Research on Foreign Background and Musical Thought of Teng Gu
Directory of Open Access Journals (Sweden)
Bo Zhang
2014-12-01
Full Text Available TENG Gu is a famous art historian in Republic of China. Together with early Chinese scholars studying abroad like ZONG Bai-hua, ZHU Guang-qian, DENG Yi-zhe, MA Cai and FU Bao-shi, he constructed a framework of early Chinese Art. We still know his influence after a century. In his artistic thought, the essential music idea occupies 1/3.He had given music the highest position among all arts and cultures. In his view, culture won’t have any value if art is removed. And all arts follow the rhythm of music.
Dark matter at the SHiP experiment
International Nuclear Information System (INIS)
Timiryasov, Inar
2016-01-01
We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk
Civil Engineering for the SHiP facility
Osborne, John Andrew
2015-01-01
The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT
Radiation protection studies for the SHiP facility
Strabel, Claudia Christina; Vincke, Helmut
2015-01-01
The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.
Women stereotypes in Shi Zhecun's short stories.
Rosenmeier, Christopher
2010-01-01
This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.
Brothers or Rivals? Iran and the Shi'a of Iraq
National Research Council Canada - National Science Library
Hunter, Robert C
2006-01-01
This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...
Interaction and conflict between Sufism and Shi`ism during Safavid era
Directory of Open Access Journals (Sweden)
E Naghibi
2017-10-01
Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shiâite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.
R and D of tritium technology as SHI (Sumitomo Heavy Industries)
International Nuclear Information System (INIS)
Yokogawa, N.
1997-01-01
Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)
Dr. Shi Hanzhang's Experience in Treating Andropathy
Institute of Scientific and Technical Information of China (English)
无
2007-01-01
@@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.
Calibrating the SHiP muon-flux using NA61/SHINE
Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe
2016-01-01
A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.
$\\mu$-flux measurements for SHiP using NA61/SHINE
Dijkstra, H; Korzenev, A; Mermod, P
2016-01-01
A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.
Muon-flux measurements for SHiP at H4
van Herwijnen, E
2017-01-01
A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.
Antonella Del Rosso
2015-01-01
SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world. The SHiP experiment is designed to be installed next to the SPS North Area. Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...
The secret of René Guénon: A critical review of Guénon's traditionalism
Directory of Open Access Journals (Sweden)
Poznanović Željko
2014-01-01
Full Text Available This paper aims to present the basic principles of the doctrine of René Guénon (1886-1951, a French thinker of broad and comprehensive scope when it comes to Hinduism, Western Occult Tradition, Freemasonry, Taoism, symbolism and certain aspects of metaphysics. His teaching did not leave a mark in the mainstream of philosophy, yet it founded a whole syncretic movement known as Traditionalism or Perennialism. While Guénons doctrine is commonly either ignored or accepted as unquestionably true, a critical approach to it is very rare, especially criticism of the logical coherence of the system itself. Although Guénon was not a transparently systematic thinker, his own beliefs just like any other cannot be self-contradictory. A special attention is given to the contradiction of his doctrine with Islam despite the fact that Guénon was a declared Muslim. In this paper we have particularly shown socio-political implications of Guénons doctrine supporting our attitudes by both Guénons own statements and the statements of his supporters as well as critics ranging from moderate to the most severe ones. We hope we have shown that in his doctrine there is a hidden coherent system that leads to conclusions and objectives that are precisely determined regardless of apparent contradictions.
Why I Am Not SHY: A Reply to Tononi and Cirelli
Directory of Open Access Journals (Sweden)
Marcos Gabriel Frank
2013-01-01
Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.
The computer-assisted interview In My Shoes can benefit shy preschool children's communication
Salari, Raziye; Eriksson, Maria; Sarkadi, Anna
2017-01-01
Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534
TianShuiShi space breeding current situation and developing trend
International Nuclear Information System (INIS)
Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang
2011-01-01
TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)
Search for New Physics in SHiP and at future colliders
AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara
2015-01-01
SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\
SyGuS-Comp 2016: Results and Analysis
Directory of Open Access Journals (Sweden)
Rajeev Alur
2016-11-01
Full Text Available Syntax-Guided Synthesis (SyGuS is the computational problem of finding an implementation f that meets both a semantic constraint given by a logical formula φ in a background theory T, and a syntactic constraint given by a grammar G, which specifies the allowed set of candidate implementations. Such a synthesis problem can be formally defined in SyGuS-IF, a language that is built on top of SMT-LIB. The Syntax-Guided Synthesis Competition (SyGuS-Comp is an effort to facilitate, bring together and accelerate research and development of efficient solvers for SyGuS by providing a platform for evaluating different synthesis techniques on a comprehensive set of benchmarks. In this year's competition we added a new track devoted to programming by examples. This track consisted of two categories, one using the theory of bit-vectors and one using the theory of strings. This paper presents and analyses the results of SyGuS-Comp'16.
The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality
Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.
2013-01-01
The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175
Tema. Patrones alimentarios: guías nutricionales
Ortiz-Moncada, Rocío
2011-01-01
El objetivo del la presentacion del tema es reconocer las bases de la alimentación saludable de acuerdo a los patrones alimentarios de España, y su relación con la dieta mediterránea. Se espera que al finalizar el tema, los estudiantes tengan la capacidad de analizar la evolución de las guías nutricionales en España desde su aparición teniendo en cuenta las características que debe de llevar una guía alimentaria. Plantear ventajas y limitaciones de las guías alimentarias, y proponer opciones...
[Doctor HUANG Shi-ping's acupuncture with golden needles].
Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang
2013-08-01
Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.
First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector
Solovev, Vladimir
2017-01-01
This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.
Study of nu-tau properties with the SHiP experiment
AUTHOR|(CDS)2209555
The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...
The secret of René Guénon: A critical review of Guénon's traditionalism
Poznanović Željko
2014-01-01
This paper aims to present the basic principles of the doctrine of René Guénon (1886-1951), a French thinker of broad and comprehensive scope when it comes to Hinduism, Western Occult Tradition, Freemasonry, Taoism, symbolism and certain aspects of metaphysics. His teaching did not leave a mark in the mainstream of philosophy, yet it founded a whole syncretic movement known as Traditionalism or Perennialism. While Guénons doctrine is commonly either ignored or accepted as unquestionably true,...
Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.
Leichtman, Mara A
2009-07-01
The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.
Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee
2011-01-01
Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106
Directory of Open Access Journals (Sweden)
Shiuan-Pey Lin
2011-01-01
Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.
An evaluation of prefilled insulin pens: a focus on the Next Generation FlexPen®
Directory of Open Access Journals (Sweden)
Estella M Davis
2010-08-01
Full Text Available Estella M Davis, Emily L Sexson, Mikayla L Spangler, Pamela A ForalDepartment of Pharmacy Practice, Creighton University School of Pharmacy and Health Professions, Omaha, Nebraska, USAAbstract: Insulin pen delivery systems are preferred by patients over the traditional vial and syringe method for insulin delivery because they are simple and easy to use, improve confidence in dosing insulin, and have less interference with activities and improved discretion with use. Insulin manufacturers have made numerous improvements to their first marketed pen devices and are now introducing their next generation of devices. Design modifications to the newest generation of prefilled insulin pen devices are intended to improve the ease of use and safety and continue to positively impact adherence to insulin. This review focuses on the Next Generation FlexPen® with regard to design considerations to reduce injection force, improve accuracy and ease of use, and evaluate the preference of patient and health-care provider compared with other disposable, prefilled insulin pen devices.Keywords: diabetes, dose accuracy, injection force, patient preference, insulin pen device
Late GI and GU complications in the treatment of prostate cancer
International Nuclear Information System (INIS)
Schultheiss, Timothy E.; Lee, W. Robert; Hunt, Margie A.; Hanlon, Alexandra L.; Peter, Ruth S.; Hanks, Gerald E.
1997-01-01
Purpose: To assess the factors that predict late GI and GU morbidity in radiation treatment of the prostate. Methods and Materials: Seven hundred twelve consecutive prostate cancer patients treated at this institution between 1986 and 1994 (inclusive) with conformal or conventional techniques were included in the analysis. Patients had at least 3 months follow-up and received at least 65 Gy. Late GI Grade 3 morbidity was rectal bleeding (requiring three or more procedure) or proctitis. Late Grade 3 GU morbidity was cystitis or structure. Multivariate analysis (MVA) was used to assess factors related to the complication-free survival. The factors assessed were age, occurrence of side effects ≥ Grade 2 during treatment, irradiated volume parameters (use of pelvic fields, treatment of seminal vesicles to full dose or 57 Gy, and use of additional rectal shielding), dose, comorbidities, and other treatments (hormonal manipulation, TURP). Results: Acute GI and GU side effects (Grade 2 or higher ) were noted in 246 and 201 patients, respectively; 67 of these patients exhibited both. GI side effects were not correlated with GU side effects acutely. Late and acute morbidities were correlated (both GI and GU). Fifteen of the 712 patients expressed Grade 3 or 4 GI injuries 3 to 32 months after the end of treatment, with a mean of 14.3 months. One hundred fifteen patients expressed Grade 2 or higher GI morbidity (mean: 13.7 months). The 43 Grade 2 or higher GU morbidities occurred significantly later (mean: 22.7 months). Central axis dose was the only independent variable significantly related to the incidence of late GI morbidity on MVA. No treatment volume parameters were significant for Grade 3. The following parameters were significantly related (by MVA) to Grade 2 GI morbidity: central axis dose, use of the increased rectal shielding, androgen deprivation therapy starting before RT. Acute and late GI morbidities were highly correlated. History of diabetes, treatment of
Agencia Estatal de Meteorología (España)
2015-01-01
Guía disponible en castellano, catalán, euskera y gallego La gestión del riesgo asociado a las avalanchas es una tarea compleja y multidisciplinar que incluye tanto la cartografía de las zonas proclives a los aludes como la predicción del fenómeno, la construcción de estructuras de defensa y el desencadenamiento artificial de las avalanchas. Sin embargo, ante todo, es imprescindible conocer el fenómeno y sus causas. Esta guía pretende ser una primera aproximación a dicho conocimiento a...
[Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].
Liu, Jian; Fan, Xiao-Nong; Wang, Shu
2014-01-01
Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.
Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja
2017-12-01
Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse
Markovic, Andrea; Bowker, Julie C
2015-01-01
A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.
Vegetation survey of PEN Branch wetlands
Energy Technology Data Exchange (ETDEWEB)
1991-01-01
A survey was conducted of vegetation along Pen Branch Creek at Savannah River Site (SRS) in support of K-Reactor restart. Plants were identified to species by overstory, understory, shrub, and groundcover strata. Abundance was also characterized and richness and diversity calculated. Based on woody species basal area, the Pen Branch delta was the most impacted, followed by the sections between the reactor and the delta. Species richness for shrub and groundcover strata were also lowest in the delta. No endangered plant species were found. Three upland pine areas were also sampled. In support of K Reactor restart, this report summarizes a study of the wetland vegetation along Pen Branch. Reactor effluent enters Indian Grove Branch and then flows into Pen Branch and the Pen Branch Delta.
ν{sub τ}-physics with the SHiP experiment
Energy Technology Data Exchange (ETDEWEB)
Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)
2016-07-01
SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.
SC/RP Group
2006-01-01
The Radiation Protection Group has decided to withdraw all pen dosimeters from the main PS and SPS access points. This will be effective as of January 2006. The following changes will be implemented: All persons working in a limited-stay controlled radiation area must wear an operational dosimeter in addition to their personal DIS dosimeter. Any persons not equipped with this additional dosimeter must contact the SC/RP Group, which will make this type of dosimeter available for temporary loan. A notice giving the phone numbers of the SC/RP Group members to contact will be displayed at the former distribution points for the pen dosimeters. Thank you for your cooperation. The SC/RP Group
Cytotoxicity of Pd nanostructures supported on PEN: Influence of sterilization on Pd/PEN interface
Energy Technology Data Exchange (ETDEWEB)
Polívková, M., E-mail: polivkoa@vscht.cz [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Siegel, J. [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Rimpelová, S. [Department of Biochemistry and Microbiology, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Hubáček, T. [Institute of Hydrobiology, Biology Centre of the AS CR, 370 05 Ceske Budejovice (Czech Republic); Kolská, Z. [Materials Centre of Usti n. L., J.E. Purkyne University, 400 96 Usti nad Labem (Czech Republic); Švorčík, V. [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic)
2017-01-01
Non-conventional antimicrobial agents, such as palladium nanostructures, have been increasingly used in the medicinal technology. However, experiences uncovering their harmful and damaging effects to human health have begun to appear. In this study, we have focused on in vitro cytotoxicity assessment of Pd nanostructures supported on a biocompatible polymer. Pd nanolayers of variable thicknesses (ranging from 1.1 to 22.4 nm) were sputtered on polyethylene naphthalate (PEN). These nanolayers were transformed by low-temperature post-deposition annealing into discrete nanoislands. Samples were characterized by AFM, XPS, ICP-MS and electrokinetic analysis before and after annealing. Sterilization of samples prior to cytotoxicity testing was done by UV irradiation, autoclave and/or ethanol. Among the listed sterilization techniques, we have chosen the gentlest one which had minimal impact on sample morphology, Pd dissolution and overall Pd/PEN interface quality. Cytotoxic response of Pd nanostructures was determined by WST-1 cell viability assay in vitro using three model cell lines: mouse macrophages (RAW 264.7) and two types of mouse embryonic fibroblasts (L929 and NIH 3T3). Finally, cell morphology in response to Pd/PEN was evaluated by means of fluorescence microscopy. - Highlights: • Annealing of Pd nanolayers on PEN resulted to Pd aggregation and formation of discrete nanoislands. • UV treatment was found as the gentlest sterilization method in term of physicochemical properties of Pd/PEN interface. • Autoclaving and chemical sterilization by ethanol resulted into remarkable changes of Pd/PEN interface. • Cytotoxicity of Pd samples was insignificant. • Pd nanostructures are potentially applicable as health-unobjectionable antibacterial coatings of medical devices.
GuMNet - Guadarrama Monitoring Network initiative (Madrid,Spain)
Santolaria-Canales, Edmundo
2017-04-01
The Guadarrama Monitoring Network initiative (GuMNet) is an observational infrastructure focused on monitoring the state of the atmosphere, surface and subsurface in the Sierra de Guadarrama, 50 km NW of the city of Madrid. The network is composed of 10 automatic real time weather stations ranging from low altitude (ca. 900 m.a.s.l) to high mountain areas (ca. 2400 m.a.s.l). The GuMNet infrastructure consists in 10 real time automatic weather stations with instrumentation for observing the state of the atmosphere, surface and the subsurface at the Sierra de Guadarrama, just 50 km north-northwest of the city of Madrid. GuMNet lays the foundations of a research network on weather, soil thermodynamics, boundary layer physics, climate and ecosystem oriented impacts, air pollutions, etc. in the Sierra de Guadarrama. GuMNet represents a first step to provide a unique observational network in an environment of high protection to be used as a laboratory serving a wide range of scientific and educational interests. High altitude sites are focused on periglacial areas and lower altitude sites have emphasis on pastures. One of the low altitude sites is equipped with a 10 m high anemometric tower with a 3D sonic anemometer at the top jointly with a CO2/H2O analyzer that will allow sampling of wind profiles and H2O and CO2 eddy covariance fluxes, important for soil respiration and CO2 and water vapor exchange. A portable station has also a 3D sonic anemometer with CO2/H2O analyzer, this 4 meters-high portable tower is designed for comparison with other soil terrain fluxes. The network is connected via general packet radio service (GPRS) to the central lab in the Campus of Excellence of Moncloa and a management software has been developed to handle the operation of the infrastructure. The deployment of instrumentation and connection of sites to the network was finished in 2016. GuMNet is currently in the process of becoming operational. Conceptually, GuMNet intends to convert a
NovoPen Echo® insulin delivery device
Directory of Open Access Journals (Sweden)
Hyllested-Winge J
2016-01-01
Full Text Available Jacob Hyllested-Winge,1 Thomas Sparre,2 Line Kynemund Pedersen2 1Novo Nordisk Pharma Ltd, Tokyo, Japan; 2Novo Nordisk A/S, Søborg, Denmark Abstract: The introduction of insulin pen devices has provided easier, well-tolerated, and more convenient treatment regimens for patients with diabetes mellitus. When compared with vial and syringe regimens, insulin pens offer a greater clinical efficacy, improved quality of life, and increased dosing accuracy, particularly at low doses. The portable and discreet nature of pen devices reduces the burden on the patient, facilitates adherence, and subsequently contributes to the improvement in glycemic control. NovoPen Echo® is one of the latest members of the NovoPen® family that has been specifically designed for the pediatric population and is the first to combine half-unit increment (=0.5 U of insulin dosing with a simple memory function. The half-unit increment dosing amendments and accurate injection of 0.5 U of insulin are particularly beneficial for children (and insulin-sensitive adults/elders, who often require small insulin doses. The memory function can be used to record the time and amount of the last dose, reducing the fear of double dosing or missing a dose. The memory function also provides parents with extra confidence and security that their child is taking insulin at the correct doses and times. NovoPen Echo is a lightweight, durable insulin delivery pen; it is available in two different colors, which may help to distinguish between different types of insulin, providing more confidence for both users and caregivers. Studies have demonstrated a high level of patient satisfaction, with 80% of users preferring NovoPen Echo to other pediatric insulin pens. Keywords: NovoPen Echo®, memory function, half-unit increment dosing, adherence, children, adolescents
The Penning fusion experiment-ions
International Nuclear Information System (INIS)
Schauer, M. M.; Umstadter, K. R.; Barnes, D. C.
