting) compared to those in a traditional home pen design or traditional facility. Welfare indicating behaviours did not vary consistently with strain, but male dogs showed more negative welfare indicating behaviours and had greater variation in these behaviours than females. Our findings showed more positive welfare indicating behaviours in dogs with higher mechanical pressure thresholds. We conclude that factors relating to the design of home pens and implementation of Refinements at the facility level have a significant positive impact on the welfare of laboratory-housed dogs, with a potential concomitant impact on scientific endpoints. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights

  9. Guía de la gestión integrada de recursos hídricos para gobiernos locales

    Autoridad Nacional del Agua. Dirección de Conservación y Planeamiento de Recursos Hídricos. Unidad de Glaciología y Recursos Hídricos; Cooperación Alemana; Asociacion Civil para la Gestión Social del Agua

    2013-01-01

    Presenta una herramienta práctica que permita a los Gobiernos Locales implementar paso a paso la gestión integrada del agua. Esta guía está compuesta por ocho capítulos, que explican, como una hoja de ruta, la Gestión Integrada de Recursos Hídricos para Gobiernos Locales; de igual manera cada capítulo está dividido en etapas, que señalan las fases que se deben atravesar en el nivel local, para definir y ejecutar políticas públicas de Gestión Integrada de los Recursos Hídricos en los Gobiernos...

  10. The biomechanics study of rabbit osteoporosis models treated by 99Tcm-MDP combined with GuKangLing

    Gao Kejia; Zhao Guoding; Ye Zhiwei; Mei Xiaogang; Tian Yingmin; Yan Chushun; Wang Wei; Li Wei; Cai Zhengyu; Song Haiping

    2011-01-01

    Objective: To study the bone biomechanics of the rabbit osteoporosis models induced by dexamethasone sodium phosphate injection (DX) using a combined treatment modality of 99 Tc-MDP and GuKangLing. Methods: Rabbits were intramuscularly injected with DX (2 mg/kg) twice a week for 6 weeks. The animal osteoporosis model group (Group C) and normal group (Group A) were compared to confirm the model was available. Another control group (Group B), the osteoporosis control group (Group D) were set for the comparison at the end of the experiment. The 99 Tc-MDP therapy group (Group E), GuKangLing therapy group (Group F) and 99 Tc-MDP plus GuKangLing therapy group (Group G) were included in the study. The treatment lasted for 16 weeks. The bone biomechanics, cytopathology bone histomorphology, bone mineral density (BMD), X-ray, CT, bone scintigraphy and serum bone alkaline phosphatase (BALP) and P (bone gla protein) were chosen as the markers or methods to evaluate the treatment results (excellent, effective and invalid). The analysis of variance (ANOVA) and t-test were used for group comparison analysis. Results: Cytopathology result indicated that there was no bone trabecular destruction in Group A. However, there was distinct bone destruction in Group C. The bone biomechanics (left femur head (265.914 ±52.773) N, L 4 (369.671 ±94.919) N), BMD (left femur (0.238 ±0.016) g/cm 2 , L 4 (0.236 ±0.016) g/cm 2 ) and bone histomorphology ((66.230 ± 10.848)%) in Group C reduced clearly as compared with Group A ((405.343±55.410) N, (750.870±53.718) N, (0.294±0.017) g/cm 2 , (0.302±0.023) g/cm 2 , (131.500 ± 21.846)%) (t ≥4.550, all P<0.01). Radionuclide bone scan also showed that the uptake of tracers was higher by the main arthrosis in Group C than that in Group A. Vertebra was not clearly visualized on bone scan image. There were significant differences between Group A and Group C in serum BALP and P ((45.000±7.303) vs (12.485 ±1.512) U/L, (0.168±0.018) vs (0.115

  11. The association between Bacillus Calmette-Guérin vaccination (1331 SSI) skin reaction and subsequent scar development in infants

    Birk, Nina Marie; Nissen, Thomas Nørrelykke; Ladekarl, Monica

    2017-01-01

    BACKGROUND: The Bacillus Calmette-Guérin vaccine (BCG) against tuberculosis is administered intradermally, and vaccination is often followed by a scar at the injection site. Among BCG-vaccinated individuals, having a scar has been associated with lower mortality. We aimed to examine the impact...... of vaccination technique for scarring in a high income setting, by assessing the associations between the post injection reaction, the wheal size, and the probability of developing a scar, and scar size. METHODS: This study was nested within a clinical multicenter study randomizing 4262 infants to either BCG...... vaccination (BCG 1331 SSI) or no intervention. In this substudy, including 492 vaccinated infants, the immediate post BCG vaccination reaction was registered as either wheal (a raised, blanched papule at the injection site), bulge (a palpable element at the injection site), or no reaction. The presence...

  12. Use of LANDSAT 8 images for depth and water quality assessment of El Guájaro reservoir, Colombia

    González-Márquez, Luis Carlos; Torres-Bejarano, Franklin M.; Torregroza-Espinosa, Ana Carolina; Hansen-Rodríguez, Ivette Renée; Rodríguez-Gallegos, Hugo B.

    2018-03-01

    The aim of this study was to evaluate the viability of using Landsat 8 spectral images to estimate water quality parameters and depth in El Guájaro Reservoir. On February and March 2015, two samplings were carried out in the reservoir, coinciding with the Landsat 8 images. Turbidity, dissolved oxygen, electrical conductivity, pH and depth were evaluated. Through multiple regression analysis between measured water quality parameters and the reflectance of the pixels corresponding to the sampling stations, statistical models with determination coefficients between 0.6249 and 0.9300 were generated. Results indicate that from a small number of measured parameters we can generate reliable models to estimate the spatial variation of turbidity, dissolved oxygen, pH and depth, as well the temporal variation of electrical conductivity, so models generated from Landsat 8 can be used as a tool to facilitate the environmental, economic and social management of the reservoir.

  13. Bladder Contracture – A Rare and Serious Side Effect of Intravesical Bacillus Calmette-Guérin Therapy

    Cindy Garcia

    2016-01-01

    Full Text Available Instillation of intravesical bacillus Calmette-Guérin (BCG is an effective treatment for non-muscle invasive bladder cancer (NMIBC. The high incidence of side effects may limit its tolerability in patients. Local side effects including cystitis and hematuria are common but generally self-limiting. Bladder contractures are a rare but serious consequence of BCG treatment. In this case, an 82 year-old male developed BCG reactivation and subsequent bladder contractures following transurethral resection of the prostate (TURP three years post-BCG. To our knowledge, this is the first reported case of BCG reactivation post-TURP leading to the rare but serious effect of bladder contractures.

  14. Cooling Simulation and Thermal Abuse Modeling of Lithium-Ion Batteries Using the Newman, Tiedemann, Gu, and Kim (NTGK) Model

    Saeed Madani, Seyed; Swierczynski, Maciej Jozef; Kær, Søren Knudsen

    2017-01-01

    This paper gives insight into the cooling simulation and thermal abuse modeling of lithium-ion batteries by ANSYS FLUENT. Cooling strategies are important issues in the thermal management of lithium-ion battery systems, and it is essential to investigate them attentively in order to maintain...... the functioning temperature of batteries within an optimum range. The high temperature is able not only to decrease the efficiency of batteries but also may lead to the thermal runaway. To comprehend further, the thermal abuse behavior of lithium-ion batteries based on The Newman, Tiedemann, Gu, and Kim (NTGK......) model has been implemented in ANSYS FLUENT software. The results show that to achieve an optimum energy consumption for battery cooling, a minimum value of average heat transfer coefficient can be selected in order to keep the functioning temperature of batteries within an optimum range....

  15. Propuesta para el diseño de una guía didáctica en la disciplina Bioquímica

    Pedro Luis Bravo Hernández

    2017-01-01

    Conclusiones: Se obtuvo una guía didáctica con un enfoque sistemático donde el profesor va dosificando actividades docentes teniendo en cuenta los estilos de aprendizaje del grupo y dejando claro las condiciones de estudio y la ruta crítica para la revisión bibliográfica.

  16. Evaluation of Soil Erosion and Sediment Yield from Ridge Watersheds Leading to Guánica Bay, Puerto Rico, Using SWAT Model

    Increased sediment loading to reservoirs and, ultimately, to Guánica Bay and reef areas is a significant concern in Puerto Rico. Sediment deposition has significantly reduced storage capacity of reservoirs, and sediment-attached contaminants can stress corals and negative...