1999-01-01
The Penning fusion experiment (PFX) studies the feasibility of using a Penning trap as a fusion confinement device. Such use would require spatial and/or temporal compression of the plasma to overcome the Brillouin density limit imposed by the nonneutrality of Penning trap plasmas. In an earlier experiment, we achieved enhanced plasma density at the center of a pure, electron plasma confined in a hyperbolic, Penning trap by inducing spherically convergent flow in a nonthermal plasma. The goal of this work is to induce similar flow in a positive ion plasma confined in the virtual cathode provided by a spherical, uniform density electron plasma. This approach promises the greatest flexibility in operating with multi-species plasmas (e.g. D + /T + ) or implementing temporal compression schemes such as the Periodically Oscillating Plasma Sphere of Nebel and Barnes. Here, we report on our work to produce and diagnose the necessary electron plasma
Directory of Open Access Journals (Sweden)
Manuel García Herrera
2014-01-01
Full Text Available Se hace un análisis comparativo de las guías de valoración de requerimientos laborales: la Guía de Valoración Profesional del INSS, el MERCAL y la Guía mejorada del Instituto de Biomecánica de Valencia, se destacan los defectos y virtudes de cada una de ellas, sus puntos fuertes y sus puntos débiles, y se apuesta hacia la convergencia de todas ellas en una misma herramienta unificada.
Design of a detector to study associated charm production in the SHiP beam dump facility
Iuliano, Antonio; Di Crescenzo, Antonia
A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.
From handwriting analysis to pen-computer applications
Schomaker, L
1998-01-01
In this paper, pen computing, i.e. the use of computers and applications in which the pen is the main input device, will be described from four different viewpoints. Firstly a brief overview of the hardware developments in pen systems is given, leading to the conclusion that the technological
The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility
Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel
2015-01-01
The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.
Lu, Yi; Xu, Yuan
2018-01-01
The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…
Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.
Directory of Open Access Journals (Sweden)
M Ashraful Islam
Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.
Guía de uso de la base de datos Emerald
Biblioteca de la Universidad de Málaga
2014-01-01
Guía de uso de la base de datos Emerald. Recoge publicaciones de diferentes áreas temáticas: Economía, Ciencias Sociales, Ingeniería, Biblioteconomía, etc. Guía de uso de la base de datos Emerald en PDF.
Negative Ion Sources: Magnetron and Penning
Faircloth, D.C.
2013-12-16
The history of the magnetron and Penning electrode geometry is briefly outlined. Plasma generation by electrical discharge-driven electron impact ionization is described and the basic physics of plasma and electrodes relevant to magnetron and Penning discharges are explained. Negative ions and their applications are introduced, along with their production mechanisms. Caesium and surface production of negative ions are detailed. Technical details of how to build magnetron and Penning surface plasma sources are given, along with examples of specific sources from around the world. Failure modes are listed and lifetimes compared.
Negative Ion Sources: Magnetron and Penning
International Nuclear Information System (INIS)
Faircloth, D C
2013-01-01
The history of the magnetron and Penning electrode geometry is briefly outlined. Plasma generation by electrical discharge-driven electron impact ionization is described and the basic physics of plasma and electrodes relevant to magnetron and Penning discharges are explained. Negative ions and their applications are introduced, along with their production mechanisms. Caesium and surface production of negative ions are detailed. Technical details of how to build magnetron and Penning surface plasma sources are given, along with examples of specific sources from around the world. Failure modes are listed and lifetimes compared. (author)
Isodose plotting for pen plotters
International Nuclear Information System (INIS)
Rosen, I.I.
1985-01-01
A general algorithm for treatment plan isodose line plotting is described which is particularly useful for pen plotters. Unlike other methods of plotting isodose lines, this algorithm is designed specifically to reduce pen motion, thereby reducing plotting time and wear on the transport mechanism. Points with the desired dose value are extracted from the dose matrix and stored, sorted into continuous contours, and then plotted. This algorithm has been implemented on DEC PDP-11/60 and VAX-11/780 computers for use with two models of Houston Instrument pen plotters, two models of Tektronix vector graphics terminals, a DEC VT125 raster graphics terminal, and a DEC VS11 color raster graphics terminal. Its execution time is similar to simpler direct-plotting methods
SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis
Directory of Open Access Journals (Sweden)
Leandro H. Estornell
2018-02-01
Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.
The LongPen--the world's first original remote signing device.
Kruger, Diane M
2010-05-01
The LongPen is a remote-controlled pen and videoconferencing device conceived by Canadian author Margaret Atwood in 2004 and initially intended to bring "live" author signings to far away locations. The LongPen allows for individually inscribed long distance signatures and writing while maintaining an original record, written with pen and ink. LongPen specimens were compared with control specimens using different speeds, pen pressures, and types of pens. Preliminary indications are that LongPen inscriptions can be identified or associated with their author. Size and form are maintained and artifacts are subtle. Some limitations with respect to the capture of long tapered strokes, delicate connecting strokes, and differences in line width were noted. Factors which may impact forensic handwriting examinations include limited amounts of writing, light pen pressure, date of the writing, type of writing instrument, dimensions of the writing, and failure to consider that the device has been used.
Surgical Complications of Bacille Calmette-Guérin (BCG) Infection in ...
African Journals Online (AJOL)
Surgical Complications of Bacille Calmette-Guérin (BCG) Infection in HIV infected children. J Karpelowsky, A Alexander, SD Peek, A Millar, H Rode. Abstract. Aim. Bacille Calmette-Guérin (BCG) immunisation is well established as part of the South African national expanded programme for immunisation (EPI). The World ...
Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs
Lanfranchi, Gaia
2017-01-01
This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.
Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation
Energy Technology Data Exchange (ETDEWEB)
Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)
2016-03-15
The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.
Pen of Health Care Worker as Vector of Infection
Directory of Open Access Journals (Sweden)
Prashant Patil
2010-10-01
Full Text Available Nosocomial infections are the major concern in tertiary hospitals. Health care workers and their belonging are known to act as vector in transmission of infections. In present study, the writing pen of health care workers was worked out for carrying infection. The swab from writing pen of health care workers were cultured for any growth of microorganism and compared with swab from pen of the non health care workers. It was found that the rate of growth of microorganism were more in pen of health care workers. Similarly the organism attributed to the nosocomial infection was grown from the pens of health care workers. These organisms might be transmitted from the hands of health care workers. The writing pen which health care worker are using became the vectors of transmission of infection. So to prevent it, the most important way is to wash the hands and pen properly after examining the patients.
Extraction and beam transfer for the SHiP facility
Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno
2015-01-01
This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.
DEFF Research Database (Denmark)
Damgaard, B.M.; Studnitz, M.; Nielsen, Jens
2006-01-01
The effects of pen design and group composition were examined with respect to activity, use of pen, floor conditions, health condition and immune competence for groups of 60 pigs. The experiment was designed with the two factors with zones/without zones and divided litters/intact litters....... The experiment included a total of 1440 pigs from weaning at the age of 4 weeks to the age of 18 weeks after weaning. In pens with zones, the selection of different areas for different activities was improved. Pens with zones were more dirty in the elimination and open areas than pens without zones. In pens...... with zones, the number of lymphocytes was decreased, the ability to respond to an additional challenge by a model infection was decreased and the number of neutrophils was increased in intact litters. In week 9, the health condition was better with a group composition consisting of intact litters compared...
Pen- Name in Persian and Arabic Poetry
Directory of Open Access Journals (Sweden)
Ebrahim Khodayar
2012-03-01
Full Text Available  Abstract Pen-name (Takhalloss is one of the main features of Persian poetry. It has been a matter of concern among many of Persian language geography poets in the orient at least up to the Mashrouteh era. Pen-name has been promoted among the other Muslim nations throuph Persian poetry. Although it is not as famous in the Arab nations as in the Persian speaking nations, it is known as âAlqab-o-shoaraâ among the Arab nations and, through this way, it has affected the poetrical wealth of the Arabic poets.  The Present paper, using description-analystic approach, compares the pen-names of Persian and Arabic poets under the title of âpen-namesâ and investigates their features in both cultures. The main research question is: What are the similarities and differences of poetic-names, in Persian and Arabic poets in terms of the type of name, position and importance? The results showed that Pseudonym by its amazing expansion in Persian poetry has also influenced Arabic poetry. In addition to the factors affecting in the choice of pen-names (like pseudonym, pen-name, nickname..., sometimes such external factors as events, commends, community benefactors and climate, as well as internal factors including the poetsâ inner beliefs are associated too. .
A facility to search for hidden particles at the CERN SPS: the SHiP physics case.
Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M
2016-12-01
This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.
Propaganda mitu nägu / Kulle Raig
Raig, Kulle, 1940-
2016-01-01
Arvustus: Lehtonen, Pekka. Tehtävä Tallinnassa : neuvostopropagandaa ja itsenäisyysinnostusta. Helsinki : Into, 2016 ; Lehtonen, Pekka. Ülesandega üle lahe : propaganda mitu nägu. Tallinn : K&K, 2016
Penning ionization processes studied by electron spectroscopy
International Nuclear Information System (INIS)
Yencha, A.J.
1978-01-01
The technique of measuring the kinetic energy of electrons ejected from atomic or molecular species as a result of collisional energy transfer between a metastable excited rare gas atom and an atom or molecule is known as Penning ionization spectroscopy. Like the analogous photoionization process of photoelectron spectroscopy, a considerable amount of information has been gained about the ionization potentials of numerous molecular systems. It is, in fact, through the combined analyses of photoelectron and Penning electron spectra that affords a probe of the particle-particle interactions that occur in the Penning process. In this paper a short survey of the phenomenon of Penning ionization, as studied by electron spectroscopy, will be presented as it pertains to the ionization processes of simple molecules by metastable excited atoms. (author)
Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...
African Journals Online (AJOL)
Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.
De innemende verteller Louwrens Penning
Ester, Hans
2012-01-01
Dutch author Louwrens Penning (1854 – 1927) indisputably contributed more than any other novelist in the Netherlands to the high degree of solidarity with the Boers before, during and after the Anglo- Boer War 1899 – 1902. Penning, being a believer in the Calvinist tradition, had a profound trust in God’s guidance of history. He identified the war of the Boer soldiers against the British imperialists with the rebellion of the Dutch out of their true religious convictions against t...
9 CFR 313.1 - Livestock pens, driveways and ramps.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Livestock pens, driveways and ramps... INSPECTION AND CERTIFICATION HUMANE SLAUGHTER OF LIVESTOCK § 313.1 Livestock pens, driveways and ramps. (a) Livestock pens, driveways and ramps shall be maintained in good repair. They shall be free from sharp or...
A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case
Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC
2016-10-24
This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....
Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS
SHiP Collaboration
2015-01-01
With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.
Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui
2016-01-01
The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…
Coherent states approach to Penning trap
International Nuclear Information System (INIS)
Fernandez, David J; Velazquez, Mercedes
2009-01-01
By using a matrix technique, which allows us to identify directly the ladder operators, the Penning trap coherent states are derived as eigenstates of the appropriate annihilation operators. These states are compared with those obtained through the displacement operator. The associated wavefunctions and mean values for some relevant operators in these states are also evaluated. It turns out that the Penning trap coherent states minimize the Heisenberg uncertainty relation
Le commerce des sels de Guérande (xviie-xviiie siècles)
Buron, Gildas
2015-01-01
Depuis les travaux de Michel Mollat, Henri Touchard, Jean Tanguy et Jean Meyer touchant au sel et aux marais salants du pays de Guérande, l’historien en est resté à l’idée que la production salicole guérandaise n’avait connu, aux Temps modernes, de débouchés que régionaux, vers la Bretagne intérieure par le biais de la troque effectuée par les gens du marais. L’enquête en cours montre que les sels de Guérande, certes peu présents dans le grand commerce international du sel de la Baie du xive ...
International Nuclear Information System (INIS)
Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti
2015-01-01
Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications
[A review for a traditional Chinese medical journal Shou Shi Yi Bao].
Xiao, Mei-Hua; Sun, Wen-Zhong
2009-06-01
Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.
Administration technique and storage of disposable insulin pens reported by patients with diabetes.
Mitchell, Virginia D; Porter, Kyle; Beatty, Stuart J
2012-01-01
The purpose of the study was to evaluate insulin injection technique and storage of insulin pens as reported by patients with diabetes and to compare correct pen use to initial education on injection technique, hemoglobin A1C, duration of insulin therapy, and duration of insulin pen. Cross-sectional questionnaire orally administered to patients at a university-affiliated primary care practice. Subjects were patients with diabetes who were 18 years or older and prescribed a disposable insulin pen for at least 4 weeks. A correct usage score was calculated for each patient based on manufacturer recommendations for disposable insulin pen use. Associations were made between the correct usage score and certainty in technique, initial education, years of insulin therapy, duration of pen use, and hemoglobin A1C. Sixty-seven patients completed the questionnaire, reporting total use of 94 insulin pens. The 3 components most often neglected by patients were priming pen needle, holding for specific count time before withdrawal of pen needle from skin, and storing an in-use pen. For three-fourths of the insulin pens being used, users did not follow the manufacturer's instructions for proper administration and storage of insulin pens. Correct usage scores were significantly higher if initial education on insulin pens was performed by a pharmacist or nurse. The majority of patients may be ignoring or unaware of key components for consistent insulin dosing using disposable insulin pens; therefore, initial education and reeducation on correct use of disposable insulin pens by health care professionals are needed.
THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST
Directory of Open Access Journals (Sweden)
Alexander A. Kuznetsov
2014-01-01
Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.
The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East
Directory of Open Access Journals (Sweden)
Alexander A. Kuznetsov
2014-01-01
Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.
Steimle, Jurgen
2012-01-01
Even at the beginning of the 21st century, we are far from becoming paperless. Pen and paper is still the only truly ubiquitous information processing technology. Pen-and-paper user interfaces bridge the gap between paper and the digital world. Rather than replacing paper with electronic media, they seamlessly integrate both worlds in a hybrid user interface. Classical paper documents become interactive. This opens up a huge field of novel computer applications at our workplaces and in our homes. This book provides readers with a broad and extensive overview of the field, so as to provide a fu
SHI induced irradiation effect on Mo/Si interface
International Nuclear Information System (INIS)
Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh
2006-01-01
Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)
Early warning of diarrhea and pen fouling in growing pigs using sensor-based monitoring
DEFF Research Database (Denmark)
Jensen, D. B.; Toft, Nils; Kristensen, A. R.
2016-01-01
then identify specific pens in need of extra attention. Here we evaluate the value of monitoring live weight, feed usage, humidity, drinking behavior and pen temperature in relation to early warnings of diarrhea and pen fouling in slaughter pigs. Materials and methods: We used data collected in 16 pens (8...... double-pens) between November 2013 and December 2014 at a commercial Danish farm. During this time, three new batches were inserted. We monitored the mean live weight of the pigs per pen (weekly, only in 4 pens), feed usage per double-pen (daily), humidity per section (daily), temperature at two...... positions per pen (hourly), water flow per double-pen (liters/hour/pig) and drinking frequency per pen (activations/hour/pig). Staff registrations of diarrhea and pen fouling were the events of interest. The data were divided into a learning set (15 events) and a test set (18 events). The data were modeled...
Tail posture predicts tail biting outbreaks at pen level in weaner pigs
DEFF Research Database (Denmark)
Lahrmann, Helle Pelant; Hansen, Christian Fink; D'Eath, Rick
2018-01-01
posture and behaviour could be detected at pen level between upcoming tail biting pens (T-pens) and control pens (C-pens). The study included 2301 undocked weaner pigs in 74 pens (mean 31.1 pigs/pen; SD 1.5). Tails were scored three times weekly (wound freshness, wound severity and tail length) between 07......Detecting a tail biting outbreak early is essential to reduce the risk of pigs getting severe tail damage. A few previous studies suggest that tail posture and behavioural differences can predict an upcoming outbreak. The aim of the present study was therefore to investigate if differences in tail......:00 h-14:00 h from weaning until a tail biting outbreak. An outbreak (day 0) occurred when at least four pigs had a tail damage, regardless of wound freshness. On average 7.6 (SD 4.3) pigs had a damaged tail (scratches + wound) in T-pens on day 0. Tail posture and behaviour (activity, eating...
Kuidas tehti filmi "Arminägu" / Timo Diener
Diener, Timo
2003-01-01
Mängufilm "Arminägu" ("Scarface") : stsenarist Oliver Stone : režissöör Brian De Palma : peaosas Al Pacino : produtsent Martin Bregman : Ameerika Ühendriigid 1983. Järgneb 20. ja 27. okt. 2003, lk. 38
Humalog(®) KwikPen™: an insulin-injecting pen designed for ease of use.
Schwartz, Sherwyn L; Ignaut, Debra A; Bodie, Jennifer N
2010-11-01
Insulin pens offer significant benefits over vial and syringe injections for patients with diabetes who require insulin therapy. Insulin pens are more discreet, easier for patients to hold and inject, and provide better dosing accuracy than vial and syringe injections. The Humalog(®) KwikPen™ (prefilled insulin lispro [Humalog] pen, Eli Lilly and Company, Indianapolis, IN, USA) is a prefilled insulin pen highly rated by patients for ease of use in injections, and has been preferred by patients to both a comparable insulin pen and to vial and syringe injections in comparator studies. Together with an engineering study demonstrating smoother injections and reduced dosing error versus a comparator pen, recent evidence demonstrates the Humalog KwikPen device is an accurate, easy-to-use, patient-preferred insulin pen.
Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.
Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J
2017-08-01
Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.
Energy Technology Data Exchange (ETDEWEB)
Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)
2015-06-15
Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.
Of Papers and Pens: Polysemes and Homophones in Lexical (Mis)Selection
Li, Leon; Slevc, L. Robert
2017-01-01
Every word signifies multiple senses. Many studies using comprehension-based measures suggest that polysemes' senses (e.g., "paper" as in "printer paper" or "term paper") share lexical representations, whereas homophones' meanings (e.g., "pen" as in "ballpoint pen" or "pig pen")…
International Nuclear Information System (INIS)
Schultheiss, Timothy E.; Lee, W. Robert; Hunt, Margie A.; Hanlon, Alexandra L.; Peter, Ruth S.; Hanks, Gerald E.
1995-01-01
Purpose: To assess the factors that predict for late GI and GU morbidity in radiation treatment of the prostate. Materials and Methods: Six hundred sixteen consecutive prostate cancer patients treated between 1985 and 1994 with conformal or conventional techniques were included in the analysis. All patients had at least 3 months followup (median 26 months) and received at least 65 Gy. Late GI morbidity was rectal bleeding (requiring more than 2 procedures) or proctitis. Late GU morbidity was cystitis or stricture. Univariate analysis compared the differences in the incidence of RTOG-EORTC grade 3 and 4 late morbidity by age (<60 versus ≥ 60 years), peracute side effects ≥ grade 1 (during treatment), subacute side effects ≥ grade 1 (0 to 90 days after treatment), irradiated volume parameters, and dose. Multivariate proportional hazards analysis includes these same variables in a model of time to complication. Multivariate logistic regression was used to analyze incidence of peracute and subacute GI and GU side effects by GI and GU comorbidities, performance status, pretreatment procedures (biopsy, TURP, etc.), age, treatment volume parameters, and peracute responses. Results: Peracute GI and GU side effects were noted in 441 and 442 patients, respectively. Subacute GI and GU side effects were noted in 34 and 54 patients, respectively. Subacute GI side effects were highly correlated with subacute GU side effects (p<0.00001). Late morbidities were not correlated with peracute side effects but were correlated with subacute side effects (both GI and GU). Thirteen of the 616 patients expressed grade 3 or 4 GI injuries 3 to 32 months after the end of treatment, with a mean of 13 months. The 6 GU morbidities occurred significantly later (9 - 52 months) with a mean of 33 months. Central axis dose and age less than 60 years were the only independent variables significantly related to the incidence of late GI morbidity on multivariate analysis. Subacute and peracute
Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.
Directory of Open Access Journals (Sweden)
Tsung-Hsien Li
Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.
Essential Characteristics of Plasma Antennas Filled with He-Ar Penning Gases
International Nuclear Information System (INIS)
Sun Naifeng; Li Wenzhong; Wang Shiqing; Li Jian; Ci Jiaxiang
2012-01-01
Based on the essential theory of Penning gases, the discharge characteristics of He-Ar Penning gases in insulating tubes were analyzed qualitatively. The relation between the effective length of an antenna column filled with He-Ar Penning gases and the applied radio frequency (RF) power was investigated both theoretically and experimentally. The distribution of the plasma density along the antenna column in different conditions was studied. The receiving characteristics of local frequency modulated (FM) electromagnetic waves by the plasma antenna filled with He-Ar Penning gases were compared with those by an aluminum antenna with the same dimensions. Results show that it is feasible to take plasma antennas filled with He-Ar Penning gases as receiving antennas.
Guía de uso de la base de datos Dialnet
Biblioteca de la Universidad de Málaga
2015-01-01
Guía de uso de la base de datos Dialnet (y Dialnet Plus). Dialnet es un portal bibliográfico que recopila recursos científicos hispanos, apostando por el acceso abierto a la literatura científica. Dialnet funciona como un proyecto cooperativo, nacido en la Universidad de la Rioja, en el que actualmente participan numerosas bibliotecas universitarias españolas, entre ellas la Biblioteca de la Universidad de Málaga (UMA). Guía de uso de la base de datos Dialnet, elaborada por la Biblioteca d...
Arce Mateos, Félix Pablo; Fernández Fernández, Fidel Ángel; Fernández Vega, Iván; Galtés, Ignasi; Guerra Merino, Isabel; Lucena, Joaquín; Mayorga Fernández, Marta María; Regojo, Rita María; Suárez, María Paz; Terán Villagrá, Nuria
2015-01-01
El trabajo que aquí se publica se trata de la Guía Clinica de Consenso redactada por el Club de Autopsias de la Sociedad Española de Anatomía Patológica para el Libro Blanco de la Anatomía Patológica presentado en el XXVIII Congreso Nacional de la SEAP-IAP, XXII Congreso Nacional Sociedad Española de Citología y III Congreso Nacional Sociedad Española de Patología Forense, en mayo de 2015 en la ciudad de Santander. En palabras de su presidente, el Dr. M.A. Piris, “el papel de estas guías doce...
Theall-Honey, Laura A; Schmidt, Louis A
2006-04-01
We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.
"Gerontiuse unenägu" Estonias / Igor Garšnek
Garšnek, Igor, 1958-
2010-01-01
2. aprillil Estonia kontserdisaalis toimunud Edward Elgari oratooriumi "Gerontiuse unenägu" ettekandest, esitasid: ERSO, Estonia ooperikoor, Estonia poistekoor, kammerkoor Voces Musicales, Helen Lokuta, Bernhard Gärtner, Priit Volmer, dirigent Carlos Spiereri
Ease of use and patient preference injection simulation study comparing two prefilled insulin pens.
Clark, Paula E; Valentine, Virginia; Bodie, Jennifer N; Sarwat, Samiha
2010-07-01
To determine patient ease of use and preference for the Humalog KwikPen* (prefilled insulin lispro [Humalog dagger] pen, Eli Lilly and Company, Indianapolis, IN, USA) (insulin lispro pen) versus the Next Generation FlexPen double dagger (prefilled insulin aspart [NovoRapid section sign ] pen, Novo Nordisk A/S, Bagsvaerd, Denmark) (insulin aspart pen). This was a randomized, open-label, 2-period, 8-sequence crossover study in insulin pen-naïve patients with diabetes. Randomized patients (N = 367) received device training, then simulated low- (15 U) and high- (60 U) dose insulin injections with an appliance. Patients rated pens using an ease of use questionnaire and were asked separately for final pen preferences. The Insulin Device 'Ease of Use' Battery is a 10-item questionnaire with a 7-point scale (higher scores reflect greater ease of use). The primary objective was to determine pen preference for 'easy to press to inject my dose' (by comparing composite scores [low- plus high-dose]). Secondary objectives were to determine pen preference on select questionnaire items (from composite scores), final pen preference, and summary responses for all questionnaire items. On the primary endpoint, 'easy to press to inject my dose,' a statistically significant majority of patients with a preference chose the insulin lispro pen over the insulin aspart pen (68.4%, 95% CI = 62.7-73.6%). Statistically significant majorities of patients with a preference also favored the insulin lispro pen on secondary items: 'easy to hold in my hand when I inject' (64.9%, 95% CI = 58.8-70.7%), 'easy to use when I am in a public place' (67.5%, 95% CI = 61.0-73.6%), and 'overall easy to use' (69.9%, 95% CI = 63.9-75.4%). A statistically significant majority of patients had a final preference for the insulin lispro pen (67.3%, 95% CI = 62.2-72.1%). Among pen-naïve patients with diabetes who had a preference, the majority preferred the insulin lispro pen over the insulin aspart pen with regard
Pen-based Interfaces for Engineering and Education
Stahovich, Thomas F.
Sketches are an important problem-solving tool in many fields. This is particularly true of engineering design, where sketches facilitate creativity by providing an efficient medium for expressing ideas. However, despite the importance of sketches in engineering practice, current engineering software still relies on traditional mouse and keyboard interfaces, with little or no capabilities to handle free-form sketch input. With recent advances in machine-interpretation techniques, it is now becoming possible to create practical interpretation-based interfaces for such software. In this chapter, we report on our efforts to create interpretation techniques to enable pen-based engineering applications. We describe work on two fundamental sketch understanding problems. The first is sketch parsing, the task of clustering pen strokes or geometric primitives into individual symbols. The second is symbol recognition, the task of classifying symbols once they have been located by a parser. We have used the techniques that we have developed to construct several pen-based engineering analysis tools. These are used here as examples to illustrate our methods. We have also begun to use our techniques to create pen-based tutoring systems that scaffold students in solving problems in the same way they would ordinarily solve them with paper and pencil. The chapter concludes with a brief discussion of these systems.
The LEBIT 9.4 T Penning trap system
Energy Technology Data Exchange (ETDEWEB)
Ringle, R.; Bollen, G.; Schury, P.; Sun, T. [National Superconducting Cyclotron Laboratory, East Lansing, MI (United States); Michigan State University, Department of Physics and Astronomy, East Lansing, MI (United States); Lawton, D.; Schwarz, S. [National Superconducting Cyclotron Laboratory, East Lansing, MI (United States)
2005-09-01
The initial experimental program with the Low-Energy Beam and Ion Trap Facility, or LEBIT, will concentrate on Penning trap mass measurements of rare isotopes, delivered by the Coupled Cyclotron Facility (CCF) of the NSCL. The LEBIT Penning trap system has been optimized for high-accuracy mass measurements of very short-lived isotopes. (orig.)
The LEBIT 9.4 T Penning trap system
International Nuclear Information System (INIS)
Ringle, R.; Bollen, G.; Schury, P.; Sun, T.; Lawton, D.; Schwarz, S.
2005-01-01
The initial experimental program with the Low-Energy Beam and Ion Trap Facility, or LEBIT, will concentrate on Penning trap mass measurements of rare isotopes, delivered by the Coupled Cyclotron Facility (CCF) of the NSCL. The LEBIT Penning trap system has been optimized for high-accuracy mass measurements of very short-lived isotopes. (orig.)
SHiP: a new multipurpose beam-dump experiment at the SPS.
AUTHOR|(SzGeCERN)387671
2016-01-01
SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...
Guías, indigenismo y turismo en el Cusco, Perú
Chara Azurín, Alberto Carlos; Jiménez Caballero, José Luis (Coordinador)
2011-01-01
La presente investigación reflexiona y analiza sobre la actividad profesional de los guías turísticos que operan en la región de Cusco, Perú. Esta área geográfica declarada Patrimonio Cultural de la Humanidad por la Unesco en el año 1983, es considerada como el gran eje turístico y punto de ingreso obligatorio para la visita de una de las nuevas siete maravillas del mundo “Machu Picchu”. Los guías turísticos desempeñan un importante rol en la difusión del patrimonio cultur...
Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants
DEFF Research Database (Denmark)
Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel
2013-01-01
of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...
Etude linguistique chez les Baráshi/Banyaambo du Rwanda
African Journals Online (AJOL)
User
ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...
Correlates of cannabis vape-pen use and knowledge among U.S. college students
Directory of Open Access Journals (Sweden)
Tessa Frohe
2018-06-01
Full Text Available Introduction: The proliferation of electronic devices, such as vape-pens, has provided alternative means for cannabis use. Research has found cannabis-vaping (i.e., vape-pen use is associated with lower perceived risks and higher cannabis use. Knowledge of these products may increase likelihood of subsequent use. As policies for cannabis shift, beliefs that peers and family approve of this substance use (injunctive norms increase and there has been an increase in vape-pen use among young adults (18–35year olds; however, correlates thereof remain unknown. Young adults often engage in cross-substance use with cannabis and alcohol, making alcohol a potential correlate of cannabis vape-pen use and knowledge. Therefore, we examined alcohol use and other potential correlates of vape-pen use and knowledge among a sample of university students. Methods: This secondary data analysis utilized surveys at multiple colleges in the U.S. (N=270. Alcohol use, social anxiety, cannabis expectancies, injunctive and descriptive norms and facets of impulsivity were examined as correlates of vape-pen use and knowledge using bivariate correlations and logistic regressions. Results: Alcohol use was correlated with cannabis vape-pen use and knowledge. Frequency of cannabis use, peer injunctive norms, and positive expectancies were associated with increased likelihood of vape-pen use. Lack of premeditation, a facet of impulsivity, was associated with cannabis vape-pen knowledge. Conclusions: Given the unknown nature and consequences of cannabis vape-pens, the present findings offer valuable information on correlates of this behavior. Further, correlates of knowledge of vape-pens may point to areas for education and clinical intervention to prevent heavy cannabis vape-pen use. Keywords: Marijuana, Vaporizer, College students, Substance use, Attitudes, Cannabis
Directory of Open Access Journals (Sweden)
TingTing Yan
Full Text Available BACKGROUND: Systemic leukocyte activation and disseminated leukocyte adhesion will impair the microcirculation and cause severe decrements in tissue perfusion and organ function in the process of severe sepsis. Gu-4, a lactosyl derivative, could selectively target CD11b to exert therapeutic effect in a rat model of severe burn shock. Here, we addressed whether Gu-4 could render protective effects on septic animals. METHODOLOGY/PRINCIPAL FINDINGS: On a murine model of endotoxemia induced by lipopolysaccharide (LPS, we found that the median effective dose (ED50 of Gu-4 was 0.929 mg/kg. In vivo treatment of Gu-4 after LPS challenge prominently attenuated LPS-induced lung injury and decreased lactic acid level in lung tissue. Using the ED50 of Gu-4, we also demonstrated that Gu-4 treatment significantly improved the survival rate of animals underwent sepsis induced by cecal ligation and puncture. By adhesion and transwell migration assays, we found that Gu-4 treatment inhibited the adhesion and transendothelial migration of LPS-stimulated THP-1 cells. By flow cytometry and microscopy, we demonstrated that Gu-4 treatment inhibited the exposure of active I-domain and the cluster formation of CD11b on the LPS-stimulated polymorphonuclear leukocytes. Western blot analyses further revealed that Gu-4 treatment markedly inhibited the activation of spleen tyrosine kinase in LPS-stimulated THP-1 cells. CONCLUSIONS/SIGNIFICANCE: Gu-4 improves the survival of mice underwent endotoxemia and sepsis, our in vitro investigations indicate that the possible underlying mechanism might involve the modulations of the affinity and avidity of CD11b on the leukocyte. Our findings shed light on the potential use of Gu-4, an interacting compound to CD11b, in the treatment of sepsis and septic shock.