  17. Suurprojekt "Suveöö unenägu" saab kõrged hääled Eestist / Andres Laasik

    Laasik, Andres, 1960-2016

    2009-01-01

    Pärnu ooperifestivali korraldava Promfest ja Opera Studio Nederland poolt 2010. aasta suvel lavale toodavast ooperist "Suveöö unenägu", ooperit mängitakse 2. juulil Tallinnas ja 24. juulil Amsterdamis, lavastaja John Copley. Osatäitjate leidmiseks korraldatud katsetest

  18. Nosocomial Mycobacterium bovis-bacille Calmette-Guérin infections due to contamination of chemotherapeutics: case finding and route of transmission

    Vos, Margreet C.; de Haas, Petra E. W.; Verbrugh, Henri A.; Renders, Nicole H. M.; Hartwig, Nico G.; de Man, Peter; Kolk, Arend H. J.; van Deutekom, Henk; Yntema, J. L.; Vulto, Arnold G.; Messemaker, Marja; van Soolingen, Dick

    2003-01-01

    We studied nosocomial infections due to Mycobacterium bovis bacille Calmette-Guérin (BCG) Onco-TICE bacteria, transmitted by contamination of medication prepared in BCG Onco-TICE-contaminated hoods in the pharmacy, in 5 immunocompromised patients at 3 hospitals. The BCG strains cultured from the

  19. Ärkav kaunitar : I rahvusvaheline teatrifestival "Talveöö unenägu" 28. -31. XII 2000 Tallinna Linnateatris / Ene Paaver

    Paaver, Ene, 1963-

    2001-01-01

    Rahvusvaheline festival "Talveöö unenägu" Tallinna Linnateatris 28.- 30. dets. Lavastused : "K. I. Kuritööst" (lav. Kama Ginkas, Moskva Noorsooteater), "Gargantua ja Pantagruel" (lav. Stanislavas Rubinovas, Kaunase Noorsooteater), "Preili Pollinger" (lav. Edith Koerber, Saksa Tri-Bühne), "Rusudekorjajad" (lav. Nika Brettschneider, Viini Brett Theater)

  20. 78 FR 66945 - Proposed Collection; 60-Day Comment request: Gulf Long-Term Follow-Up Study (GuLF STUDY)

    2013-11-07

    ... GuLF STUDY is to investigate potential short- and long-term health effects associated with oil spill... non-Cleanup Workers Supplemental Mental Health 4,600 4 15/60 4,600 1,533 Telephone Questionnaire... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Proposed Collection; 60-Day...

  1. Linking ecosystem service supply to stakeholder concerns on both land and sea: An example from Guánica Bay watershed, Puerto Rico

    Policies to protect coastal resources may lead to greater social, economic, and ecological returns when they consider potential co-benefits and trade-offs on land. In Guánica Bay watershed, Puerto Rico, a watershed management plan is being implemented to restore declining quality...

  2. Guía para la tutorización de una actividad académicamente dirigida a través de Google Drive

    Iglesias Onofrio, Marcela; Martín Carballo, Margarita

    2016-01-01

    Guía para la tutorización de una actividad académicamente dirigida utilizando la herramienta Google Drive. En el documento se describen las indicaciones para que los alumnos y el docente compartan y editen de forma colaborativa un documento en Google Drive.

  3. Tracking Color Shift in Ballpoint Pen Ink Using Photoshop Assisted Spectroscopy: A Nondestructive Technique Developed to Rehouse a Nobel Laureate's Manuscript

    Wright, Kristi; Herro, Holly

    2016-01-01

    Many historically and culturally significant documents from the mid-to-late twentieth century were written in ballpoint pen inks, which contain light-sensitive dyes that present problems for collection custodians and paper conservators. The conservation staff at the National Library of Medicine (NLM), National Institutes of Health, conducted a multiphase project on the chemistry and aging of ballpoint pen ink that culminated in the development of a new method to detect aging of ballpoint pen ...

  4. Diagnostics of magnetized low temperature plasma by ball-pen probe

    Adámek, Jiří; Peterka, M.; Gyergyek, T.; Kudrna, P.; Tichý, M.

    2012-01-01

    Roč. 57, č. 2 (2012), s. 297-300 ISSN 0029-5922. [International Conference on Research and Applications of Plasmas (PLASMA). Warsaw, 12.09.2011-16.09.2011] R&D Projects: GA ČR GA202/07/0044; GA AV ČR KJB100430901 Institutional research plan: CEZ:AV0Z20430508 Keywords : ball- pen probe * magnetron Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.507, year: 2012 http://www.nukleonika.pl/www/back/full/vol57_2012/v57n2p297f.pdf

  5. Ball-Pen Probe Measurements in L-Mode and H-Mode on ASDEX Upgrade

    Adámek, Jiří; Horáček, Jan; Müller, H. W.; Rohde, V.; Ionita, C.; Schrittwieser, R.; Mehlmann, F.; Kurzan, B.; Stöckel, Jan; Dejarnac, Renaud; Weinzettl, Vladimír; Seidl, Jakub; Peterka, M.

    2010-01-01

    Roč. 50, č. 9 (2010), s. 854-859 ISSN 0863-1042. [International Workshop on Electric Probes in Magnetized Plasmas/8th./. Innsbruck, 21.09.2009-24.09.2009] R&D Projects: GA AV ČR KJB100430901; GA ČR GA202/09/1467 Institutional research plan: CEZ:AV0Z20430508 Keywords : Tokamak * ball- pen probe * electron temperature * L-mode * H-mode * ELMs Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.006, year: 2010 http://onlinelibrary.wiley.com/doi/10.1002/ctpp.201010145/pdf

  6. Retroperitoneal migration of a self-inflicted ballpoint pen via the urethra

    Jose Cury

    2006-04-01

    Full Text Available Numerous accounts documenting the introduction of foreign bodies into the urinary bladder have been reported. These foreign bodies are typically self-inserted via urethral but migration from adjacent organs by an ulcerative process and penetrating injuries are also reported. However, "contrary" migration of a self-inflicted vesical foreign body to the retroperitoneum was not previously reported in literature. We report here a case of a ballpoint pen self-inserted via urethral by a female patient, which was identified in retroperitoneal position years later.

  7. Fiber supercapacitors utilizing pen ink for flexible/wearable energy storage.

    Fu, Yongping; Cai, Xin; Wu, Hongwei; Lv, Zhibin; Hou, Shaocong; Peng, Ming; Yu, Xiao; Zou, Dechun

    2012-11-08

    A novel type of flexible fiber/wearable supercapacitor that is composed of two fiber electrodes - a helical spacer wire and an electrolyte - is demonstrated. In the carbon-based fiber supercapacitor (FSC), which has high capacitance performance, commercial pen ink is directly utilized as the electrochemical material. FSCs have potential benefits in the pursuit of low-cost, large-scale, and efficient flexible/wearable energy storage systems. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Fiber supercapacitors utilizing pen ink for flexible/wearable energy storage

    Fu, Yongping; Cai, Xin; Wu, Hongwei; Lv, Zhibin; Hou, Shaocong; Peng, Ming; Yu, Xiao; Zou, Dechun [Beijing National Laboratory for Molecular Sciences, Key Laboratory of Polymer Chemistry and Physics of the Ministry of Education, College of Chemistry and Molecular Engineering, Peking University, Beijing (China)

    2012-11-08

    A novel type of flexible fiber/wearable supercapacitor that is composed of two fiber electrodes - a helical spacer wire and an electrolyte - is demonstrated. In the carbon-based fiber supercapacitor (FSC), which has high capacitance performance, commercial pen ink is directly utilized as the electrochemical material. FSCs have potential benefits in the pursuit of low-cost, large-scale, and efficient flexible/wearable energy storage systems. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  9. Erosion behavior of W-Ta coatings in plasmas of stationary mirror penning discharges

    Belous, V.A.; Bondarenko, M.N.; Glazunov, G.P.; Ilchenko, A.V.; Kuprin, A.S.; Konotopskiy, A.L.; Lunyov, V.M.; Ovcharenko, V.D.

    2016-01-01

    Investigations had been carried out of the influence of Ta alloying (2...16 wt.%) in W-coatings on their erosion behavior in steady state plasmas of Penning discharges in different gases: argon, nitrogen, and hydrogen. The coatings were deposited on stainless steel substrates by argon ion sputtering of targets made from appropriate metals. For comparison the erosion behavior had been examined of pure W and Ta coatings obtained by the same method. It was shown the essential decrease of an erosion rate after Ta addition in W coatings. The possible physical mechanism is suggested to explain such erosion behavior

  10. The Islamic connotation in the Gematric pen-names of Franqois Rabelais

    Tine Kurent

    1991-12-01

    Full Text Available François Rabelais signed his books on Gargantua et Pantagruel with pen­ names. The gematric value of his pseudonyms, NASIER, M. ALCOFRIBAS, and ALCOFRIBAS NASIER, are 66, 99 and 152, respectively. With numbers 66 and 99, Rabelais identified himself as the Apocalyptic beast, according to the report by St, John the Divine: And I beheld another beast coming up out of the earth; and he had horns like a lamb. The ram's and buck's horns are indeed similar to the Indian figures 66 and 99.

  11. Torre de Oficinas en la Península de Zorrotzaure, Bilbao.

    Hevia Sánchez, Raúl de

    2015-01-01

    El proyecto se encuadra dentro de la península de Zorrotzaure, una zona industrial degradada en la que apenas hay hoy actividad. El alcance de este estudio es plantear diversas soluciones estructurales para el edificio que se planea construir y elegir la más adecuada atendiendo a conceptos tales como económicos, de plazo, funcionales y ambientales. El área no ocupada por la torre se destinará a aparcamientos, accesos y zonas verdes. Se planea construir una zona de aparcamiento para los trabaj...