Auxiliares de movilidad en la discapacidad visual. Terapia asistida por perros: perros guía
García López, Verónica
2017-01-01
El desplazamiento y movilidad en personas con baja visión o ceguera no sería tan eficiente sin el uso de determinadas ayudas como pueden ser los auxiliares de desplazamiento, como el guía vidente, el bastón blanco y el perro guía. De todos ellos se hará una descripción general de los guías videntes, un análisis del bastón blanco sobre sus características, técnicas de uso y nuevas tecnologías aplicadas a este; también se comentará brevemente el uso del perro como perro de asistencia y una revi...
De Lellis, Giovanni
2018-05-01
The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.
Gu??a de autoempleo en Logopedia
Planells del Pozo, Elena Mar??a; Molina Cantero, Camila; Jacobe Mart??nez, Soledad; Jim??nez Rodr??guez, Jorge; Herrera Torres, Fuensanta
2016-01-01
Esta Gu??a de Autoempleo en Logopedia es un documento que pretende aportar informaci??n y generar motivaci??n al reci??n titulado en Logopedia, demostrando que dise??ar y crear un centro profesional propio es un camino posible y no supone tanta dificultad como se piensa. Este peque??o manual permitir?? recoger informaci??n dispersa referente al tema del autoempleo en Logopedia en un documento ??nico y asequible al titulado en Logopedia que se plantee y decida crear su propia empresa, apoya...
An audit of Colposcopy referrals from a GU/STD clinic.
LENUS (Irish Health Repository)
O'Connor, Catherine
2008-01-01
BACKGROUND: Cervical cancer is increasing at 1.5% per year in Ireland with 50% mortality giving 2.2% of all cancer deaths. In the Mid-West region a pilot screening programme has begun to screen all women 25-60 years. 66% of Genitourinary\\/Sexually transmitted disease (GU\\/STD) clinics\\' abnormal smears are <25 years. Requests to abandon "opportunistic" screening prompted this GU\\/STD clinic audit. METHODS: 221(8.4%) patients referred to colposcopy over 4 years were audited. Retrospective analysis was carried out on GU\\/STD clinic files, hospital files and computer records for biopsy reports. Ethical approval was prospectively granted. RESULTS: 2637 smears were carried out from November 1999 - September 2003.221 patients referred to colposcopy were audited.1%, 3%, 5% had severe, moderate and, mild dyskaryosis, respectively, on cervical screening while 0.8%, 1.2%, 1.5% had CIN3, CIN2, CIN1 abnormalities, respectively, on biopsy with 3.5% having no abnormality (Cervical Intraepithelial Neoplasia = CIN).53% referred to colposcopy were <25 years. CONCLUSION: 2% had high grade lesions. 37% of high grade lesions are <25 years.Of the high grade lesions 13% had Chlamydia trachomatis (27% of CIN3) and 44% had HPV despite Relative Risks (RR) being 0.75 and 1.09 respectively. Older women had higher grade changes. No statistical difference was found for progression, regression and persistence in those over and under 25.
Tilting-Twisting-Rolling: a pen-based technique for compass geometric construction
Institute of Scientific and Technical Information of China (English)
Fei LYU; Feng TIAN; Guozhong DAI; Hongan WANG
2017-01-01
This paper presents a new pen-based technique,Tilting-Twisting-Rolling,to support compass geometric construction.By leveraging the 3D orientation information and 3D rotation information of a pen,this technique allows smooth pen action to complete multi-step geometric construction without switching task states.Results from a user study show this Tilting-Twisting-Rolling technique can improve user performance and user experience in compass geometric construction.
Particle confinement in penning traps an introduction
Vogel, Manuel
2018-01-01
This book provides an introduction to the field of Penning traps and related experimental techniques. It serves both as a primer for those entering the field, and as a quick reference for those working in it. The book is motivated by the observation that often a vast number of different resources have to be explored to gain a good overview of Penning trap principles. This is especially true for students who experience additional difficulty due to the different styles of presentation and notation. This volume provides a broad introductory overview in unified notation.
Penning transfer in argon-based gas mixtures
Sahin, O; Tapan, I; Ozmutlu, E N
2010-01-01
Penning transfers, a group of processes by which excitation energy is used to ionise the gas, increase the gas gain in some detectors. Both the probability that such transfers occur and the mechanism by which the transfer takes place, vary with the gas composition and pressure. With a view to developing a microscopic electron transport model that takes Penning transfers into account, we use this dependence to identify the transfer mechanisms at play. We do this for a number of argon-based gas mixtures, using gain curves from the literature.
Angioedema hereditario: Guía de tratamiento
Directory of Open Access Journals (Sweden)
Alejandro Malbrán
2012-04-01
Full Text Available El angioedema hereditario (HAE es una enfermedad rara, autosómica dominante, caracterizada por episodios que comprometen la piel, el tracto gastrointestinal y la laringe. Tiene una mortalidad histórica por asfixia del 15 al 50%. Es producida por la deficiencia funcional del C1 inhibidor. La identificación de la bradiquinina como mediador principal ha estimulado el desarrollo de nuevos medicamentos para tratar la enfermedad. El tratamiento del HAE se establece en consensos internacionales. El desarrollo de guías para el tratamiento de la enfermedad permite ordenar el uso de procedimientos diagnósticos y drogas. Describimos aquí algunas características farmacológicas de los medicamentos utilizados en el tratamiento del HAE en la Argentina: el concentrado plasmático de C1 inhibidor, el antagonista de la bradiquinina, icatibant, el andrógeno atenuado danazol y los agentes anti-fibrinolíticos ácidos épsilon aminocaproico (EACA y tranexámico. Asimismo, se describe su forma de uso y del control de los eventos adversos más frecuentes, así como las recomendaciones del último consenso internacional, aplicables para conformar una primera guía de tratamiento del HAE en la Argentina.
Asymmetric Penning trap coherent states
International Nuclear Information System (INIS)
Contreras-Astorga, Alonso; Fernandez, David J.
2010-01-01
By using a matrix technique, which allows to identify directly the ladder operators, the coherent states of the asymmetric Penning trap are derived as eigenstates of the appropriate annihilation operators. They are compared with those obtained through the displacement operator method.
RESEARCHES REGARDING THE MAIN REPRODUCTION INDICATORS DETERMINATED IN SOWS, STAND GESTATION PEN TIPE
Directory of Open Access Journals (Sweden)
RAMONA UNTARU
2007-05-01
Full Text Available Current researches were carried out with the goal to quantisize the lost from the weaning to early gestation at the sows housed in open pen gestation. In this trail we tested two pen types, different not only by size, but also by feeders’ emplacement. The main reproduction indicators that we calculated until the 28 gestation day were the proportion of sows in heat after weaning, the weaning to estrus interval and the gestation rates. The weaning to estrus interval was about 4 to 7 days, most sows were in heat in the day 5 and 6 days after weaning. The percent of heat detection after weaning was 71.42% for the small pens and 70.71% for the big pens (differences statistically non significant, chi test value was 0.983. The gestation rate at 28 days after insemination was 91.62% for the small pens and 94.72% for the large pens (chi test value 0,959, statistically non significant differences. The overpopulation for heat induction and after that chipping animals together in those pens, show that the lost are up to 40.47%, between weaning – day 28 of gestation.
Dynamic-compliance and viscosity of PET and PEN
International Nuclear Information System (INIS)
Weick, Brian L.
2016-01-01
Complex dynamic-compliance and in-phase dynamic-viscosity data are presented and analyzed for PET and PEN advanced polyester substrates used for magnetic tapes. Frequency-temperature superposition is used to predict long-term behavior. Temperature and frequency ranges for the primary glass transition and secondary transitions are discussed and compared for PET and PEN. Shift factors from frequency-temperature superposition are used to determine activation energies for the transitions, and WLF parameters are determined for the polyester substrates.
Dynamic-compliance and viscosity of PET and PEN
Energy Technology Data Exchange (ETDEWEB)
Weick, Brian L. [School of Engineering and Computer Science, University of the Pacific, Stockton, California, 95211 (United States)
2016-05-18
Complex dynamic-compliance and in-phase dynamic-viscosity data are presented and analyzed for PET and PEN advanced polyester substrates used for magnetic tapes. Frequency-temperature superposition is used to predict long-term behavior. Temperature and frequency ranges for the primary glass transition and secondary transitions are discussed and compared for PET and PEN. Shift factors from frequency-temperature superposition are used to determine activation energies for the transitions, and WLF parameters are determined for the polyester substrates.
Dynamic-compliance and viscosity of PET and PEN
Weick, Brian L.
2016-05-01
Complex dynamic-compliance and in-phase dynamic-viscosity data are presented and analyzed for PET and PEN advanced polyester substrates used for magnetic tapes. Frequency-temperature superposition is used to predict long-term behavior. Temperature and frequency ranges for the primary glass transition and secondary transitions are discussed and compared for PET and PEN. Shift factors from frequency-temperature superposition are used to determine activation energies for the transitions, and WLF parameters are determined for the polyester substrates.
Guía de materiales reciclados en la construcción “+live”
Herrera Martín, José Adolfo
2013-01-01
El objeto de este trabajo es la presentación de guía para la utilización y difusión de materiales procedentes de labores de reciclado y su aplicación en procesos constructivos. La guía persigue los siguientes aspectos: - El conocimiento de materiales procedentes del reciclado, que tienen un uso eficaz en procesos constructivos, en una base de datos. - La generación de una base de datos actualizada que permita la fácil incorporación de nuevos productos y técnicas constructiva...
Space-charge effects in Penning ion traps
Porobić, T.; Beck, M.; Breitenfeldt, M.; Couratin, C.; Finlay, P.; Knecht, A.; Fabian, X.; Friedag, P.; Fléchard, X.; Liénard, E.; Ban, G.; Zákoucký, D.; Soti, G.; Van Gorp, S.; Weinheimer, Ch.; Wursten, E.; Severijns, N.
2015-06-01
The influence of space-charge on ion cyclotron resonances and magnetron eigenfrequency in a gas-filled Penning ion trap has been investigated. Off-line measurements with K39+ using the cooling trap of the WITCH retardation spectrometer-based setup at ISOLDE/CERN were performed. Experimental ion cyclotron resonances were compared with ab initio Coulomb simulations and found to be in agreement. As an important systematic effect of the WITCH experiment, the magnetron eigenfrequency of the ion cloud was studied under increasing space-charge conditions. Finally, the helium buffer gas pressure in the Penning trap was determined by comparing experimental cooling rates with simulations.
Influence of lucite phantoms on calibration of dosimetric pens
International Nuclear Information System (INIS)
Oliveira, E.C.; Xavier, M.; Caldas, L.E.V.
1992-01-01
Dosimetrical pens were studied for the answer repetition and were tested in gamma radiation fields ( 60 Co and 137 Cs) in air and in front of a lucite phantom, obtaining a backscattering contribution. The medium backscattering factors were 1,053 and 1,108 for respectively 60 Co and 137 Cs. The pens were placed behind the phantom for verifying the radiation attenuation. (C.G.C.)
Phase II Practice-based Evidence in Nutrition (PEN) evaluation: interviews with key informants.
Bowden, Fran Martin; Lordly, Daphne; Thirsk, Jayne; Corby, Lynda
2012-01-01
Dietitians of Canada has collaborated with experts in knowledge translation and transfer, technology, and dietetic practice to develop and implement an innovative online decision-support system called Practice-based Evidence in Nutrition (PEN). A study was conducted to evaluate the perceived facilitators and barriers that enable dietitians to use or prevent them from using PEN. As part of the overall evaluation framework of PEN, a qualitative descriptive research design was used to address the research purpose. Individual, semi-structured telephone interviews with 17 key informants were completed, and the interview transcripts underwent qualitative content analysis. Respondents identified several facilitators of and barriers to PEN use. Facilitators included specificity to dietetics, rigorous/expert review, easy accessibility, current content, credible/secure material, well-organized/easy-to-use material, material that is valuable to practice, and good value for money. Barriers included perceived high cost, fee structuring/cost to students, certain organizational aspects, and a perceived lack of training for pathway contributors. This formative evaluation has indicated areas in which PEN could be improved and strategies to make PEN the standard for dietetic education and practice. Ensuring that PEN is meeting users' knowledge needs is of the utmost importance if dietitians are to remain on the cutting edge of scientific inquiry.
Fast and Simple Forensic Red Pen Ink Analysis Using Ultra-Performance Liquid Chromatography (UPLC)
International Nuclear Information System (INIS)
Lee, L.C.; Ying, S.L.; Wan Nur Syazwani Wan Mohamad Fuad; Ab Aziz Ishak; Khairul Osman
2016-01-01
Ultra-performance liquid chromatography (UPLC) is more effective than high performance liquid chromatography in terms of analysis speed and sensitivity. This paper presents a feasibility study on forensic red pen inks analysis using UPLC. A total of 12 varieties of red ball point pen inks were purchased from selected stationary shop. For each variety, four different individual pens were sampled to provide intra-variability within a particular variety of pen. The proposed approach is very simple that it only involved limited analysis step and chemicals. A total of 144 chromatograms were obtained from red ink entries extracted with 1.5 mL 80 % (v/v) acetonitrile. Peaks originated from pen inks were determined by comparing the chromatograms of both blank paper and blank solvent against that of ink samples. Subsequently, one-way ANOVA was conducted to discriminate all 66 possible pairs for red pen inks. Results showed that the proposed approach giving discriminating power of 95.45 %. The outcome of the study indicates that UPLC could be a fast and simple approach to red ball point pen inks analysis. (author)
Innovation & evaluation of tangible direct manipulation digital drawing pens for children.
Lee, Tai-Hua; Wu, Fong-Gong; Chen, Huei-Tsz
2017-04-01
Focusing on the theme of direct manipulation, in this study, we proposed a new and innovative tangible user interface (TUI) design concept for a manipulative digital drawing pen. Based on interviews with focus groups brainstorming and experts and the results of a field survey, we selected the most suitable tangible user interface for children between 4 and 7 years of age. Using the new tangible user interface, children could choose between the brush tools after touching and feeling the various patterns. The thickness of the brush could be adjusted by changing the tilt angle. In a subsequent experimental process we compared the differences in performance and subjective user satisfaction. A total of sixteen children, aged 4-7 years participated in the experiment. Two operating system experiments (the new designed tangible digital drawing pen and traditional visual interface-icon-clicking digital drawing pens) were performed at random and in turns. We assessed their manipulation performance, accuracy, brush stroke richness and subjective evaluations. During the experimental process we found that operating functions using the direct manipulation method, and adding shapes and semantic models to explain the purpose of each function, enabled the children to perform stroke switches relatively smoothly. By using direct manipulation digital pens, the children could improve their stroke-switching performance for digital drawing. Additionally, by using various patterns to represent different brushes or tools, the children were able to make selections using their sense of touch, thereby reducing the time required to move along the drawing pens and select icons (The significant differences (p = 0.000, p drawing thick lines using the crayon function of the two (new and old) drawing pens (new 5.8750 drawing operations enhanced the drawing results, thereby increasing the children's enjoyment of drawing with tangible digital drawing pens. Copyright © 2016 Elsevier Ltd. All
Chemical composition of felt-tip pen inks.
Germinario, Giulia; Garrappa, Silvia; D'Ambrosio, Valeria; van der Werf, Inez Dorothé; Sabbatini, Luigia
2018-01-01
Felt-tip pens are frequently used for the realization of sketches, drawings, architectural projects, and other technical designs. The formulations of these inks are usually rather complex and may be associated to those of modern paint materials where, next to the binding medium and pigments/dyes, solvents, fillers, emulsifiers, antioxidants, plasticizers, light stabilizers, biocides, and so on are commonly added. Felt-tip pen inks are extremely sensitive to degradation and especially exposure to light may cause chromatic changes and fading. In this study, we report on the complete chemical characterization of modern felt-tip pen inks that are commercially available and commonly used for the realization of artworks. Three brands of felt-tip pens (Faber-Castell, Edding, and Stabilo) were investigated with complementary analytical techniques such as thin-layer chromatography (TLC), VIS-reflectance spectroscopy, μ-Raman spectroscopy, surface-enhanced Raman spectroscopy (SERS), pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS), GC-MS, and Fourier transform infrared (FTIR) spectroscopy. The use of TLC proved to be very powerful in the study of complex mixtures of synthetic dyes. First derivatives of the reflectance spectra acquired on the TLC spots were useful in the preliminary identification of the dye, followed by Raman spectroscopy and SERS, which allowed for the unambiguous determination of the chemical composition of the pigments (phthalocyanines, dioxazines, and azo pigments) and dyes (azo dyes, triarylmethanes, xanthenes). FTIR spectroscopy was used especially for the detection of additives, as well as for confirming the nature of solvents and dyes/pigments. Finally, (Py-)GC-MS data provided information on the binders (styrene-acrylic resins, plant gums), solvents, and additives, as well as on pigments and dyes.