  12. High-accuracy mass determination of unstable nuclei with a Penning trap mass spectrometer

    2002-01-01

    The mass of a nucleus is its most fundamental property. A systematic study of nuclear masses as a function of neutron and proton number allows the observation of collective and single-particle effects in nuclear structure. Accurate mass data are the most basic test of nuclear models and are essential for their improvement. This is especially important for the astrophysical study of nuclear synthesis. In order to achieve the required high accuracy, the mass of ions captured in a Penning trap is determined via their cyclotron frequency $ \

  13. A cylindrical Penning trap for capture, mass selective cooling, and bunching of radioactive ion beams

    Raimbault-Hartmann, H.; Bollen, G.; Beck, D.; Koenig, M.; Kluge, H.-J.; Schwarz, S.; Schark, E.; Stein, J.; Szerypo, J.

    1997-01-01

    A Penning trap ion accumulator, cooler, and buncher for low-energy ion beams has been developed for the ISOLTRAP mass spectrometer at ISOLDE/CERN. A cylindrical electrode configuration is used for the creation of a nested trapping potential. This is required for efficient accumulation of externally produced ions and for high-mass selectivity by buffer gas cooling. The design goal of a mass resolving power of about 1 x 10 5 has been achieved. Isobar separation has been demonstrated for radioactive rare-earth ion beams delivered by the ISOLDE on-line mass separator. (orig.)

  14. A cylindrical Penning trap for capture, mass selective cooling, and bunching of radioactive ion beams

    Raimbault-Hartmann, H; Bollen, G; König, M; Kluge, H J; Schark, E; Stein, J; Schwarz, S; Szerypo, J

    1997-01-01

    A Penning trap ion accumulator, cooler, and buncher for low energy ion beams has been developed for the ISOLTRAP mass spectrometer at ISOLDE/CERN. A cylindrical electrode configuration is used for the creation of a nested trapping potential. This is required for efficient accumulation of externally produced ions and for high mass selectivity by buffer gas cooling. The design goal of a mass resolving power of about $1\\cdot 10^{5}$ has been achieved. Isobar separation has been demonstrated for radioactive rare earth ion beams delivered by the ISOLDE on-line mass separator.

  15. First simultaneous measurements of Reynolds stress with ball-pen and Langmuir probes

    Grover, Ondřej; Adámek, Jiří; Seidl, Jakub; Devitre, A.; Šos, Miroslav; Vondráček, Petr; Bílková, Petra; Hron, Martin

    2017-01-01

    Roč. 88, č. 6 (2017), č. článku 063501. ISSN 0034-6748 R&D Projects: GA ČR(CZ) GA15-10723S; GA ČR(CZ) GA16-25074S; GA MŠk(CZ) LM2015045 Institutional support: RVO:61389021 Keywords : COMPASS tokamak * Electric field effects * Electric fields * Langmuir probes * Magnetoplasma * Ball-pen probes Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: 2.11 Other engineering and technologies Impact factor: 1.515, year: 2016 http://aip.scitation.org/doi/full/10.1063/1.4984240

  16. Operation of a Dudnikov type Penning source with LaB/sub 6/ cathodes

    Leung, K.N.; DeVries, G.J.; Ehlers, K.W.

    1986-10-01

    The Dudnikov type Penning source has been operated successfully with LaB 6 cathodes in a cesium-free discharge. It is found that the extracted H - current density is comparable to that of the cesium-mode operation and H - current density of 350 mA/cm 2 have been obtained for an arc current of 55 A. The H - yield is closely related to the source geometry and the applied magnetic field. Experimental results demonstrate that the majority of the H - ions extracted are formed by volume processes in this type of source operation

  17. A new pen device for injection of recombinant human growth hormone: a convenience, functionality and usability evaluation study

    Sauer M

    2017-12-01

    Full Text Available   Maritta Sauer,1 Carole Abbotts2 1Global Strategic Insights, Merck KGaA, Darmstadt, Germany; 2Pharmaceutical Market Research Consultant, London, UK Purpose: Adherence to recombinant human growth hormone (r-hGH is critical to growth and other outcomes in patients with growth disorders, but the requirement for daily injections means that ease of use is an important factor. This study assessed the perceived ease of use and functionality of the prototype of a reusable pen injector (pen device for r-hGH that incorporates several advanced features. Participants and methods: Semi-structured 60-minute qualitative interviews were conducted in 5 countries with 57 health care professionals (HCPs and 30 patients with GH deficiency/caregivers administering r-hGH to patients, including children. HCPs had to be responsible for training in the use of r-hGH pen devices and to see ≥4 r-hGH patients/caregivers per month. Patients/caregivers had to have experience with r-hGH administration for at least 6 months.Results: Thirty-seven (65% of HCPs described the pen device as “simple” or “easy” to use. The aluminum body was generally perceived as attractive, high quality and comfortable to hold and operate. The ease of preparation and use made it suitable for both children and adults. The ability to dial back the r-hGH dose, if entered incorrectly, was mentioned as a major benefit, because other devices need several user steps to reset. Patients/caregivers felt the pen device was easy to use and the injection-feedback features reassured them that the full dose had been given. Overall, 40 (70% HCPs and 16 (52% patients/caregivers were likely to recommend or request the pen device. Moreover, patients/caregivers rated the pen device higher than their current reusable pens and almost equal to the leading disposable device for ease of learning, preparation, administration and ease of use.Conclusion: The prototype pen device successfully met its design

  18. Gradual training of alpacas to the confinement of metabolism pens reduces stress when normal excretion behavior is accommodated.

    Lund, Kirrin E; Maloney, Shane K; Milton, John T B; Blache, Dominique

    2012-01-01

    Confinement in metabolism pens may provoke a stress response in alpacas that will reduce the welfare of the animal and jeopardize the validity of scientific results obtained in such pens. In this study, we tested a protocol designed to successfully train alpacas to be held in a specially designed metabolism pen so that the animals' confinement would not jeopardize their welfare. We hypothesized that the alpacas would show fewer behaviors associated with a response to stress as training gradually progressed, and that they would adapt to being in the confinement of the metabolism pen. The training protocol was successful at introducing alpacas to the metabolism pens, and it did reduce the incidence of behavioral responses to stress as the training progressed. The success of the training protocol may be attributed to the progressive nature of the training, the tailoring of the protocol to suit alpacas, and the use of positive reinforcement. This study demonstrated that both animal welfare and the validity of the scientific outcomes could be maximized by the gradual training of experimental animals, thereby minimizing the stress imposed on the animals during experimental procedures.

  19. Forensic Analysis of Blue Ball point Pen Inks on Questioned Documents by High Performance Thin Layer Chromatography Technique (HPTLC)

    Lee, L.C.; Siti Mariam Nunurung; Abdul Aziz Ishak

    2014-01-01

    Nowadays, crimes related to forged documents are increasing. Any erasure, addition or modification in the document content always involves the use of writing instrument such as ball point pens. Hence, there is an evident need to develop a fast and accurate ink analysis protocol to solve this problem. This study is aimed to determine the discrimination power of high performance thin layer chromatography (HPTLC) technique for analyzing a set of blue ball point pen inks. Ink samples deposited on paper were extracted using methanol and separated via a solvent mixture of ethyl acetate, methanol and distilled water (70: 35: 30, v/ v/ v). In this method, the discrimination power of 89.40 % was achieved, which confirm that the proposed method was able to differentiate a significant number of pen-pair samples. In addition, composition of blue pen inks was found to be homogeneous (RSD < 2.5 %) and the proposed method showed good repeatability and reproducibility (RSD < 3. 0%). As a conclusion, HPTLC is an effective tool to separate blue ball point pen inks. (author)

  20. [Effects of large bio-manipulation fish pen on community structure of crustacean zooplankton in Meiliang Bay of Taihu Lake].

    Ke, Zhi-Xin; Xie, Ping; Guo, Long-Gen; Xu, Jun; Zhou, Qiong

    2012-08-01

    In 2005, a large bio-manipulation pen with the stock of silver carp and bighead carp was built to control the cyanobacterial bloom in Meiliang Bay of Taihu Lake. This paper investigated the seasonal variation of the community structure of crustacean zooplankton and the water quality within and outside the pen. There were no significant differences in the environmental parameters and phytoplankton biomass within and outside the pen. The species composition and seasonal dynamics of crustacean zooplankton within and outside the pen were similar, but the biomass of crustacean zooplankton was greatly suppressed by silver carp and bighead carp. The total crustacean zooplankton biomass and cladocerans biomass were significantly lower in the pen (P < 0.05). In general, silver carp and bighead carp exerted more pressure on cladoceran species than on copepod species. A distinct seasonal succession of crustacean zooplankton was observed in the Bay. Many crustacean species were only dominated in given seasons. Large-sized crustacean (mainly Daphnia sp. and Cyclops vicnus) dominated in winter and spring, while small-sized species (mainly Bosmina sp., Ceriodaphnia cornuta, and Limnoithona sinensis) dominated in summer and autumn. Canonical correspondence analysis showed that water transparency, temperature, and phytoplankton biomass were the most important factors affecting the seasonal succession of the crustacean.