A redesigned follitropin alfa pen injector for infertility: results of a market research study
Directory of Open Access Journals (Sweden)
Abbotts C
2011-06-01
Full Text Available Carole Abbotts1, Cristiana Salgado-Braga2, Céline Audibert-Gros31Pharmaceutical Marketing Research Consultancy, London, UK; 2Fertility and Endocrinology Global Business Unit, 3Business Intelligence, Merck Serono SA, Geneva, SwitzerlandBackground: The purpose of this study was to evaluate patient-learning and nurse-teaching experiences when using a redesigned prefilled, ready-to-use follitropin alfa pen injector.Methods: Seventy-three UK women of reproductive age either administering daily treatment with self-injectable gonadotropins or about to start gonadotropin treatment for infertility (aged 24–47 years; 53 self-injection-experienced and 20 self-injection-naïve and 28 nurses from UK infertility clinics were recruited for the study. Following instruction, patients and nurses used the redesigned follitropin alfa pen to inject water into an orange and completed questionnaires to evaluate their experiences with the pen immediately after the simulated injections.Results: Most (88%, n = 64 patients found it easy to learn how to use the pen. Among injection-experienced patients, 66% (n = 35 agreed that the redesigned pen was easier to learn to use compared with their current method and 70% (n = 37 also said they would prefer its use over current devices for all injectable fertility medications. All nurses considered the redesigned pen easy to learn and believed it would be easy to teach patients how to use. Eighty-six percent (n = 24 of the nurses thought it was easy to teach patients to determine the remaining dose to be dialed and injected in a second pen if the initial dose was incomplete. Compared with other injection devices, 96% (n = 27 thought it was "much easier" to "as easy" to teach patients to use the redesigned pen. Based on ease of teaching, 68% (n = 19 of nurses would choose to teach the pen in preference to any other injection method. Almost all (93%, n = 26 nurses considered that having the same pen format for a range of
Update on insulin treatment for dogs and cats: insulin dosing pens and more
Directory of Open Access Journals (Sweden)
Thompson A
2015-04-01
Full Text Available Ann Thompson,1 Patty Lathan,2 Linda Fleeman3 1School of Veterinary Science, The University of Queensland, Gatton, QLD, Australia; 2College of Veterinary Medicine Mississippi State University, Starkville, MS, USA; 3Animal Diabetes Australia, Melbourne, VIC, Australia Abstract: Insulin therapy is still the primary therapy for all diabetic dogs and cats. Several insulin options are available for each species, including veterinary registered products and human insulin preparations. The insulin chosen depends on the individual patient's requirements. Intermediate-acting insulin is usually the first choice for dogs, and longer-acting insulin is the first choice for cats. Once the insulin type is chosen, the best method of insulin administration should be considered. Traditionally, insulin vials and syringes have been used, but insulin pen devices have recently entered the veterinary market. Pens have different handling requirements when compared with standard insulin vials including: storage out of the refrigerator for some insulin preparations once pen cartridges are in use; priming of the pen to ensure a full dose of insulin is administered; and holding the pen device in place for several seconds during the injection. Many different types of pen devices are available, with features such as half-unit dosing, large dials for visually impaired people, and memory that can display the last time and dose of insulin administered. Insulin pens come in both reusable and disposable options. Pens have several benefits over syringes, including improved dose accuracy, especially for low insulin doses. Keywords: diabetes, mellitus, canine, feline, NPH, glargine, porcine lente
PyMEs : Guía de comunicación para exportación
Barandiain, Dolores; Feiteler, Daniela Elizabeth; Longarzo, María Florencia
2007-01-01
Esta guía de comunicación está dirigida al empresario PyME que pretende insertarse en la actividad exportadora o que aspira a mejorar dicho proceso. Este material tiene como objetivo aportar herramientas útiles, prácticas y claras vinculadas a la comunicación, entendiendo el concepto como un valor agregado en la gestión de las PyMEs que exportan. Cualquier acción que la empresa realice va a construir un sentido en el destinatario. A partir de aquí, se plantea la Guía de Comunicación para Expo...
Dynamic monitoring of weight data at the pen vs at the individual level
DEFF Research Database (Denmark)
Jensen, Dan; Toft, Nils; Kristensen, A. R. K.
recorded weight data from finisher pigs. Data are collected at insertion and at the exit of the first pigs in the pen, and in few pens, the weight is recorded weekly. Dynamic linear models are fitted on the weight data, at the pig level (univariate), at the double pen level using averaged weight...... (univariate) and using individual pig values as parameters in a hierarchical (multivariate) model including section, double pen, and individual level. Variance components of the different models are estimated using the Expectation Maximization algorithm. The difference of information obtained...... at the individual vs pen level is thereafter assessed. Whereas weight data is usually monitored after a batch is being sent to the slaughter house, this method provides weekly updating of the data. Perspectives of application include dynamic monitoring of weight data in relation to events such as diarrhoea, tail...
Dynamic monitoring of weight data at the pen vs at the individual level
DEFF Research Database (Denmark)
Jensen, Dan Børge; Toft, Nils; Kristensen, Anders Ringgaard
recorded weight data from finisher pigs. Data are collected at insertion and at the exit of the first pigs in the pen, and in few pens, the weight is recorded weekly. Dynamic linear models are fitted on the weight data, at the pig level (univariate), at the double pen level using averaged weight...... (univariate) and using individual pig values as parameters in a hierarchical (multivariate) model including section, double pen, and individual level. Variance components of the different models are estimated using the Expectation Maximization algorithm. The difference of information obtained...... at the individual vs. pen level is thereafter assessed. Whereas weight data is usually monitored after a batch is being sent to the slaughter house, this method provides with weekly updating of the data. Perspectives of application include dynamic monitoring of weight data in relation to events such as diarrhoea...
Tema 4. Calor y temperatura (Guía del tema)
Beléndez Vázquez, Augusto
2010-01-01
Guía del "Tema 4. Calor y temperatura" de la asignatura "Fundamentos Físicos de la Ingeniería I" del "Grado en Ingeniería en Sonido e Imagen" impartido en la Escuela Politécnica Superior de la Universidad de Alicante.
International Nuclear Information System (INIS)
Lynn, Kristi D; Udugamasooriya, D Gomika; Roland, Christina L; Castrillon, Diego H; Kodadek, Thomas J; Brekken, Rolf A
2010-01-01
Vascular endothelial growth factor (VEGF) is a primary stimulant of angiogenesis under physiological and pathological conditions. Anti-VEGF therapy is a clinically proven strategy for the treatment of a variety of cancers including colon, breast, lung, and renal cell carcinoma. Since VEGFR2 is the dominant angiogenic signaling receptor, it has become an important target in the development of novel anti-angiogenic therapies. We have reported previously the development of an antagonistic VEGFR2 peptoid (GU40C4) that has promising anti-angiogenic activity in vitro and in vivo. In the current study, we utilize a derivative of GU40C4, termed GU81 in therapy studies. GU81 was tested alone or in combination with doxorubicin for in vivo efficacy in the MMTV-PyMT transgenic model of breast cancer. The derivative GU81 has increased in vitro efficacy compared to GU40C4. Single agent therapy (doxorubicin or GU81 alone) had no effect on tumor weight, histology, tumor fat content, or tumor growth index. However, GU81 is able to significantly to reduce total vascular area as a single agent. GU81 used in combination with doxorubicin significantly reduced tumor weight and growth index compared to all other treatment groups. Furthermore, treatment with combination therapy significantly arrested tumor progression at the premalignant stage, resulting in increased tumor fat content. Interestingly, treatment with GU81 alone increased tumor-VEGF levels and macrophage infiltration, an effect that was abrogated when used in combination with doxorubicin. This study demonstrates the VEGFR2 antagonist peptoid, GU81, enhances the anti-tumor activity of doxorubicin in spontaneous murine MMTV-PyMT breast tumors
A Survey of Pen name semantic Applications in Rumis Sonnets (Ghazals
Directory of Open Access Journals (Sweden)
Zohre AhmadiPoor anari
2015-04-01
Full Text Available Abstract The pen name in sonnet is the poet’s poetic name which most of the poets mention it in their verses. Jalāl ad-Dīn Muhammad Balkhī also known as Jalāl ad-Dīn Rumi lived in 13th-century was a Persian Moslem poet, theologian, and Sufi mystic. He has written more than 3229 sonnets and dedicated to Shams Tabrizi. Thus mentioned, names such “Shams”, “Shams od-Din” and “Shams al-Haq” in the ending lines of his sonnets. One of the points which could be studied about pen name is study of theme or concepts which are mentioned alongside that. Entirely it has been said that the same theme which comes with the pen name “Shams” in 992 sonnets. In this study, we pay attention to mentioning the poets desired name which is not necessarily the pen name in Rumis’ sonnets, what theme does it carry and what is relationship of it with the previous lines? Themes which the poets apply in their sonnets beside pen name is mostly what that has been mentioned in the previous lines. However, in times the concept mentioned along side with the pen name is independent from the sonnet concepts, mostly eulogy. Studying Hafiz and Saadi sonnets shows that the most important themes existing are: love declaration, advice, eulogizing and sometimes a mischievous concept. Rumis’ sonnets are lover-based. Therefore, there is much talk of the lover in the whole sonnet. But in other poet’s sonnets, the lover (the poet is the main theme is the sonnet. The poet may find a way to praise his own poem or stays in his dreamy world and focuses on the romantic feelings. Considering the fact that unlike other poets Rumi has not mentioned his own pen name but his lover “Shams”, the study focuses on the themes which are mentioned by the pen name “Shams” as the following: 1-Eulogy: One third of the Shams pen names are eulogies. The sufist approach has given the lines a special color. The similes and metaphors used for him are heavenly and
Cómo elaborar Guías de Recomendaciones de Autocuidado para Pacientes y Cuidadores (GRAPyC
Directory of Open Access Journals (Sweden)
Sandra Milena Hernández Zambrano
2015-12-01
Full Text Available Objetivo: Obtener una estructura estandarizada para la elaboración y publicación de Guías de Recomendaciones de Autocuidado para Pacientes y Cuidadores siguiendo la metodología de la Investigación Acción Participativa. Metodología: La guía se elabora a partir de tres etapas: Emergencia, Interacción y Modelización. En la emergencia, se identifica y analiza el problema principal que afecta a la población diana, se conforma el equipo elaborador, y se realiza una búsqueda de literatura científica que dé respuesta al problema. En la interacción, se establece un diálogo de saberes entre profesionales y ciudadanos para analizar y seleccionar aquellas recomendaciones que se consideran prioritarias para la población diana; se adaptan al nivel de comprensión y entorno cultural de pacientes o cuidadores y se implementan con el objetivo de evaluar su efectividad. Finalmente, en la modelización, se elabora el documento final, considerando tres elementos: diseño de la guía, contenidos y estructura. Estructura de la guía de recomendaciones: El formato establecido consta de 7 apartados: presentación del documento, información general del problema objeto de la guía, recomendaciones por temáticas, recursos web para pacientes y cuidadores, autores e instituciones que participaron en la elaboración y bibliografía. Utilidad esperada: La información contenida en estas guías se ajustada al lenguaje de los ciudadanos, es rigurosa pero fácil de comprender y favorece la toma de decisiones a partir de las mejores evidencias disponibles. Para las enfermeras clínicas se convierte en un instrumento novedoso orientado al diseño de materiales educativos basados en la evidencia científica.
Pham, Ngoc Ha T.; Shellnutt, J. Gregory; Yeh, Meng-Wan; Lee, Tung-Yi
2017-04-01
The poorly studied Saharan Metacraton of North-Central Africa is located between the Arabian-Nubian Shield in the east, the Tuareg Shield in the west and the Central African Orogenic Belt in the south. The Saharan Metacraton is composed of Neoproterozoic juvenile crust and the relics of pre-Neoproterozoic components reactivated during the Pan-African Orogeny. The Republic of Chad, constrained within the Saharan Metacraton, comprises a Phanerozoic cover overlying Precambrian basement outcroppings in four distinct massifs: the Mayo Kebbi, Tibesti, Ouaddaï, and the Guéra. The Guéra massif is the least studied of the four massifs but it likely preserves structures that were formed during the collision between Congo Craton and Saharan Metacraton. The Guéra Massif is composed of mostly granitic rocks. The granitoids have petrologic features that are consistent with A-type granite, such as micrographic intergrowth of sodic and potassic feldspar, the presence of sodic- and iron-rich amphibole, and iron-rich biotite. Compositionally, the granitic rocks of the Guéra Massif have high silica (SiO2 ≥ 68.9 wt.%) content and are metaluminous to marginally peraluminous. The rocks are classified as ferroan calc-alkalic to alkali-calcic with moderately high to very high Fe* ratios. The first zircon U/Pb geochronology of the silicic rocks from the Guéra Massif yielded three main age groups: 590 Ma, 570 Ma, 560 Ma, while a single gabbro yielded an intermediate age ( 580 Ma). A weakly foliated biotite granite yielded two populations, in which the emplacement age is interpreted to be 590 ± 10 Ma, whereas the younger age (550 ± 11 Ma) is considered to be a deformation age. Furthermore, inherited Meso- to Paleoproterozoic zircons are found in this sample. The geochemical and geochronology data indicate that there is a temporal evolution in the composition of rocks with the old, high Mg# granitoids shifting to young, low Mg# granitoids. This reveals that the A-type granites in
The Possible Role of Penning Ionization Processes in Planetary Atmospheres
Directory of Open Access Journals (Sweden)
Stefano Falcinelli
2015-03-01
Full Text Available In this paper we suggest Penning ionization as an important route of formation for ionic species in upper planetary atmospheres. Our goal is to provide relevant tools to researchers working on kinetic models of atmospheric interest, in order to include Penning ionizations in their calculations as fast processes promoting reactions that cannot be neglected. Ions are extremely important for the transmission of radio and satellite signals, and they govern the chemistry of planetary ionospheres. Molecular ions have also been detected in comet tails. In this paper recent experimental results concerning production of simple ionic species of atmospheric interest are presented and discussed. Such results concern the formation of free ions in collisional ionization of H2O, H2S, and NH3 induced by highly excited species (Penning ionization as metastable noble gas atoms. The effect of Penning ionization still has not been considered in the modeling of terrestrial and extraterrestrial objects so far, even, though metastable helium is formed by radiative recombination of He+ ions with electrons. Because helium is the second most abundant element of the universe, Penning ionization of atomic or molecular species by He*(23S1 is plausibly an active route of ionization in relatively dense environments exposed to cosmic rays.
Directory of Open Access Journals (Sweden)
Irena Dzwonkowska
2007-12-01
Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.
Análisis comparativo de guías para el desarrollo web accesible
Directory of Open Access Journals (Sweden)
Luis Felipe Londoño Rojas
2018-01-01
Full Text Available En la actualidad los sitios web no cumplen con requerimientos mínimos de accesibilidad, lo que impide que cualquier persona sin importar sus condiciones pueda acceder a los contenidos y servicios disponibles a través de estos sitios. Este problema se da en parte porque los desarrolladores no tienen conocimientos de los criterios y pautas de accesibilidad existen-tes o no saben cómo implementarlas. Como una alternativa, en este trabajo se presenta un análisis de guías para el desarrollo accesible, donde se evalúan diferentes criterios como las discapacidades que son atendidas, el nivel de conocimientos técnico que se requiere para su comprensión y la forma como se presentan los contenidos. A partir de esta evaluación se genera un cuadro comparativo y se hace la selección de las guías que pueden ser de mayor utilidad en la creación de sitios web accesibles, lo que puede servir como un apoyo a los desarrolladores al decidir cuál guía utilizar.
Neutrino physics with the SHiP experiment
AUTHOR|(SzGeCERN)759942
2015-01-01
Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.
Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing
2012-01-01
This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193
Analysis of the NovoTwist pen needle in comparison with conventional screw-thread needles.
Aye, Tandy
2011-11-01
Administration of insulin via a pen device may be advantageous over a vial and syringe system. Hofman and colleagues introduce a new insulin pen needle, the NovoTwist, to simplify injections to a small group of children and adolescents. Their overall preferences and evaluation of the handling of the needle are reported in the study. This new needle has the potential to ease administration of insulin via a pen device that may increase both the use of a pen device and adherence to insulin therapy. © 2011 Diabetes Technology Society.
Increasing viscosity and inertia using a robotically-controlled pen improves handwriting in children
Ben-Pazi, Hilla; Ishihara, Abraham; Kukke, Sahana; Sanger, Terence D
2010-01-01
The aim of this study was to determine the effect of mechanical properties of the pen on the quality of handwriting in children. Twenty two school aged children, ages 8–14 years wrote in cursive using a pen attached to a robot. The robot was programmed to increase the effective weight (inertia) and stiffness (viscosity) of the pen. Speed, frequency, variability, and quality of the two handwriting samples were compared. Increased inertia and viscosity improved handwriting quality in 85% of children (pHandwriting quality did not correlate with changes in speed, suggesting that improvement was not due to reduced speed. Measures of movement variability remained unchanged, suggesting that improvement was not due to mechanical smoothing of pen movement by the robot. Since improvement was not explained by reduced speed or mechanical smoothing, we conclude that children alter handwriting movements in response to pen mechanics. Altered movement could be caused by changes in proprioceptive sensory feedback. PMID:19794098
El lenguaje integral en el grupo interactivo II: guía pedagógica
Directory of Open Access Journals (Sweden)
Jeanneth Cerdas Núñez
2002-01-01
Full Text Available En los últimos años la filosofía del Lenguaje Integral se ha venido promoviendo en diversas instituciones educativas, como una opción para generar procesos de construcción de lenguaje y conocimiento desde una perspectiva constructivista en los salones de clase. Con base en algunas de las experiencias desarrolladas en nuestro contexto costarricense, surgió la idea de elaborar una guía didáctica que considere algunos elementos de la filosofía del Lenguaje Integral para abordar la práctica pedagógica con niños de edades entre 4 y 5 años. Dicha guía contempla básicamente estrategias para diseñar y operacionalizar el planeamiento didáctico y lineamientos para organizar el ambiente físico del aula. Para efectos de implementar la guía didáctica elaborada, es necesario que cada usuario profundice en los diferentes aspectos de la filosofía del Lenguaje Integral y de esta manera pueda adecuar la propuesta a su contexto
Penning ionization cross sections of excited rare gas atoms
International Nuclear Information System (INIS)
Ukai, Masatoshi; Hatano, Yoshihiko.
1988-01-01
Electronic energy transfer processes involving excited rare gas atoms play one of the most important roles in ionized gas phenomena. Penning ionization is one of the well known electronic energy transfer processes and has been studied extensively both experimentally and theoretically. The present paper reports the deexcitation (Penning ionization) cross sections of metastable state helium He(2 3 S) and radiative He(2 1 P) atoms in collision with atoms and molecules, which have recently been obtained by the authors' group by using a pulse radiolysis method. Investigation is made of the selected deexcitation cross sections of He(2 3 S) by atoms and molecules in the thermal collisional energy region. Results indicate that the cross sections are strongly dependent on the target molecule. The deexcitation probability of He(2 3 S) per collision increases with the excess electronic energy of He(2 3 S) above the ionization potential of the target atom or molecule. Another investigation, made on the deexcitation of He(2 1 P), suggests that the deexcitation cross section for He(2 1 P) by Ar is determined mainly by the Penning ionization cross section due to a dipole-dipole interaction. Penning ionization due to the dipole-dipole interaction is also important for deexcitation of He(2 1 P) by the target molecules examined. (N.K.)
Energy Technology Data Exchange (ETDEWEB)
Knapp, R.J.; Yamamura, H.I. (Univ. of Arizona College of Medicine, Tucson (USA))
1990-01-01
({sup 3}H)(D-Pen{sup 2}, D-Pen{sup 5})enkephalin binding to intact NG 108-15 cells has been measured under physiological conditions of temperature and medium. The dissociation constant, receptor density, and Hill slope values measured under these conditions are consistent with values obtained by others using membranes prepared from these cells. Kinetic analysis of the radioligand binding to these cells show biphasic association and monophasic dissociation processes suggesting the presence of different receptor affinity states for the agonist. The data show that the binding affinity of ({sup 3}H)(D-Pen{sup 2}, D-Pen{sup 5})enkephalin under physiological conditions is not substantially different to that measured in 50 mM Tris buffer using cell membrane fractions. Unlike DPDPE, the {mu} opioid agonists morphine, normorphine, PL-17, and DAMGO, have much lower affinity for the {delta} receptor measured under these conditions than is observed by studies using 50 mM Tris buffer. The results described here suggest that this assay may serve as a useful model of {delta} opioid receptor binding in vivo.
Festival Branding – Case Study: The Dragačevo Trumpet Festival in Guča
Directory of Open Access Journals (Sweden)
Igor Stamenković
2013-01-01
Full Text Available The Dragačevo Trumpet Festival in Guča (The Republic of Serbia is a unique competition of folk brass bands in the world and one of the most important events of the overall national creativity and cultural amateurism in Serbia. Therefore, Guča represents an event which is used for branding of tourist offer and musical culture of Serbia at regional and international level. The paper delivers the results of a questionnaire research conducted during the 50th anniversary of The Dragačevo Trumpet Festival in Guča (DTF in August 2010. The results were based on 300 questionnaires. The questionnaire contained, in one of its parts, questions regarding festival branding and influences, i.e. effects which brands (various advertisements of great sponsors and festival donators may produce and thus leave an impression on perception of each visitor as well as on a destination itself.
Bird checklist, Guánica Biosphere Reserve, Puerto Rico
Wayne J. Arendt; John Faaborg; Miguel Canals; Jerry Bauer
2015-01-01
This research note compiles 43 years of research and monitoring data to produce the first comprehensive checklist of the dry forest avian community found within the Guánica Biosphere Reserve. We provide an overview of the reserve along with sighting locales, a list of 185 birds with their resident status and abundance, and a list of the available bird habitats....
Pen-Enabled, Real-Time Student Engagement for Teaching in STEM Subjects
Urban, Sylvia
2017-01-01
The introduction of pen-enabling devices has been demonstrated to increase a student's ability to solve problems, communicate, and learn during note taking. For the science, technology, engineering, and mathematics subjects that are considered to be symbolic in nature, pen interfaces are better suited for visual-spatial content and also provide a…
De Lellis, G.; SHiP Collaboration
2016-07-01
The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.
Bonivento, Walter M.
2017-07-01
The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.
Guías de viaje 2.0: léxico y metadiscurso
Directory of Open Access Journals (Sweden)
Giovanna Mapelli
2016-04-01
Full Text Available La guía de viaje se ha ido configurando como un género textual propio del ámbito del turismo, bien codificado y fácilmente reconocible (Baider et al., 2004; Antelmi et al., 2007, y caracterizado por un tono regulativo y un estilo objetivo e impersonal. Sin embargo, en los últimos años el género se ha reconfigurado, debido al desarrollo de la tecnología digital, que ha dado lugar al llamado Turismo 2.0. Por esta razón, se han producido cambios significativos también en las pautas textuales (Calvi y Mapelli, 2011; Sanmartín Sáez, 2012 y en la relevancia cognoscitiva de las informaciones que se transmiten (Yus Ramos, 2010. Asimismo, han nacido nuevas formas de guías en las que el usuario es también emisor de la comunicación turística dirigida a otros viajeros. Esta “recontextualización” (Linell, 1998 ha originado nuevos géneros “fronterizos” en los que se rompen los esquemas tradicionales: se mezclan rasgos preexistentes en nuevas combinaciones (Calvi, 2010, los miembros de la comunidad de viajeros cooperan entre ellos, y los contenidos se disuelven en microunidades informativas. En este trabajo, se pretende estudiar, cuantitativa y cualitativamente, el léxico y los aspectos interpersonales del metadiscurso (Hyland, 2005 en un corpus heterogéneo y representativo (Biber et al., 1998 de las diferentes tipologías de guía 2.0. Se comparará este nuevo formato con las guías tradicionales (Mapelli y Piccioni, 2011 y con otros materiales informativos de tipo promocional, con el objetivo de perfilar su identidad genérica. El corpus está formado por medio millón palabras y para su análisis se recurrirá al programa AntConc 3.2.4 (Anthony, 2014.
International Nuclear Information System (INIS)
2010-01-01
After a presentation of the objectives of the Penly 3 project, this report gives an overview of the context of electricity production (increasing world demand, geographically unbalanced energy reserves with fluctuating prices and a tendency to increase, French energy assessment, electricity peculiarities, electricity production and consumption in France in 2009, climate change issue). It presents the Penly 3 project and its alternatives within the frame of the French environment and energy policy. The project is then presented in terms of safety objectives, of design choices, of environmental improvements (water sampling, thermal, chemical and radioactive releases, wastes, sound and visual impact, foreseen cost and financing), and then in terms of socio-economical impact. The main steps of the project are briefly indicated
Product Plan of New Generation System Camera "OLYMPUS PEN E-P1"
Ogawa, Haruo
"OLYMPUS PEN E-P1", which is new generation system camera, is the first product of Olympus which is new standard "Micro Four-thirds System" for high-resolution mirror-less cameras. It continues good sales by the concept of "small and stylish design, easy operation and SLR image quality" since release on July 3, 2009. On the other hand, the half-size film camera "OLYMPUS PEN" was popular by the concept "small and stylish design and original mechanism" since the first product in 1959 and recorded sale number more than 17 million with 17 models. By the 50th anniversary topic and emotional value of the Olympus pen, Olympus pen E-P1 became big sales. I would like to explain the way of thinking of the product plan that included not only the simple functional value but also emotional value on planning the first product of "Micro Four-thirds System".
Pen harvester for powering a pulse rate sensor
International Nuclear Information System (INIS)
Bedekar, Vishwas; Oliver, Josiah; Priya, Shashank
2009-01-01
Rapid developments in the area of micro-sensors for various applications such as structural health monitoring, bio-chemical sensors and pressure sensors have increased the demand for portable, low cost, high efficiency energy harvesting devices. In this paper, we describe the scheme for powering a pulse rate sensor with a vibration energy harvester integrated inside a pen commonly carried by humans in the pocket close to the heart. Electromagnetic energy harvesting was selected in order to achieve high power at lower frequencies. The prototype pen harvester was found to generate 3 mW at 5 Hz and 1 mW at 3.5 Hz operating under displacement amplitude of 16 mm (corresponding to an acceleration of approximately 1.14 g rms at 5 Hz and 0.56 g rms at 3.5 Hz, respectively). A comprehensive mathematical modelling and simulations were performed in order to optimize the performance of the vibration energy harvester. The integrated pen harvester prototype was found to generate continuous power of 0.46-0.66 mW under normal human actions such as jogging and jumping which is enough for a small scale pulse rate sensor.
Guía básica para organizar un campamento recreativo y formativo
Directory of Open Access Journals (Sweden)
Jorge Mejía Calderón
2010-01-01
Full Text Available La información expuesta en este artículo es parte de un trabajo final de investigación de maestría. Ese trabajo final tenía dos objetivos generales. El primero fue el desarrollo de un campamento para capacitar a 40 líderes de pastorales juveniles. El segundo objetivo fue la elaboración de una guía sobre la organización de un campamento recreativo y formativo. Esta guía es la que se presenta en este artículo, la cual se fundamentó en la revisión bibliográfica y la experiencia obtenida en el campamento con los grupos de pastorales juveniles. La guía comparte la importancia de esta actividad recreativa como una herramienta para reforzar en las personas áreas tales como la educación, la espiritualidad y las habilidades físicas. Además, incluye una reseña histórica con respecto a los campamentos y los elementos básicos de un programa de campamento: el inicio, la imagen, la filosofía, la estructura del programa, la selección de personas facilitadoras, la espiritualidad, el horario y la evaluación.
Validación de guías de autoaprendizaje en simulación clínica para estudiantes de enfermería
Directory of Open Access Journals (Sweden)
Julián Barragán Becerra
2017-05-01
Full Text Available Introducción: Las guías de autoaprendizaje constituyen una estrategia pedagógica que permite abordar e integrar conocimientos, actitudes y prácticas de los enfermeros en formación. Objetivo: Validar las guías de autoaprendizaje del laboratorio de procedimientos y simulación del Programa de Enfermería de la Universidad Pedagógica y Tecnológica de Colombia. Materiales y Métodos: Se realizó validez facial y de contenido de 40 guías por comité de expertos con base en la guía de evaluación de material educativo de la Organización Panamericana de la Salud. Resultados: La mitad de las guías requieren ajustes de estructura, presentación e imágenes. Según el juicio de los expertos el 50% de las guías obtuvo una puntuación del índice de validez de contenido (IVC mayor de 0.6, lo cual indica que el proceso de elaboración de diseño y el contenido son pertinentes para el autoaprendizaje de los estudiantes de enfermería; 16 guías correspondieron a puntajes entre 0.64 y 0.8, es decir una validez buena con necesidad de ajustes de los aspectos evaluados y 4 guías obtuvieron IVC superior a 0.8, es decir muy buena validez. Discusión: La evaluación de guías construidas y evaluadas es fundamental para la facilitación del aprendizaje y mejoramiento de habilidades y conocimientos clínicos, tanto para la práctica en escenarios, como para el futuro desempeño profesional. Conclusiones: La validez facial y de contenido de material educativo para el uso actual de la simulación clínica, requiere de evaluación y de procesos metodológicos fundamentados en pedagogías motivadoras en un contexto de aprendizaje autónomo y cercano a la realidad. Cómo citar este artículo: Barragán J, Hernández NE, Medina A. Validación de guías de autoaprendizaje en simulación clínica para estudiantes de enfermería. Rev Cuid. 2017; 8(2: 1582-90. http://dx.doi.org/10.15649/cuidarte.v8i2.377
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feeding pens. 89.5 Section 89.5 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE INTERSTATE TRANSPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS STATEMENT OF POLICY UNDER THE...
Ballpoint pen ingestion in a 2-year-old child.
Rameau, Anaïs; Anand, Sumeet M; Nguyen, Lily H
2011-07-01
A 2-year-old girl ingested a ballpoint pen, which was found on chest x-ray to have lodged in the lower esophagus and stomach. The pen, which measured nearly 15 cm in length, was removed via rigid esophagoscopy without complication. To the best of our knowledge, this is the longest nonflexible foreign body ingested by a young child ever reported in the English-language literature. We describe the presentation of this case and the current guidelines for safety as enumerated in the Small Parts Regulations established by the U.S. Consumer Product Safety Commission.
See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响
Institute of Scientific and Technical Information of China (English)
Liu Lili; Li Feng
2008-01-01
Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.
Nonlinear PIC simulation in a Penning trap
International Nuclear Information System (INIS)
Lapenta, G.; Delzanno, G.L.; Finn, J. M.
2002-01-01
We study the nonlinear dynamics of a Penning trap plasma, including the effect of the finite length and end curvature of the plasma column. A new cylindrical PIC code, called KANDINSKY, has been implemented by using a new interpolation scheme. The principal idea is to calculate the volume of each cell from a particle volume, in the same manner as it is done for the cell charge. With this new method, the density is conserved along streamlines and artificial sources of compressibility are avoided. The code has been validated with a reference Eulerian fluid code. We compare the dynamics of three different models: a model with compression effects, the standard Euler model and a geophysical fluid dynamics model. The results of our investigation prove that Penning traps can really be used to simulate geophysical fluids
Infarto agudo de miocardio. Guía de práctica clínica
Directory of Open Access Journals (Sweden)
Yanier Coll Muñoz
2011-08-01
Full Text Available
La elaboración de esta Guía de Práctica Clínica se justifica, en primer lugar, por la elevada frecuencia de presentación y mortalidad del infarto agudo del miocardio en la población general. Las enfermedades cardiovasculares constituyen en la actualidad la principal causa de muerte en los países industrializados, y se espera que también lo sean en los países en vías de desarrollo en el año 2020. La presente guía se refiere a los pacientes que presentan síntomas isquémicos o sus equivalentes, y una elevación persistente del segmento ST en el electrocardiograma, o cambios del electrocardiograma de infradesnivel del ST o de la onda T, compatibles con el diagnóstico de IAM sin elevación del ST. Esta Guía no aborda los elementos relacionados directamente con los procedimientos de intervencionismo coronario percutáneo ni la revascularización miocárdica quirúrgica.