  1. Influence of Penning effect on the plasma features in a non-equilibrium atmospheric pressure plasma jet

    Chang, Zhengshi; Zhang, Guanjun [School of Electrical Engineering, Xi' an Jiaotong University, Xi' an 710049 (China); Jiang, Nan; Cao, Zexian, E-mail: zxcao@iphy.ac.cn [Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China)

    2014-03-14

    Non-equilibrium atmospheric pressure plasma jet (APPJ) is a cold plasma source that promises various innovative applications. The influence of Penning effect on the formation, propagation, and other physical properties of the plasma bullets in APPJ remains a debatable topic. By using a 10 cm wide active electrode and a frequency of applied voltage down to 0.5 Hz, the Penning effect caused by preceding discharges can be excluded. It was found that the Penning effect originating in a preceding discharge helps build a conductive channel in the gas flow and provide seed electrons, thus the discharge can be maintained at a low voltage which in turn leads to a smaller propagation speed for the plasma bullet. Photographs from an intensified charge coupled device reveal that the annular structure of the plasma plume for He is irrelevant to the Penning ionization process arising from preceding discharges. By adding NH{sub 3} into Ar to introduce Penning effect, the originally filamentous discharge of Ar can display a rather extensive plasma plume in ambient as He. These results are helpful for the understanding of the behaviors of non-equilibrium APPJs generated under distinct conditions and for the design of plasma jet features, especially the spatial distribution and propagation speed, which are essential for application.

  2. Pen-on-paper strategy for point-of-care testing: Rapid prototyping of fully written microfluidic biosensor.

    Li, Zedong; Li, Fei; Xing, Yue; Liu, Zhi; You, Minli; Li, Yingchun; Wen, Ting; Qu, Zhiguo; Ling Li, Xiao; Xu, Feng

    2017-12-15

    Paper-based microfluidic biosensors have recently attracted increasing attentions in point-of-care testing (POCT) territories benefiting from their affordable, accessible and eco-friendly features, where technologies for fabricating such biosensors are preferred to be equipment free, easy-to-operate and capable of rapid prototyping. In this work, we developed a pen-on-paper (PoP) strategy based on two custom-made pens, i.e., a wax pen and a conductive-ink pen, to fully write paper-based microfluidic biosensors through directly writing both microfluidic channels and electrodes. Particularly, the proposed wax pen is competent to realize one-step fabrication of wax channels on paper, as the melted wax penetrates into paper during writing process without any post-treatments. The practical applications of the fabricated paper-based microfluidic biosensors are demonstrated by both colorimetric detection of Salmonella typhimurium DNA with detection limit of 1nM and electrochemical measurement of glucose with detection limit of 1mM. The developed PoP strategy for making microfluidic biosensors on paper characterized by true simplicity, prominent portability and excellent capability for rapid prototyping shows promising prospect in POCT applications. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Preliminary study for the National Energy Plan (PEN) uses the Community market as a reference base. El ante-proyecto del Plan Energetico Nacional (PEN) toma referencia basica del mercado comunitario

    1991-11-01

    The National Energy Plan (PEN) for the period 1991 to 2000 lays down basic guidelines for a Spanish energy policy. This includes a wide range of economic measures. The PEN is divided into five main sections with two appendices. The sections are: the international situation; energy demand; energy supply; energy and the environment; and R D policy. The appendices are: Energy-saving and energy-efficiency plan; and General plan for radioactive waste. The PEN provides for 4-year research programmes which aim to reduce the environmental impact of energy production and use. General demand for energy during this period will increase by2.4% and investment in power installations and in the gas sector will be some 1.5 thousand million pesetas. 4 figs., 3 tabs.

  4. Preferences of lame cows for type of surface and level of social contact in hospital pens

    Jensen, Margit Bak; Herskin, Mette S; Thomsen, Peter T.

    2015-01-01

    To investigate preferences of lame cows for flooring and level of social contact, 37 lame, lactating dairy cows (diagnosed with sole ulcer or white line disease) were housed individually for 6 d in experimental hospital pens, where they could choose between 2 equally sized areas (6m × 4.5m......) with either deep-bedded sand or a rubber surface. On both surfaces, cows could choose between 2 equally sized areas either near or away from heifers in a neighboring group pen. Cows spent more time lying on the deep-bedded sand than on the rubber surface (870 vs. 71min/d), whereas they spent less time upright...... (standing or walking) on the sand than on the rubber surface (180 vs. 319min/d). In addition, cows spent less time self-grooming on the sand than on the rubber surface (2.2 vs. 4.7% of time spent upright). With regard to level of social contact, cows spent more time near the neighboring heifers than away...

  5. Preparation of a tritium Q-value measurement in a double penning trap

    Diehl, Christoph; Orth, Christoph; Blaum, Klaus [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Physikalisches Institut, Ruprecht-Karls-Universitaet, Heidelberg (Germany); Pinegar, David [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Van Dyck, Robert Jr. [Department of Physics, University of Washington, Seattle (United States)

    2009-07-01

    A precise determination of the Q-value of tritium ({sup 3}H) is of relevance for the determination of the electron anti-neutrino mass as aspired by the Karlsruhe Tritium Neutrino Experiment (KATRIN). In our double Penning trap mass spectrometer we aim to measure the mass ratio of {sup 3}H and its {beta}-decay product {sup 3}He to an accuracy of 10{sup -11}, which would determine the Q-value to an accuracy of 30 meV. The spectrometer we utilize is an enhanced version of the University of Washington Penning trap mass spectrometer (UW-PTMS) and was recently transfered from Seattle to Heidelberg, where it is set up at the moment as the MPIK/UW-PTMS. We present the necessary preparation work at the Max-Planck-Institut fuer Kernphysik. This includes major reconstructions of the building as well as studies and control of environmental parameters in the laboratory, like temperature and magnetic field.

  6. Marker Pen Lithography for Flexible and Curvilinear On-Chip Energy Storage

    Jiang, Qiu

    2015-07-14

    On-chip energy storage using microsupercapacitors can serve the dual role of supplementing batteries for pulse power delivery, and replacement of bulky electrolytic capacitors in ac-line filtering applications. Despite complexity and processing costs, microfabrication techniques are being employed in fabricating a great variety of microsupercapacitor devices. Here, a simple, cost-effective, and versatile strategy is proposed to fabricate flexible and curvilinear microsupercapacitors (MSCs). The protocol involves writing sacrificial ink patterns using commercial marker pens on rigid, flexible, and curvilinear substrates. It is shown that this process can be used in both lift-off and etching modes, and the possibility of multistack design of active materials using simple pen lithography is demonstrated. As a prototype, this method is used to produce conducting polymer MSCs involving both poly(3,4-ethylenedioxythiophene), polyaniline, and metal oxide (MnO2) electrode materials. Typical values of energy density in the range of 5-11 mWh cm-3 at power densities of 1-6 W cm-3 are achieved, which is comparable to thin film batteries and superior to the carbon and metal oxide based microsupercapacitors reported in the literature. The simplicity and broad scope of this innovative strategy can open up new avenues for easy and scalable fabrication of a wide variety of on-chip energy storage devices. © 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim.

  7. Behavior of many ions in a Penning trap and results of the WITCH experiment

    Porobic, Tomica

    Precision measurements of the beta−neutrino angular correlation in nuclear beta-decay provide a unique window into the physics beyond the Standard model. The WITCH (Weak Interaction Trap for CHarged particles) experiment aims to measure this correlation, a(beta-nu), in order to impose a more stringent constraint on the exotic scalar current admixture in the beta-decay Hamiltonian. The apparatus is situated at CERN/ISOLDE laboratory and consists of a unique combination of a retardation spectrometer and two Penning traps, with one of them serving as a scattering-free source. This configuration is suited for a precise measurement of the energy spectrum of 35Ar recoiled daughter ions. The shape of the spectrum then allows a determination of a(beta-nu) and consequently of the presence or absence of a scalar current. Radioactive 35Ar ions are created at ISOLDE by impinging 1.2 GeV protons on the target material. After being separated by a magnetic separator and bunched by REXTRAP, a high-capacity Penning trap, th...

  8. Ion bunch stacking in a Penning trap after purification in an electrostatic mirror trap

    Rosenbusch, M; Blaum, K; Borgmann, Ch; Kreim, S; Lunney, D; Manea, V; Schweikhard, L; Wienholtz, F; Wolf, R N

    2014-01-01

    The success of many measurements in analytical mass spectrometry as well as in precision mass determinations for atomic and nuclear physics is handicapped when the ion sources deliver ``contaminations'', i.e., unwanted ions of masses similar to those of the ions of interest. In particular, in ion-trapping devices, large amounts of contaminant ions result in significant systematic errors-if the measurements are possible at all. We present a solution for such cases: The ions from a quasi-continuous source are bunched in a linear radio-frequency-quadrupole ion trap, separated by a multi-reflection time-of-flight section followed by a Bradbury-Nielsen gate, and then captured in a Penning trap. Buffer-gas cooling is used to damp the ion motion in the latter, which allows a repeated opening of the Penning trap for a stacking of mass-selected ion bunches. Proof-of-principle demonstrations have been performed with the ISOLTRAP setup at ISOLDE/CERN, both with Cs-133(+) ions from an off-line ion source and by applicati...

  9. Estructuras de fondo rehundido altomedievales en la Península Ibérica

    TEJERIZO GARCÍA, C.

    2014-01-01

    Full Text Available La presencia de estructuras de fondo rehundido en contextos arqueológicos altomedievales está ampliamente documentada en toda Europa y cuenta con una dilatada historiografía. En la Península Ibérica, asociado a la expansión urbanística, se ha podido detectar un conjunto muy significativo de estas estructuras. Sin embargo, la falta de sistematización y análisis ha llevado a algunos problemas en su detección y documentación, así como a excesos conceptuales y de interpretación. En este trabajo se realiza una recopilación analítica de las evidencias de estructuras de fondo rehundido de época altomedieval presentes en la Península Ibérica mostrando su alta complejidad y diversidad. Basado en un análisis de la evidencia disponible, y frente a las tesis etnicistas que las vinculan a la llegada de grupos alóctonos, se propone una interpretación relacionada con el desarrollo de un modo de producción campesino tras la desarticulación de la economía imperial romana.