Figueroa P. Adalberto; Gonzalez D. Fernando; Barrios G. Fernando
1986-01-01
Guía práctica para la identificación y manejo de plagas en hortalizas La guía práctica comprende una descripción de los insectos, ácaros y moluscos que atacan los cultivos hortícolas en nuestro país. Se registraron 33 especies hortícolas pertenecientes a 10 familias botánicas que por su afinidad bioquímica atraen las mismas plagas. Se describieron 52 plagas con las respectivas recomendaciones de manejo. También se presentan las alternativas para un control eficaz con enfoque ecológico.This wo...
Search for hidden particles with the SHiP experiment
Energy Technology Data Exchange (ETDEWEB)
Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)
2016-07-01
Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.
The SHiP experiment at CERN SPS
Di Crescenzoon, A
2016-01-01
SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.
Quantification of Tissue Trauma following Insulin Pen Needle Insertions in Skin
DEFF Research Database (Denmark)
Jensen, Casper Bo; Larsen, Rasmus; Vestergaard, Jacob Schack
Objective: Within the field of pen needle development, most research on needle design revolves around mechanical tensile testing and patient statements. Only little has been published on the actual biological skin response to needle insertions. The objective of this study was to develop a computa......Objective: Within the field of pen needle development, most research on needle design revolves around mechanical tensile testing and patient statements. Only little has been published on the actual biological skin response to needle insertions. The objective of this study was to develop...... a computational method to quantify tissue trauma based on skin bleeding and immune response. Method: Two common sized pen needles of 28G (0.36mm) and 32G (0.23mm) were inserted into skin of sedated LYD pigs prior to termination. Four pigs were included and a total of 32 randomized needle insertions were conducted...... diameter. Conclusion: A computational and quantitative method has been developed to assess tissue trauma following insulin pen needle insertions. Application of the method is tested by conduction of a needle diameter study. The obtained quantitative measures of tissue trauma correlate positively to needle...
Lee, Wi Hyoung; Min, Honggi; Park, Namwoo; Lee, Junghwi; Seo, Eunsuk; Kang, Boseok; Cho, Kilwon; Lee, Hwa Sung
2013-08-28
Research into printing techniques has received special attention for the commercialization of cost-efficient organic electronics. Here, we have developed a capillary pen printing technique to realize a large-area pattern array of organic transistors and systematically investigated self-organization behavior of printed soluble organic semiconductor ink. The capillary pen-printed deposits of organic semiconductor, 6,13-bis(triisopropylsilylethynyl) pentacene (TIPS_PEN), was well-optimized in terms of morphological and microstructural properties by using ink with mixed solvents of chlorobenzene (CB) and 1,2-dichlorobenzene (DCB). Especially, a 1:1 solvent ratio results in the best transistor performances. This result is attributed to the unique evaporation characteristics of the TIPS_PEN deposits where fast evaporation of CB induces a morphological evolution at the initial printed position, and the remaining DCB with slow evaporation rate offers a favorable crystal evolution at the pinned position. Finally, a large-area transistor array was facilely fabricated by drawing organic electrodes and active layers with a versatile capillary pen. Our approach provides an efficient printing technique for fabricating large-area arrays of organic electronics and further suggests a methodology to enhance their performances by microstructural control of the printed organic semiconducting deposits.
International Nuclear Information System (INIS)
Fu, Shuai; Zhang, Liyan; Ye, Nan; Liu, Shenglan; Zhang, WeiZhong
2014-01-01
A monocular-vision-based coordinate measuring system (MVB-CMS) obtains the 3D coordinates of the probe tip center of a light pen by analyzing the monocular image of the target points on the light pen. The light pen calibration, including the target point calibration and the probe tip center calibration, is critical to guarantee the accuracy of the MVB-CMS. The currently used method resorts to special equipment to calibrate the feature points on the light pen in a separate offsite procedure and uses the system camera to calibrate the probe tip center onsite. Instead, a complete onsite light pen calibration method is proposed in this paper. It needs only several auxiliary target points with the same visual features of the light pen targets and two or more cone holes with known distance(s). The target point calibration and the probe tip center calibration are jointly implemented by simply taking two groups of images of the light pen with the camera of the system. The proposed method requires no extra equipment other than the system camera for the calibration, so it is easier to implement and flexible for use. It has been incorporated in a large field-of-view MVB-CMS, which uses active luminous infrared LEDs as the target points. Experimental results demonstrate the accuracy and effectiveness of the proposed method. (paper)
Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong
2017-08-12
According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.
(Anti)hydrogen recombination studies in a nested Penning trap
International Nuclear Information System (INIS)
Quint, W.; Kaiser, R.; Hall, D.; Gabrielse, G.
1993-01-01
Extremely cold antiprotons, stored in Penning trap at 4 K, open the way toward the production and study of cold antihydrogen. We have begun experimentally investigating the possibility to recombine cold positrons and antiprotons within nested Penning traps. Trap potentials are adjusted to allow cold trapped protons (and positive helium ions) to pass through cold trapped electrons. Electrons, protons and ions are counted by ejecting them to a cold channel plate and by nondestructive radiofrequency techniques. The effect of the space charge of one trapped species upon another trapped species passing through is clearly observed. (orig.)
III. Penning ionization, associative ionization and chemi-ionization processes
International Nuclear Information System (INIS)
Cermak, V.
1975-01-01
Physical mechanisms of three important ionization processes in a cold plasma and the methods of their experimental study are discussed. An apparatus for the investigation of the Penning ionization using ionization processes of long lived metastable rare gas atoms is described. Methods of determining interaction energies and ionization rates from the measured energy spectra of the originating electrons are described and illustrated by several examples. Typical associative ionization processes are listed and the ionization rates are compared with those of the Penning ionization. Interactions with short-lived excited particles and the transfer of excitation without ionization are discussed. (J.U.)
Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.
2012-01-01
This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…
Neutrino scattering physics with the SHiP Experiment
AUTHOR|(CDS)2083090
2015-01-01
SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.
Neutrino scattering physics with the SHiP Experiment
Di Crescenzo, Antonia
2016-01-01
SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.
DVD-d "Läbi hägu", "Tabamata ime" / Andris Feldmanis
Feldmanis, Andris, 1982-
2007-01-01
Lühiarvustus kuue noorema põlve režissööri R. Sarneti, M. Kõrveri, M. Raati, A. Tammiksaare, J. Kilmi, A. Maimiku lühifilmide kogumikule E. Vilde näidendi "Tabamata ime" ainetel ning Richard Linklateri filmile "Läbi hägu" ("A Scanner Darkly"; USA 2006)
Guía de viaje y turismo 2.0: Los borrosos confines de un género
Directory of Open Access Journals (Sweden)
Maria Vittoria Calvi
2016-04-01
Full Text Available La guía de viajes se configura como uno de los géneros discursivos más específicos del turismo; entre sus reglas constitutivas se destaca, además del carácter regulativo, el estilo objetivo e impersonal. En las últimas décadas, el advenimiento de la comunicación a través de la Red ha tenido importantes repercusiones en la caracterización de este género, modificando algunos de sus aspectos convencionales. El objetivo de este artículo es el de evaluar las principales transformaciones ocurridas en el género de las guías de viaje en la era del Turismo 2.0, mediante el análisis de algunos ejemplos extraídos de textos turísticos recientes. Ante todo, el entorno virtual modifica la presentación, la distribución y la cantidad de las informaciones que se transmiten; asimismo, se esfuma la frontera entre la guía descriptiva tradicional y los materiales informativos de tipo promocional. Por otra parte, las cualidades sociales de la Web 2.0 crean en el destinatario un nuevo horizonte de expectativas, propiciando la realización de guías “cooperativas”, al explotar la participación de la comunidad de los viajeros. Como consecuencia de estas innovaciones, el estilo objetivo, pretendidamente imparcial, propio de la guía tradicional, se abre a la evaluación subjetiva y al elemento experiencial, ambos procedentes de tradiciones discursivas contiguas (reportaje, literatura de viajes, así como de otros cibergéneros, tales como el foro y el blog, acentuando la hibridación genérica.
Smartphone Versus Pen-and-Paper Data Collection of Infant Feeding Practices in Rural China
Zhang, Shuyi; Wu, Qiong; van Velthoven, Michelle HMMT; Chen, Li; Car, Josip; Rudan, Igor; Li, Ye; Scherpbier, Robert W
2012-01-01
Background Maternal, Newborn, and Child Health (MNCH) household survey data are collected mainly with pen-and-paper. Smartphone data collection may have advantages over pen-and-paper, but little evidence exists on how they compare. Objective To compare smartphone data collection versus the use of pen-and-paper for infant feeding practices of the MNCH household survey. We compared the two data collection methods for differences in data quality (data recording, data entry, open-ended answers, and interrater reliability), time consumption, costs, interviewers’ perceptions, and problems encountered. Methods We recruited mothers of infants aged 0 to 23 months in four village clinics in Zhaozhou Township, Zhao County, Hebei Province, China. We randomly assigned mothers to a smartphone or a pen-and-paper questionnaire group. A pair of interviewers simultaneously questioned mothers on infant feeding practices, each using the same method (either smartphone or pen-and-paper). Results We enrolled 120 mothers, and all completed the study. Data recording errors were prevented in the smartphone questionnaire. In the 120 pen-and-paper questionnaires (60 mothers), we found 192 data recording errors in 55 questionnaires. There was no significant difference in recording variation between the groups for the questionnaire pairs (P = .32) or variables (P = .45). The smartphone questionnaires were automatically uploaded and no data entry errors occurred. We found that even after double data entry of the pen-and-paper questionnaires, 65.0% (78/120) of the questionnaires did not match and needed to be checked. The mean duration of an interview was 10.22 (SD 2.17) minutes for the smartphone method and 10.83 (SD 2.94) minutes for the pen-and-paper method, which was not significantly different between the methods (P = .19). The mean costs per questionnaire were higher for the smartphone questionnaire (¥143, equal to US $23 at the exchange rate on April 24, 2012) than for the pen
penORNL: a parallel Monte Carlo photon and electron transport package using PENELOPE
International Nuclear Information System (INIS)
Bekar, Kursat B.; Miller, Thomas Martin; Patton, Bruce W.; Weber, Charles F.
2015-01-01
The parallel Monte Carlo photon and electron transport code package penORNL was developed at Oak Ridge National Laboratory to enable advanced scanning electron microscope (SEM) simulations on high-performance computing systems. This paper discusses the implementations, capabilities and parallel performance of the new code package. penORNL uses PENELOPE for its physics calculations and provides all available PENELOPE features to the users, as well as some new features including source definitions specifically developed for SEM simulations, a pulse-height tally capability for detailed simulations of gamma and x-ray detectors, and a modified interaction forcing mechanism to enable accurate energy deposition calculations. The parallel performance of penORNL was extensively tested with several model problems, and very good linear parallel scaling was observed with up to 512 processors. penORNL, along with its new features, will be available for SEM simulations upon completion of the new pulse-height tally implementation.
Una nueva generación de guías de práctica clínica confiables a través de Magic
Directory of Open Access Journals (Sweden)
Per Olav Vandvik
Full Text Available El diagnóstico y el tratamiento seguro y eficaz de enfermedades en la consulta requieren que el personal de salud pueda acceder a la mejor evidencia, preferentemente a través de guías de práctica clínica confiables. La mayoría de guías sufren debilidades metodológicas, formatos de presentación subóptimos y frecuente falta de actualización de su contenido. Nuevos estándares desarrollados por el Institute of Medicine de los Estados Unidos y el Guideline International Network and Systems for Trustworthy Guidelines, ofrecen mejores oportunidades para el éxito en el desarrollo de guías, pero también aumentan la demanda de competencia metodológica, experiencia clínica y tiempo. Tan importante como proporcionar un contenido fiable de guías de práctica clínica es lograr la difusión y actualización de estas. En este artículo describimos cómo aplicar nuevos estándares, métodos y herramientas para la creación, difusión y actualización de las guías de práctica clínica confiables. Trazamos pasos clave para el desarrollo de guías a través de la utilización del sistema Grading of Recommendations Assessment, Development and Evaluation (GRADE. Explicamos cómo un programa de investigación innovador, MAking GRADE the Irresistible Choice (MAGIC (www.magicproject.org a través de su plataforma autoría y publicación (MAGICapp ofrece nuevas soluciones para facilitar la producción, la difusión y la actualización dinámica de guías de práctica clínica confiables. Describimos un ejemplo práctico de una guía noruega publicada recientemente sobre los nuevos anticoagulantes orales para fibrilación auricular, mostrando cómo una guía publicada en el MAGICapp se puede utilizar la consulta médica
A Rapid and Sensitive Assay for the Detection of Benzylpenicillin (PenG in Milk.
Directory of Open Access Journals (Sweden)
Anna Pennacchio
Full Text Available Antibiotics, such as benzyl-penicillin (PenG and cephalosporin, are the most common compounds used in animal therapy. Their massive and illegal use in animal therapy and prophylaxis inevitably causes the presence of traces in foods of animal origin (milk and meat, which creates several problems for human health. With the aim to prevent the negative impact of β-lactam and, in particular, PenG residues present in the milk on customer health, many countries have established maximum residue limits (MRLs. To cope with this problem here, we propose an effective alternative, compared to the analytical methods actually employed, to quantify the presence of penicillin G using the surface plasmon resonance (SPR method. In particular, the PenG molecule was conjugated to a protein carrier to immunize a rabbit and produce polyclonal antibodies (anti-PenG. The produced antibodies were used as molecular recognition elements for the design of a competitive immune-assay for the detection of PenG by SPR experiments. The detection limit of the developed assay was found to be 8.0 pM, a value much lower than the MRL of the EU regulation limit that is fixed at 12 nM. Thus, our results clearly show that this system could be successfully suitable for the accurate and easy determination of PenG.
Garcia-Diaz, Silvia; Girabent-Farrés, Montserrat; Roig-Vilaseca, Daniel; Reina, Delia; Cerdà, Dacia; González, Marina; Torrente-Segarra, Vicenç; Fíguls, Ramon; Corominas, Hèctor
2013-01-01
The aims of this study are to evaluate the level of fear of post-injection pain prior to the administration, the difficulty in handling the device, and the level of satisfaction of patients using a pre-filled syringe versus an etanercept pen, as well as to evaluate the usefulness of the training given by nursing staff prior to starting with the pen, and the preferences of patients after using both devices. A prospective study was designed to follow-up a cohort of patients during a 6 months period. The data was collected using questionnaires and analyzed with SPSS 18.00. Rank and McNemar tests were performed. Statistical significance was pre-set at an α level of 0.05. A total of 29 patients were included, of whom 69% female, and with a mean age 52.5±10.9 years. Of these, 48% had rheumatoid arthritis, 28% psoriatic arthritis, 21% ankylosing spondylitis, and 3% undifferentiated spondyloarthropathy. There were no statistically significant differences either with the fear or pain or handling of the device between the syringe and the pen (P=.469; P=.812; P=.169 respectively). At 6 months, 59% of patients referred to being satisfied or very satisfied with the pen. Almost all (93%) found useful or very useful the training given by nursing staff prior to using the pen, and 55% preferred the pen over the pre-filled syringe. The etanercept pen is another subcutaneous device option for patients with chronic arthritis. According to the present study, nursing educational workshops before starting this therapy are recommended. Copyright © 2012 Elsevier España, S.L. All rights reserved.
Arquitectura del Paisaje: gu??a Did??ctica (ETSA-Universidad de Granada)
Cabrera-Manzano, David
2013-01-01
Esta Gu??a contiene informaci??n sobre contenidos, objetivos, actividades, metodolog??a, criterios de evaluaci??n y otros asuntos de inter??s para los alumnos de Arquitectura, que cursan la asignatura optativa ARQUITECTURA DEL PAISAJE del Grado de Arquitectura en la Escuela T??cnica Superior de Arquitectura (ETSA) de la Universidad de Granada.
Novel dip-pen nanolithography strategies for nanopatterning
Wu, C.C.
2010-01-01
Dip-pen nanolithography (DPN) is an atomic force microscopy (AFM)-based lithography technique offering the possibility of fabricating patterns with feature sizes ranging from micrometers to tens of nanometers, utilizing either top-down or bottom-up strategies. Although during its early development
Using a Computer Module to Teach Use of the EpiPen®
Directory of Open Access Journals (Sweden)
Amandeep Singh Rai
2011-11-01
Full Text Available Background: The medical literature suggests that patients and physicians are deficient in their ability to use a self-injectable epinephrine device (EpiPen® for management of anaphylaxis. This study aims to determine whether a computer module is an effective tool for the instruction of a technical skill to medical trainees. Methods: We conducted a two group comparison study of 35 Post-Graduate Year 1 and 2 Family Medicine residents. Participants were instructed on use of the EpiPen® using either a written module or a computer module. Participants were evaluated on use of the EpiPen® using standardized objective outcome measures by a blinded assessor. Assessments took place prior to and following instruction, using the assigned learning modality. Results: There were 34 participants who completed the study. Both groups demonstrated significant improvement in demonstrating use of the EpiPen® following training (p <0.001 for both. A significant post-training difference favouring the computer module learners over the written module learners was observed (p = 0.035. However, only 53% and 18% of candidates (computer module and written module, respectively were able to correctly perform all of the checklist steps. Conclusion: While our findings suggest computer modules represent an effective modality for teaching use of the EpiPen® to medical trainees, the low number of candidates who were able to perform all the checklist items regardless of modality needs to be addressed.