  10. Gesture language use in natural UI: pen-based sketching in conceptual design

    Ma, Cuixia; Dai, Guozhong

    2003-04-01

    Natural User Interface is one of the important next generation interactions. Computers are not just the tools of many special people or areas but for most people. Ubiquitous computing makes the world magic and more comfortable. In the design domain, current systems, which need the detail information, cannot conveniently support the conceptual design of the early phrase. Pen and paper are the natural and simple tools to use in our daily life, especially in design domain. Gestures are the useful and natural mode in the interaction of pen-based. In natural UI, gestures can be introduced and used through the similar mode to the existing resources in interaction. But the gestures always are defined beforehand without the users' intention and recognized to represent something in certain applications without being transplanted to others. We provide the gesture description language (GDL) to try to cite the useful gestures to the applications conveniently. It can be used in terms of the independent control resource such as menus or icons in applications. So we give the idea from two perspectives: one from the application-dependent point of view and the other from the application-independent point of view.

  11. PENTATRAP. A novel Penning-trap system for high-precision mass measurements

    Doerr, Andreas

    2015-01-21

    The novel Penning-trap mass spectrometer PENTATRAP aims at mass-ratio determinations of medium-heavy to heavy ions with relative uncertainties below 10{sup -11}. From the mass ratios of certain ion species, the corresponding mass differences will be determined with sub-eV/c{sup 2} uncertainties. These mass differences are relevant for neutrino-mass experiments, a test of special relativity and tests of bound-state QED. Means to obtain the required precision are very stable trapping fields, the use of highly-charged ions produced by EBITs, a non-destructive cyclotron-frequency determination scheme employing detectors with single-ion sensitivity and a five-trap tower, that allows for measurement schemes being insensitive to magnetic field drifts. Within this thesis, part of the detection electronics was set up and tested under experimental conditions. A single-trap setup was realized. A Faraday cup in the trap tower enabled the proper adjustment of the settings of the beamline connecting the EBIT and the Penning-trap system, resulting in the first trapping of ions at PENTATRAP. A stabilization of switched voltages in the beamline and detailed studies of ion bunch characteristics allowed for reproducible loading of only a few ions. Detection of the axial oscillation of the trapped ions gave hints that in some cases, even single ions had been trapped. Furthermore, valuable conclusions about necessary modifications of the setup could be drawn.

  12. Profile measurements in the plasma edge of mega amp spherical tokamak using a ball pen probe

    Walkden, N. R.; Adamek, J.; Komm, M.; Allan, S.; Elmore, S.; Fishpool, G.; Harrison, J.; Kirk, A.; Dudson, B. D.

    2015-01-01

    The ball pen probe (BPP) technique is used successfully to make profile measurements of plasma potential, electron temperature, and radial electric field on the Mega Amp Spherical Tokamak. The potential profile measured by the BPP is shown to significantly differ from the floating potential both in polarity and profile shape. By combining the BPP potential and the floating potential, the electron temperature can be measured, which is compared with the Thomson scattering (TS) diagnostic. Excellent agreement between the two diagnostics is obtained when secondary electron emission is accounted for in the floating potential. From the BPP profile, an estimate of the radial electric field is extracted which is shown to be of the order ∼1 kV/m and increases with plasma current. Corrections to the BPP measurement, constrained by the TS comparison, introduce uncertainty into the E R measurements. The uncertainty is most significant in the electric field well inside the separatrix. The electric field is used to estimate toroidal and poloidal rotation velocities from E × B motion. This paper further demonstrates the ability of the ball pen probe to make valuable and important measurements in the boundary plasma of a tokamak

  13. Profile measurements in the plasma edge of mega amp spherical tokamak using a ball pen probe

    Walkden, N. R.; Adamek, J.; Allan, S.; Dudson, B. D.; Elmore, S.; Fishpool, G.; Harrison, J.; Kirk, A.; Komm, M.

    2015-02-01

    The ball pen probe (BPP) technique is used successfully to make profile measurements of plasma potential, electron temperature, and radial electric field on the Mega Amp Spherical Tokamak. The potential profile measured by the BPP is shown to significantly differ from the floating potential both in polarity and profile shape. By combining the BPP potential and the floating potential, the electron temperature can be measured, which is compared with the Thomson scattering (TS) diagnostic. Excellent agreement between the two diagnostics is obtained when secondary electron emission is accounted for in the floating potential. From the BPP profile, an estimate of the radial electric field is extracted which is shown to be of the order ˜1 kV/m and increases with plasma current. Corrections to the BPP measurement, constrained by the TS comparison, introduce uncertainty into the ER measurements. The uncertainty is most significant in the electric field well inside the separatrix. The electric field is used to estimate toroidal and poloidal rotation velocities from E × B motion. This paper further demonstrates the ability of the ball pen probe to make valuable and important measurements in the boundary plasma of a tokamak.

  14. Profile measurements in the plasma edge of mega amp spherical tokamak using a ball pen probe

    Walkden, N. R., E-mail: nrw504@york.ac.uk [CCFE, Culham Science Centre, Abingdon,Oxon OX14 3DB (United Kingdom); Department of Physics, York Plasma Institute, University of York, Heslington, York YO10 5DD (United Kingdom); Adamek, J.; Komm, M. [Institute of Plasma Physics of AS CR, v. v. i., Za Slovankou 3, 182 00 Praha 8 (Czech Republic); Allan, S.; Elmore, S.; Fishpool, G.; Harrison, J.; Kirk, A. [CCFE, Culham Science Centre, Abingdon,Oxon OX14 3DB (United Kingdom); Dudson, B. D. [Department of Physics, York Plasma Institute, University of York, Heslington, York YO10 5DD (United Kingdom)

    2015-02-15

    The ball pen probe (BPP) technique is used successfully to make profile measurements of plasma potential, electron temperature, and radial electric field on the Mega Amp Spherical Tokamak. The potential profile measured by the BPP is shown to significantly differ from the floating potential both in polarity and profile shape. By combining the BPP potential and the floating potential, the electron temperature can be measured, which is compared with the Thomson scattering (TS) diagnostic. Excellent agreement between the two diagnostics is obtained when secondary electron emission is accounted for in the floating potential. From the BPP profile, an estimate of the radial electric field is extracted which is shown to be of the order ∼1 kV/m and increases with plasma current. Corrections to the BPP measurement, constrained by the TS comparison, introduce uncertainty into the E{sub R} measurements. The uncertainty is most significant in the electric field well inside the separatrix. The electric field is used to estimate toroidal and poloidal rotation velocities from E × B motion. This paper further demonstrates the ability of the ball pen probe to make valuable and important measurements in the boundary plasma of a tokamak.

  15. Marker Pen Lithography for Flexible and Curvilinear On-Chip Energy Storage

    Jiang, Qiu; Kurra, Narendra; Alshareef, Husam N.

    2015-01-01

    On-chip energy storage using microsupercapacitors can serve the dual role of supplementing batteries for pulse power delivery, and replacement of bulky electrolytic capacitors in ac-line filtering applications. Despite complexity and processing costs, microfabrication techniques are being employed in fabricating a great variety of microsupercapacitor devices. Here, a simple, cost-effective, and versatile strategy is proposed to fabricate flexible and curvilinear microsupercapacitors (MSCs). The protocol involves writing sacrificial ink patterns using commercial marker pens on rigid, flexible, and curvilinear substrates. It is shown that this process can be used in both lift-off and etching modes, and the possibility of multistack design of active materials using simple pen lithography is demonstrated. As a prototype, this method is used to produce conducting polymer MSCs involving both poly(3,4-ethylenedioxythiophene), polyaniline, and metal oxide (MnO2) electrode materials. Typical values of energy density in the range of 5-11 mWh cm-3 at power densities of 1-6 W cm-3 are achieved, which is comparable to thin film batteries and superior to the carbon and metal oxide based microsupercapacitors reported in the literature. The simplicity and broad scope of this innovative strategy can open up new avenues for easy and scalable fabrication of a wide variety of on-chip energy storage devices. © 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim.

  16. A method of measurement of lifetimes of excited ion levels, using orientation transfer by Penning collisions

    Hamel, J.; Barrat, J.-P.

    1978-01-01

    A method for measuring the lifetimes of ionic excited levels is described. This method uses the transfer of coherence in a Penning collision using metastable optically oriented He 2 3 S 1 atoms. If R.F. transitions are induced in the (2 3 S 1 )He level, a transverse component of the magnetic moment of this level is created, which precesses coherently at the angular frequency ω of the R.F. field. The helium transverse orientation is partially transferred to the ions produced by Penning collisions. After the collision, the orientation transferred precesses around the external magnetic field at the Larmor frequency ω 0 ' of the ion excited level. The degree of orientation of the excited ion level depends, in the stationary state, on the average phase shift, during the lifetime tau prime of this level, between the Larmor precession at angular frequency ω 0 ' and the forced precession of helium (at angular frequency ω). The orientation of the ions is monitored by the modulation of the light emitted during their radiative decay. It is possible to determine the lifetime tau prime by measuring the degree of modulation of the reemitted light as a function of ω [fr

  17. [A comparison of rebound tonometry (ICare) with TonoPenXL and Goldmann applanation tonometry].

    Schreiber, W; Vorwerk, C K; Langenbucher, A; Behrens-Baumann, W; Viestenz, A

    2007-04-01

    Goldmann applanation tonometry and dynamic contour tonometry (PASCAL) are two well established slit lamp mounted tonometric methods. Intraocular pressure measurement in bedridden patients and children is often only possible using hand held tonometers (TonoPenXL, Perkins tonometer, Draeger tonometer). This study was performed to evaluate the hand held ICare tonometer, which is based on the rebound method. A total of 102 eyes were examined by two highly experienced ophthalmologists for: 1) ophthalmological status, 2) central corneal power (Zeiss IOL-Master), 3) central corneal thickness (Tomey ultrasound pachymetry, five successive measurements, SDr=0.592-0.642; p<0.001). There was a great intra-individual variability of up to 17 mmHg between the GAT, TonoPenXL and ICare methods. The ICare tonometer is easy to handle and high reliability. The data are comparable with those from the Goldmann tonometer. A tonography effect of 0.6 mmHg in the successive measurement series was found.

  18. Quantum simulation of the integer factorization problem: Bell states in a Penning trap

    Rosales, Jose Luis; Martin, Vicente

    2018-03-01

    The arithmetic problem of factoring an integer N can be translated into the physics of a quantum device, a result that supports Pólya's and Hilbert's conjecture to demonstrate Riemann's hypothesis. The energies of this system, being univocally related to the factors of N , are the eigenvalues of a bounded Hamiltonian. Here we solve the quantum conditions and show that the histogram of the discrete energies, provided by the spectrum of the system, should be interpreted in number theory as the relative probability for a prime to be a factor candidate of N . This is equivalent to a quantum sieve that is shown to require only o (ln√{N}) 3 energy measurements to solve the problem, recovering Shor's complexity result. Hence the outcome can be seen as a probability map that a pair of primes solve the given factorization problem. Furthermore, we show that a possible embodiment of this quantum simulator corresponds to two entangled particles in a Penning trap. The possibility to build the simulator experimentally is studied in detail. The results show that factoring numbers, many orders of magnitude larger than those computed with experimentally available quantum computers, is achievable using typical parameters in Penning traps.

  19. Comparison of filters: Inkjet printed on PEN substrate versus a laser-etched on LCP substrate

    Arabi, Eyad A.

    2014-10-01

    In this paper, microstrip-based bandpass filters on polyethylene naphthalate (PEN) and liquid crystal polymers (LCP) are presented to investigate the performance of filters on ultra-thin substrates. PEN (with a thickness of 120 μm) has been characterized and used for a filter for the first time. In addition to being low cost and transparent, it demonstrates comparable RF performance to LCP. The conductor losses are compared by fabricating filters with inkjet printed lines as well as laser etched copper clad LCP sheets. With 5 layers of inkjet printing, and a curing temperature below 200°C, a final silver thickness of 2 μm and conductivity of 9.6 × 106 S/m are achieved. The designs are investigated at two frequencies, 24 GHz as well as 5 GHz to assess their performance at high and low frequencies respectively. The 24 GHz inkjet printed filter shows an insertion loss of 2 dB, while the 5 GHz design gives an insertion loss of 8 dB. We find that thin substrates have a strong effect on the insertion loss of filters especially as the frequency is reduced. The same design, realized on LCP (thickness of 100 μm) through laser etching, demonstrates a very similar performance, thus verifying this finding. © 2014 European Microwave Association.

  20. Simulation of the formation of antihydrogen in a nested Penning trap: effect of positron density

    Jonsell, S; Werf, D P van der; Charlton, M; Robicheaux, F

    2009-01-01

    Detailed simulations of antihydrogen formation have been performed under the conditions of the ATHENA experiment, using several densities of the positron plasma in the range n e = 5 x 10 13 m -3 to 10 15 m -3 . The simulations include only collisional effects, typically resulting in the formation of weakly bound antihydrogen via the three-body process, e + + e + + p-bar → H-bar + e + . (Radiative processes, which are much slower than collisional effects, are neglected.) The properties of these weakly bound anti-atoms are affected not only by further collisions in the plasma but also by the inherent electric fields. The role of field ionization in influencing the distribution of binding energies of the antihydrogen is clarified and the mechanism for this process in the strong B-field nested Penning trap used in the experiment is elucidated. The fate of antihydrogen is explained and the properties of the population detected after having reached the wall of the Penning trap electrodes, as well as those field ionized, are recorded. We find that the yield of detected antihydrogen varies with positron density roughly as n 1.7 e , rather than the n 2 e expected from the underlying formation process. As n e is increased, antihydrogen formation is sufficiently rapid that epithermal effects begin to play an important role. In general, the simulated timescales for antihydrogen formation are much shorter than those found from the experiment.

  1. Comparison of filters: Inkjet printed on PEN substrate versus a laser-etched on LCP substrate

    Arabi, Eyad A.; McKerricher, Garret; Shamim, Atif

    2014-01-01

    In this paper, microstrip-based bandpass filters on polyethylene naphthalate (PEN) and liquid crystal polymers (LCP) are presented to investigate the performance of filters on ultra-thin substrates. PEN (with a thickness of 120 μm) has been characterized and used for a filter for the first time. In addition to being low cost and transparent, it demonstrates comparable RF performance to LCP. The conductor losses are compared by fabricating filters with inkjet printed lines as well as laser etched copper clad LCP sheets. With 5 layers of inkjet printing, and a curing temperature below 200°C, a final silver thickness of 2 μm and conductivity of 9.6 × 106 S/m are achieved. The designs are investigated at two frequencies, 24 GHz as well as 5 GHz to assess their performance at high and low frequencies respectively. The 24 GHz inkjet printed filter shows an insertion loss of 2 dB, while the 5 GHz design gives an insertion loss of 8 dB. We find that thin substrates have a strong effect on the insertion loss of filters especially as the frequency is reduced. The same design, realized on LCP (thickness of 100 μm) through laser etching, demonstrates a very similar performance, thus verifying this finding. © 2014 European Microwave Association.

  2. Paper Spray Mass Spectrometry for the Forensic Analysis of Black Ballpoint Pen Inks

    Amador, Victoria Silva; Pereira, Hebert Vinicius; Sena, Marcelo Martins; Augusti, Rodinei; Piccin, Evandro

    2017-09-01

    This article describes the use of paper spray mass spectrometry (PS-MS) for the direct analysis of black ink writings made with ballpoint pens. The novel approach was developed in a forensic context by first performing the classification of commercially available ballpoint pens according to their brands. Six of the most commonly worldwide utilized brands (Bic, Paper Mate, Faber Castell, Pentel, Compactor, and Pilot) were differentiated according to their characteristic chemical patterns obtained by PS-MS. MS on the negative ion mode at a mass range of m/ z 100-1000 allowed prompt discrimination just by visual inspection. On the other hand, the concept of relative ion intensity (RII) and the analysis at other mass ranges were necessary for the differentiation using the positive ion mode. PS-MS combined with partial least squares (PLS) was utilized to monitor changes on the ink chemical composition after light exposure (artificial aging studies). The PLS model was optimized by variable selection, which allowed the identification of the most influencing ions on the degradation process. The feasibility of the method on forensic investigations was also demonstrated in three different applications: (1) analysis of overlapped fresh ink lines, (2) analysis of old inks from archived documents, and (3) detection of alterations (simulated forgeries) performed on archived documents. [Figure not available: see fulltext.

  3. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动

    李秋菊

    2017-01-01

    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  4. Effect of sand and rubber surface on the lying behavior of lame dairy cows in hospital pens

    Bak, Anne Sandgrav; Herskin, Mette S.; Jensen, Margit Bak

    2016-01-01

    Housing lame cows in designated hospital pens with a soft surface may lessen the pain the animals feel when lying and changing position. This study investigated the effect of the lying surface on the behavior of lame cows in hospital pens. Thirty-two lame dairy cows were kept in individual hospital...... pens, provided with either 30-cm deep-bedded sand or 24-mm rubber mats during 24 h in a crossover design. On each surface, the lying behavior of each cow was recorded during 18 h. On deep-bedded sand, cows lay down more and changed position more often than when housed on the rubber surface. Furthermore......, a shorter duration of lying down and getting up movements and a shorter duration of lying intention movements were observed. These results suggest that lame dairy cows are more reluctant to change position on rubber compared with sand, and that sand is more comfortable to lie on. Thus, deep bedding...

  5. Insulin pen needles: effects of extra-thin wall needle technology on preference, confidence, and other patient ratings.

    Aronson, Ronnie; Gibney, Michael A; Oza, Kunjal; Bérubé, Julie; Kassler-Taub, Kenneth; Hirsch, Laurence

    2013-07-01

    Pen needles (PNs) are essential for insulin injections using pen devices. PN characteristics affect patients' injection experience. The goal of this study was to evaluate the impact of a new extra-thin wall (XTW) PN versus usual PNs on overall patient preference, ease of injection, perceived time to complete the full dose, thumb button force to deliver the injection, and dose delivery confidence in individuals with diabetes mellitus (DM). Subjects injected insulin with the KwikPen(TM) (Eli Lilly and Company, Indianapolis, Indiana), SoloSTAR(®) (sanofi-aventis U.S. LLC, Bridgewater, New Jersey), and FlexPen(®) (Novo Nordisk A/S, Bagsvaerd, Denmark) insulin pens, and included some with impaired hand dexterity. We first performed quantitative testing of XTW and comparable PNs with the 3 insulin pens for thumb force, flow rate, and time to deliver medication. A prospective, randomized, 2-period, open-label, crossover trial was then conducted in patients aged 35 to 80 years with type 1 or type 2 DM who injected insulin by pen for ≥2 months, with at least 1 daily dose ≥10 U. Patients who used 4- to 8-mm length PNs with 31- to 32-G diameter were randomly assigned to use their current PN or the same/similar size XTW PN at home for ~1 week and the other PN the second week. They completed several comparative 150-mm visual analog scales and direct questions at the end of period 2. XTW PNs had statistically significant better performance for each studied PN characteristic (thumb force, flow, and time to deliver medication) for all pens combined and each individual pen brand (all, P ≤ 0.05). Of 216 patients randomized to study groups (80, SoloSTAR; 77, FlexPen; 59, KwikPen), 209 completed both periods; 198 were evaluable. Baseline characteristics revealed a mean (SD) age of 60.8 (9.3) years, insulin pen use duration of 4.3 (4.1) years, and mean total daily dose of 75.1 (52.3) U (range, 10-420 U). Approximately 50% of patients were female; 81.5% were white and 14.8% were

  6. Orobanche flava Mart. ex F.W. Schultz (Orobanchaceae: en la Península Ibérica

    Pujadas Salvá, Antonio J.

    2003-12-01

    Full Text Available Orobanche flava is reported in the N of the Iberian Península. Its diversity and distribution is analyzed for the península: var. flava in the Pyrenees and var. albicans Rhiner in the Cantabrian Mountain chain. Lectotypification of O. flava var. albicans Rhiner [ZT] is proposed. To facilítate the identification of O. flava we emphasize its differential morphological characters and an original icon is contributed.Se indica la presencia de Orobanche flava en el N de la Península Ibérica. Se analiza su diversidad y su distribución en el territorio: var. flava en el Pirineo y var. albicans Rhiner en la Cordillera Cantábrica. Se propone el lectótipo de O. flava var. albicans Rhiner [ZT]. Para facilitar la identificación de O. flava destacamos sus caracteres morfológicos diferenciales y aportamos un icono original.

  7. Granulomas do pênis: uma complicação rara da terapia intravesical com Bacilo Calmette-Guérin Granulomas of the penis: a rare complication of intravesical therapy with Bacillus Calmette-Guerin

    Sara Isabel Alcântara Lestre

    2011-08-01

    Full Text Available A imunoterapia com o Bacilo Calmette-Guérin é amplamente usada no tratamento e profilaxia da neoplasia urotelial superficial. As complicações associadas ao tratamento são comuns. Os autores relatam um caso de inflamação granulomatosa do pênis, associada à terapia intravesical com Bacilo Calmette-Guérin, com múltiplos nódulos eritematosos indolores localizados na glande. É também efetuada uma revisão da literatura. A balanopostite granulomatosa é uma complicação rara associada à imunoterapia com Bacilo Calmette-Guérin, com uma apresentação clinicamente heterogênea que pode dificultar o diagnóstico. O seu reconhecimento clínico é essencial para o início precoce de tuberculostáticos e interrupção de Bacilo Calmette-GuérinImmunotherapy with Bacillus Calmette-Guérin is widely used for treatment and prophylaxis of superficial urothelial cancer. Complications associated with Bacillus Calmette-Guérin treatment are common. The authors describe a case of granulomatous inflammation of the penis associated with intravesical Bacillus Calmette-Guérin therapy, presenting with multiple erythematous and painless nodules located on the glans. A review of the literature is also performed. Granulomatous balanoposthitis is a rare complication of Bacillus Calmette-Guérin immunotherapy, with heterogeneous clinical presentation, which can make the diagnosis difficult. Its clinical recognition is essential for early start of therapy with antitubercular agents and interruption of Bacillus Calmette-Guérin

  8. Guía de práctica clínica sobre diagnóstico y tratamiento de infección de vías urinarias no complicada en mujeres adquirida en la comunidad

    Jorge Alberto Cortés; Diego Perdomo; Renán Morales; Carlos Arturo Álvarez; Sonia Isabel Cuervo; Aura Lucía Leal; Julio César Gómez; Patricia Reyes; Análida Elizabeth Pinilla; Edgar Castellanos; Wilfredo Donoso

    2015-01-01

    Mediante un proceso de adaptación de guías de práctica clínica se seleccionaron y evaluaron guías de infección de vías urinarias en mujeres premenopáusicas no embarazadas; se identificaron 3 de alta calidad. Con base en las evidencias y las recomendaciones aportadas por estas guías, se realizó un consenso para realizar recomendaciones para personal de salud -médicos, personal de laboratorio y enfermeros- sobre el diagnóstico de las infecciones urinarias -cistitis y pielonefritis-, sus tratami...

  9. High-voltage switching for in-flight capture of keV antiprotons in a Penning trap

    Fei, X.; Davisson, R.; Gabrielse, G.

    1987-01-01

    The recently observed in-flight capture of keV antiprotons and protons in a Penning trap requires that the -3-kV potentials on electrodes of a Penning trap near 4.2 K be switched on and off with switching times less than 20 ns. These rapidly switched potentials are applied via transmission lines which are not terminated at the trap, thereby avoiding unacceptable heat load on the helium Dewar. Simple high-voltage switching circuits are constructed using krytrons and reed relays. A krytron provides the rapid switching and stays on just long enough for a reed relay to kick in and maintain the switched state indefinitely

  10. Individual and pen-based oral fluid sampling: A welfare-friendly sampling method for group-housed gestating sows.

    Pol, Françoise; Dorenlor, Virginie; Eono, Florent; Eudier, Solveig; Eveno, Eric; Liégard-Vanhecke, Dorine; Rose, Nicolas; Fablet, Christelle

    2017-11-01

    The aims of this study were to assess the feasibility of individual and pen-based oral fluid sampling (OFS) in 35 pig herds with group-housed sows, compare these methods to blood sampling, and assess the factors influencing the success of sampling. Individual samples were collected from at least 30 sows per herd. Pen-based OFS was performed using devices placed in at least three pens for 45min. Information related to the farm, the sows, and their living conditions were collected. Factors significantly associated with the duration of sampling and the chewing behaviour of sows were identified by logistic regression. Individual OFS took 2min 42s on average; the type of floor, swab size, and operator were associated with a sampling time >2min. Pen-based OFS was obtained from 112 devices (62.2%). The type of floor, parity, pen-level activity, and type of feeding were associated with chewing behaviour. Pen activity was associated with the latency to interact with the device. The type of floor, gestation stage, parity, group size, and latency to interact with the device were associated with a chewing time >10min. After 15, 30 and 45min of pen-based OFS, 48%, 60% and 65% of the sows were lying down, respectively. The time spent after the beginning of sampling, genetic type, and time elapsed since the last meal were associated with 50% of the sows lying down at one time point. The mean time to blood sample the sows was 1min 16s and 2min 52s if the number of operators required was considered in the sampling time estimation. The genetic type, parity, and type of floor were significantly associated with a sampling time higher than 1min 30s. This study shows that individual OFS is easy to perform in group-housed sows by a single operator, even though straw-bedded animals take longer to sample than animals housed on slatted floors, and suggests some guidelines to optimise pen-based OFS success. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. Diseño participativo de una Guía para la Promoción de la Salud Mental en el medio penitenciario

    R. Bustamante Navarro

    2013-10-01

    Full Text Available Objetivos: Describir los contenidos y el proceso participativo de construcción de una guía para promover la salud mental en el medio penitenciario a través de actividades grupales. Material y método: Se realizó una revisión de la literatura, de las políticas de salud mental, de un programa de talleres de hábitos mentales saludables y un vídeo sobre factores de protección y riesgo. Se identificaron a los actores implicados (stakeholders y se recabó su opinión sobre los temas de la guía. Se decidieron los contenidos de la guía y la incorporación del modelo de activos en salud y las perspectivas de género y diversidad cultural. Tras la elaboración inicial de los módulos y sesiones, se pilotaron en los centros penitenciarios de Valencia y Zaragoza con mujeres y hombres de distintas culturas, incorporando las mejoras sugeridas, unificándose contenidos y el estilo discursivo. Resultados: La guía consta de: prólogo, Introducción, descripción, módulos, sesiones y evaluación. Contiene 6 módulos y 19 sesiones sobre: salud y motivación; autoestima; salud y emociones; más activos para ganar salud: relajación, pensar en positivo, mantener la calma, comunicación y resolver problemas; avanzar es posible: resiliencia y ser protagonista de mi cambio. Cada sesión está compuesta por: las dinámicas (objetivos, material, tiempo asignado y desarrollo, material teórico y fichas para las actividades. La guía está disponible en edición impresa y electrónica. Conclusiones: Se ha construido una guía con participación de actores implicados y teniendo en cuenta la opinión de la población penitenciaria.

  12. Guía ilustrada de la flora del “Desierto de la Tatacoa ”, Huila, Colombia

    Yisela Figueroa Cardozo

    2004-07-01

    promedio de 28º C y una precipitación promedio anual cercana a 1.000 mm. Históricamente,la región ha sufrido un fuerte proceso de sabanización y desertificación, por lo cual la cobertura vegetal actual se encuentra representada principalmente por matorrales bajos, rastrojos y pastizales. En este estudio se presenta el inventario florístico preliminar de la región del “desierto” de la Tatacoa; además, se caracteriza la vegetación de la región de una forma general y se presenta una guía ilustrada con descripciones botánicas para 100 de las especies más representativas de la región. Se encontraron 227 especies, distribuidas en cerca de 170 géneros y 60 familias. La gran mayoría de las especies son dicotiledóneas (85%, mientras que las monocotiledóneas se encuentran representadas solo por el 14% de las especies, y un mínimo porcentaje (menos del 1% por helechos y afines. A nivel florístico, la familia Fabaceae (s.l. es la más destacada con 35 especies y 27 géneros, representando el 15,5% del total de las especies, discriminada en las subfamilias Faboideae con 18/16, Mimosoideae con 9/7 y Caesalpinioideae con 8/4. Otras de las familias que sobresalen por su riqueza son Poaceae con 20 especies y 15 géneros, Euphorbiaceae (13/7, Asteraceae (10/10, Malvaceae (9/4, Cactaceae (8/7, Asclepiadaceae (8/7 y Convolvulaceae (8/3. Como hallazgos importantes se presenta el primer registro para el país de Senna uniflora (Caesalpiniodeae y el reencuentro de Amoreuxia palmatifida (Cochlospermaceae, especie que era conocida para Colombia por un solo espécimen coleccionado antes de 1858 en cercanías al municipio del Espinal (Tolima. La guía ilustrada incluye para cada especie una descripción corta e información sobre su distribución, usos y nombres comunes (cuando los hay. Además, la mayoría de las especies están ilustradas con fotografías de su hábito y detalles de flores y/o frutos.

  13. Serologic surveillance of wild and pen-reared ring-necked pheasants (Phasianus colchicus) as a method of understanding disease reservoirs

    Dwight, Ian; Coates, Peter S.; Stoute, Simone T.; Senties-Cue, C. Gabriel; Gharpure, Radhika V.; Pitesky, Maurice E.

    2018-01-01

    We investigated exposure to infectious diseases in wild (n=33) and pen-reared (n=12) Ring-necked Pheasants (Phasianus colchicus) in the Central Valley of California during 2014 and 2015. Serologic tests were positive for antibodies against hemorrhagic enteritis (HE), infectious bursal disease (IBD), and Newcastle disease (ND) viruses in both wild and pen-reared pheasants.

  14. Comparison of bacterial culture and qPCR testing of rectal and pen floor samples as diagnostic approaches to detect enterotoxic Escherichia coli in nursery pigs

    Weber, N. R.; Nielsen, J. P.; Hjulsager, Charlotte Kristiane

    2017-01-01

    Enterotoxigenic E. coli (ETEC) are a major cause of diarrhoea in weaned pigs. The objective of this study was to evaluate the agreement at pen level among three different diagnostic approaches for the detection of ETEC in groups of nursery pigs with diarrhoea. The diagnostic approaches used were...... to determine the quantity of F18 and F4 genes. The study was carried out in three Danish pig herds and included 31 pens with a pen-level diarrhoea prevalence of > 25%, as well as samples from 93 diarrhoeic nursery pigs from these pens. All E. coli isolates were analysed by PCR and classified as ETEC when genes...... was observed between the detection of ETEC by bacterial culture and qPCR in the same pen floor sample in 26 (83.9%, Kappa = 0.679) pens. Conclusion: We observed an acceptable agreement for the detection of ETEC-positive diarrhoeic nursery pigs in pen samples for both bacterial culture of pen floor samples...

  15. Using the PEN-3 Model to Plan Culturally Competent Domestic Violence Intervention and Prevention Services in Chinese American and Immigrant Communities

    Yick, Alice G.; Oomen-Early, Jody

    2009-01-01

    Purpose: The purpose of this article is two-fold. First, it applies the PEN-3 model to the topic of domestic violence within the Chinese American and Chinese immigrant community. The PEN-3 model was developed by Collins Airhihenbuwa, and it focuses on placing culture at the forefront of health promotion. It consists of three dimensions: cultural…

  16. Patient evaluation of the use of follitropin alfa in a prefilled ready-to-use injection pen in assisted reproductive technology: an observational study

    Welcker J

    2010-09-01

    Full Text Available Abstract Background Self-administration of recombinant human follicle-stimulating hormone (r-hFSH can be performed using injection pen devices by women undergoing assisted reproductive technology procedures. The objective of this study was to explore the use of the prefilled follitropin alfa pen in routine assisted reproductive technology procedures in Germany. Methods This prospective, observational study was conducted across 43 German IVF centres over a period of 1.75 years. Patients who had used the prefilled follitropin alfa pen in the current or a previous cycle of controlled ovarian stimulation completed a questionnaire to assess their opinions of the device. Results A total of 5328 patients were included in the study. Of these, 2888 reported that they had previous experience of daily FSH injections. Significantly more patients reported that less training was required to use the prefilled follitropin alfa pen than a syringe and lyophilized powder (1997/3081 [64.8%]; p Conclusions In this questionnaire-based survey, routine use of the prefilled follitropin alfa pen was well accepted and associated with favourable patient perceptions. Users of the pen found it easier to initially learn how to use, and subsequently use, than other injection methods. In general, the prefilled follitropin alfa pen was the preferred method for self-administration of gonadotrophins. Together with previous findings, the results here indicate a high level of patient satisfaction among users of the prefilled follitropin alfa pen for daily self-administration of r-hFSH.

  17. Pen Rearing and Imprinting of Fall Chinook Salmon, 1986 Annual Report.

    Novotny, Jerry F.; Macy, Thomas L.; Gardenier, James T.; Beeman, John W.

    1986-12-01

    Pen rearing studies during 1986 completed the second of three years intended for rearing and releasing upriver bright fall chinook salmon (Oncorhynchus tshawytscha) from two study sites, a backwater and a pond, adjacent to the Columbia River; both areas are located in the Jonn Day Reservoir. Results of this study in 1984 and 1985 showed that fish could be successfully reared in net pens and that growth and physiological development of the off-station reared fish proceeded at a faster rate than in fish reared at a hatchery. Transfer of fish from the hatchery to off-station sites at Social Security Pond (pond) and Rock Creek (backwater) during early March increased the period of rearing in 1986 by about four weeks. The increased period of rearing allowed all treatments of fed fish to reach a minimum weight of YU fish/lb by release. Differences in growth of fed fish between regular density treatments and additional, high density treatments (double and triple the regular densities) were not significantly different (P > 0.05), but growth of all fed fish reared off-station was again significantly better than that of hatchery reared fish (P < 0.05), Mortalities in all groups of fed fish were low. Physiological development of fed fish was similar in all treatments. At release, development of fish at Social Security Pond appeared to be somewhat ahead of fish at Rock Creek on the same dates however, none of the groups of fed fish achieved a high state of smoltification by release. Unfed fish grew poorly over the redring period, and at release were significantly smaller than either fed groups at the off-station sites, or the control groups reared at the hatchery (P < 0.05). Development of unfed fish toward smoltification was much slower than of fed fish. Mortality of all groups of unfed fish, including the barrier net, was relatively low. Health of all fish reared off-station remained good over the rearing period, and no outbreaks of disease were noted. On-site marking and

  18. ( sup 3 H)(D-PEN sup 2 , D-PEN sup 5 ) enkephalin binding to delta opioid receptors on intact neuroblastoma-glioma (NG 108-15) hybrid cells

    Knapp, R.J.; Yamamura, H.I. (Univ. of Arizona College of Medicine, Tucson (USA))

    1990-01-01

    ({sup 3}H)(D-Pen{sup 2}, D-Pen{sup 5})enkephalin binding to intact NG 108-15 cells has been measured under physiological conditions of temperature and medium. The dissociation constant, receptor density, and Hill slope values measured under these conditions are consistent with values obtained by others using membranes prepared from these cells. Kinetic analysis of the radioligand binding to these cells show biphasic association and monophasic dissociation processes suggesting the presence of different receptor affinity states for the agonist. The data show that the binding affinity of ({sup 3}H)(D-Pen{sup 2}, D-Pen{sup 5})enkephalin under physiological conditions is not substantially different to that measured in 50 mM Tris buffer using cell membrane fractions. Unlike DPDPE, the {mu} opioid agonists morphine, normorphine, PL-17, and DAMGO, have much lower affinity for the {delta} receptor measured under these conditions than is observed by studies using 50 mM Tris buffer. The results described here suggest that this assay may serve as a useful model of {delta} opioid receptor binding in vivo.

  19. Assessment of benzene-induced hematotoxicity using a human-like hematopoietic lineage in NOD/Shi-scid/IL-2Rγnull mice.

    Masayuki Takahashi

    Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.

  20. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei

    2014-05-01

    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.