Ajalool on ajaloolaste nägu / Jean-Claude Schmitt ; interv. Marek Tamm
Schmitt, Jean-Claude
2004-01-01
Intervjuu ajaloolase Jean-Claude Schmittiga. Ilm. ka: Keha, pilt ja unenägu : intervjuu Jean-Claude Scmittiga // Schmitt, Jean-Claude. Püha hurdakoer : Guinefort - lasteravija 13. sajandist. - Tallinn, 2000. - Lk. 296-305 ; Kuidas kirjutatakse ajalugu? // Tamm, Marek. Kuidas kirjutatakse ajalugu? - Tallinn, 2007. - 161-177
Bartonellosis en Colombia, bartonellosis de guáitara ó fiebre verrucosa del guáitara
Directory of Open Access Journals (Sweden)
Luis Patiño Camargo
1939-04-01
Full Text Available Desde principios de 1936 las autoridades de Nariño venían seriamente preocupadas por una mortífera enfermedad epidémica aparecida al Norte en vertientes de juanambu y del rio Mayo, enfermedad que de improviso se presentó en el Guáitara con gran virulencia. El médico doctor Max Llorente, Gobernador entonces del Departamento, inspeccionó con el Director de Higiene la zona invadida, y a su regreso a Pasto conferencio con el Colegio Médico. En la reunión se acogió el diagnostico de paludismo agudo pernicioso. Como resultado se organizó una comisión de tratamiento encabezada por un médico, y se situó en Ancuya. Por esos días el Departamento Nacional de Higiene envió un ingeniero sanitario, quien recorrió las comarcas atacadas y rindió un informe.
SHiP: a new facility to search for heavy neutrinos and study $\
De Serio, Marilisa
2016-01-01
SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\
Extending Penning trap mass measurements with SHIPTRAP to the heaviest elements
International Nuclear Information System (INIS)
Block, M.; Ackermann, D.; Herfurth, F.; Hofmann, S.; Blaum, K.; Droese, C.; Marx, G.; Schweikhard, L.; Düllmann, Ch. E.; Eibach, M.; Eliseev, S.; Haettner, E.; Plaß, W. R.; Scheidenberger, C.; Heßberger, F. P.; Ramirez, E. Minaya; Nesterenko, D.
2013-01-01
Penning-trap mass spectrometry of radionuclides provides accurate mass values and absolute binding energies. Such mass measurements are sensitive indicators of the nuclear structure evolution far away from stability. Recently, direct mass measurements have been extended to the heavy elements nobelium (Z=102) and lawrencium (Z=103) with the Penning-trap mass spectrometer SHIPTRAP. The results probe nuclear shell effects at N=152. New developments will pave the way to access even heavier nuclides.
CrossRef Space-charge effects in Penning ion traps
Porobić, T; Breitenfeldt, M; Couratin, C; Finlay, P; Knecht, A; Fabian, X; Friedag, P; Fléchard, X; Liénard, E; Ban, G; Zákoucký, D; Soti, G; Van Gorp, S; Weinheimer, Ch; Wursten, E; Severijns, N
2015-01-01
The influence of space-charge on ion cyclotron resonances and magnetron eigenfrequency in a gas-filled Penning ion trap has been investigated. Off-line measurements with View the MathML source using the cooling trap of the WITCH retardation spectrometer-based setup at ISOLDE/CERN were performed. Experimental ion cyclotron resonances were compared with ab initio Coulomb simulations and found to be in agreement. As an important systematic effect of the WITCH experiment, the magnetron eigenfrequency of the ion cloud was studied under increasing space-charge conditions. Finally, the helium buffer gas pressure in the Penning trap was determined by comparing experimental cooling rates with simulations.
Effects of lignite application on ammonia and nitrous oxide emissions from cattle pens
Energy Technology Data Exchange (ETDEWEB)
Sun, Jianlei, E-mail: su@unimelb.edu.au [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia); Bai, Mei [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia); Shen, Jianlin [Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha 410125 (China); Griffith, David W.T. [Department of Chemistry, University of Wollongong, NSW 2522 (Australia); Denmead, Owen T. [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia); Hill, Julian [Ternes Agricultural Consulting Pty Ltd, Upwey, VIC 3158 (Australia); Lam, Shu Kee; Mosier, Arvin R. [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia); Chen, Deli, E-mail: delichen@unimelb.edu.au [Faculty of Veterinary and Agricultural Sciences, The University of Melbourne, VIC 3010 (Australia)
2016-09-15
Beef cattle feedlots are a major source of ammonia (NH{sub 3}) emissions from livestock industries. We investigated the effects of lignite surface applications on NH{sub 3} and nitrous oxide (N{sub 2}O) emissions from beef cattle feedlot pens. Two rates of lignite, 3 and 6 kg m{sup −2}, were tested in the treatment pen. No lignite was applied in the control pen. Twenty-four Black Angus steers were fed identical commercial rations in each pen. We measured NH{sub 3} and N{sub 2}O concentrations continuously from 4th Sep to 13th Nov 2014 using Quantum Cascade Laser (QCL) NH{sub 3} analysers and a closed-path Fourier Transform Infrared Spectroscopy analyser (CP-FTIR) in conjunction with the integrated horizontal flux method to calculate NH{sub 3} and N{sub 2}O fluxes. During the feeding period, 16 and 26% of the excreted nitrogen (N) (240 g N head{sup −1} day{sup −1}) was lost via NH{sub 3} volatilization from the control pen, while lignite application decreased NH{sub 3} volatilization to 12 and 18% of the excreted N, for Phase 1 and Phase 2, respectively. Compared to the control pen, lignite application decreased NH{sub 3} emissions by approximately 30%. Nitrous oxide emissions from the cattle pens were small, 0.10 and 0.14 g N{sub 2}O-N head{sup −1} day{sup −1} (< 0.1% of excreted N) for the control pen, for Phase 1 and Phase 2, respectively. Lignite application increased direct N{sub 2}O emissions by 40 and 57%, to 0.14 and 0.22 g N{sub 2}O-N head{sup −1} day{sup −1}, for Phase 1 and Phase 2, respectively. The increase in N{sub 2}O emissions resulting from lignite application was counteracted by the lower indirect N{sub 2}O emission due to decreased NH{sub 3} volatilization. Using 1% as a default emission factor of deposited NH{sub 3} for indirect N{sub 2}O emissions, the application of lignite decreased total N{sub 2}O emissions. - Graphical abstract: Lignite application substantially decreased NH{sub 3} emissions from cattle feedlots and increased
Guía clínica de la enfermedad de Pompe de inicio tardío
Barba-Romero, Miguel A.; Barrot, Emilia; Bautista-Lorite, Juan; Gutiérrez-Rivas, E.; Illa, Isabel; Jiménez, Luis M.; Ley-Martos, Myriam; López de Munain, Adolfo; Pardo, Julio; Pascual-Pascual, Samuel I.; Pérez-López, Jordi; Solera, Jesús; Vílchez-Padilla, Juan J.
2012-01-01
Hasta 2006, la enfermedad de Pompe o glucogenosis tipo II era una enfermedad incurable y con tratamiento meramente paliativo. El desarrollo de la terapia de sustitución con la enzima α-glucosidasa recombinante humana ha constituido el primer tratamiento específico para esta enfermedad. El objetivo de esta guía es servir de referencia en el manejo de la variedad de inicio tardío de la enfermedad de Pompe, es decir, la que aparece después del primer año de vida. En la guía, un grupo de exper...
Directory of Open Access Journals (Sweden)
Demián Glujovsky
2014-10-01
Full Text Available OBJETIVO: Evaluar el conocimiento que los editores de las revistas indizadas en la base de datos LILACS tienen acerca de las Guías para informar y publicar sobre investigaciones -promovidas por la Red EQUATOR (Enhancing Quality and Transparency of Health Research-, los requisitos de las revistas para su uso y el conocimiento de los editores sobre los motivos de la baja tasa de uso. MÉTODOS: Se encuestó por correo electrónico a editores de LILACS sobre las Guías y su disponibilidad en el sitio web de EQUATOR y los requerimientos y dificultades para su uso. RESULTADOS: De los 802 editores, 16,4% respondieron la encuesta, más de la mitad dijeron no conocer las Guías (en especial STROBE y PRISMA y 30% tenían conocimiento sobre la Red EQUATOR. CONCLUSIONES: El primer estudio en América Latina y el Caribe sobre el conocimiento que tienen los editores de LILACS sobre las Guías revela que más de la mitad no conoce las Guías ni la Red EQUATOR.
Why investors shy away from coal
International Nuclear Information System (INIS)
Roling, D.A.
1994-01-01
Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed
Ecosystem Pen Pals: Using Place-Based Marine Science and Culture to Connect Students
Wiener, Carlie S.; Matsumoto, Karen
2014-01-01
The marine environment provides a unique context for students to explore both natural and cultural connections. This paper reports preliminary findings on Ecosystem Pen Pals, an ocean literacy program for 4th and 5th graders focused on using a pen pal model for integrating traditional ecological knowledge into marine science. Surveys with…
Flexible AMOLED display on polyethylene napthalate (PEN) foil with metal-oxide TFT backplane
Tripathi, A.K.; Putten, B. van der; Steen, J.L. van der; Tempelaars, K.; Cobb, B.; Ameys, M.; Ke, T.H.; Myny, K.; Steudel, S.; Nag, M.; Schols, S.; Vicca, P.; Smout, S.; Genoe, J.; Heremans, P.; Yakimets, I.; Gelinck, G.H.
2012-01-01
We present a top emitting monochrome AMOLED display with 85dpi resolution using an amorphous Indium-Gallium-Zinc-Oxide (IGZO) TFT backplane on PEN-foil. Maximum processing temperature was limited to 150 °C in order to ensure an overlay accuracy < 3μm on PEN foil. The backplane process flow is based
Läti hea teatri mitu nägu / Rait Avestik
Avestik, Rait
2007-01-01
Läti teatri eelmise hooaja parimate uuslavastuste ülevaatefestivalist "Spelmanu Nakts 2006" ("Mängurite Ööd"). Etendustest: Albert Camus "Caligula" - lavastaja Dzh. Dzh. Dzhilindzhers (Dailes Teater), David Harrower "Noad kanade sees" - lavastaja Gatis Shmits (Dailes Teater), Umka.Iv ja Betontanc "Näita oma nägu" - lavastaja Matjazh Pograjc, Jorge Luis Borges "Hellus" - lavastaja Elina Cerpa (Riia Uus Teater), Vladimir Sorokin "Jää" - lavastaja Alvis Hermanis (Riia Uus Teater)
Studying the variability in the Raman signature of writing pen inks.
Braz, André; López-López, María; García-Ruiz, Carmen
2014-12-01
This manuscript aims to study the inter and intra brand, model and batch variability in the Raman spectral signature among modern pen inks that will help forensic document examiners during the interpretation process. Results showed that most oil-based samples have similar Raman signatures that are characteristic of the Crystal Violet dye, independently of the brand. Exception was the Pilot samples that use Victoria Pure Blue BO instead. This small inter-brand variability makes oil-based pens difficult to discriminate by brand. On the contrary, gel and liquid-based samples use different colorants such as Rhodamine B, Copper Phthalocyanine, Ethyl Violet and Victoria Blue B. No particular pattern was observed regarding the colorants used by each brand, except the Pilot samples that were the only brand using the Victoria Blue B dye, which is a clear distinct feature. Additionally, the intra-brand variability was also large among gel-based Pilot samples. The small spectral differences observed among several batches of Bic Crystal Medium samples demonstrated that changes were introduced in their chemical formula over the years. The intra-batch variability was small and no spectral differences were observed within batches. This manuscript demonstrates the potential of Raman spectroscopy for discriminating pens inks from different brands and models and even, batches. Additionally, the main colorants used in modern pens were also identified. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Cancer Prevention and Control Research Manpower Development
1999-10-01
for preeclampsia in twin pregnancies: a population-based cohort study. Obstet Gynecol 1995;85:645-50. 17. Gu Y , He S, Shi L, Li 0, Zhu Kr, Yin Z, Wang...Gestational Diabetes, Sickle Cell Anemia in the laboratories of Jayduff Vadgama, P.D. and of Steven Taylor, M.D. at Charles Drew University of Medicine...California RESEARCH EXPERIENCE: Sickle Cell Anemia Infant Neurodevelopment and language acquisistion Deviant sexual behavior and group therapy
Electrospray deposition from fountain pen AFM probes
Geerlings, J.; Sarajlic, Edin; Berenschot, Johan W.; Abelmann, Leon; Tas, Niels Roelof
2012-01-01
In this paper we present for the first time electrospraying from fountain pen probes. By using electrospray contactless deposition in an AFM setup becomes possible. Experiments on a dedicated setup were carried out as first step towards this goal. Spraying from 8 and 2 µm apertures was observed. For
Energy Technology Data Exchange (ETDEWEB)
1991-11-01
The National Energy Plan (PEN) for the period 1991 to 2000 lays down basic guidelines for a Spanish energy policy. This includes a wide range of economic measures. The PEN is divided into five main sections with two appendices. The sections are: the international situation; energy demand; energy supply; energy and the environment; and R D policy. The appendices are: Energy-saving and energy-efficiency plan; and General plan for radioactive waste. The PEN provides for 4-year research programmes which aim to reduce the environmental impact of energy production and use. General demand for energy during this period will increase by2.4% and investment in power installations and in the gas sector will be some 1.5 thousand million pesetas. 4 figs., 3 tabs.
Alyami, Abeer; Saviello, Daniela; McAuliffe, Micheal A. P.; Cucciniello, Raffaele; Mirabile, Antonio; Proto, Antonio; Lewis, Liam; Iacopino, Daniela
2017-08-01
Au nanorods were used as an alternative to commonly used Ag nanoparticles as Surface Enhanced Raman Scattering (SERS) probes for identification of dye composition of blue BIC ballpoint pens. When used in combination with Thin Layer Chromatography (TLC), Au nanorod colloids allowed identification of the major dye components of the BIC pen ink, otherwise not identifiable by normal Raman spectroscopy. Thanks to their enhanced chemical stability compared to Ag colloids, Au nanorods provided stable and reproducible SERS signals and allowed easy identification of phthalocyanine and triarylene dyes in the pen ink mixture. These findings were supported by FTIR and MALDI analyses, also performed on the pen ink. Furthermore, the self-assembly of Au nanorods into large area ordered superstructures allowed identification of BIC pen traces. SERS spectra of good intensity and high reproducibility were obtained using Au nanorod vertical arrays, due to the high density of hot spots and morphological reproducibility of these superstructures. These results open the way to the employment of SERS for fast screening analysis and for quantitative analysis of pens and faded pens which are relevant for the fields of forensic and art conservation sciences.
Dingemanse, C.W.
2008-01-01
In the early modern period pamphlets constituted the most important medium to influence public opinion in the Netherlands. The thesis Rap van tong, scherp van pen (Glib tongues, sharp pens) focuses on the literary and rhetorical aspects of a remarkable type of pamphlet called praatje (small-talk),
International Nuclear Information System (INIS)
Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.
2016-01-01
The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.
Karch, André; Vogel, Ulrich; Claus, Heike
2015-10-01
In meningococci, reduced penicillin susceptibility is associated with five specific mutations in the transpeptidase region of penicillin binding protein 2 (PBP2). We showed that the same set of mutations was present in 64 of 123 Neisseria lactamica strains obtained from a carriage study (MIC range: 0.125-2.0mg/L). The PBP2 encoding penA alleles in these strains were genetically similar to those found in intermediate resistant meningococci suggesting frequent interspecies genetic exchange. Fifty-six N. lactamica isolates with mostly lower penicillin MICs (range: 0.064-0.38mg/L) exhibited only three of the five mutations. The corresponding penA alleles were unique to N. lactamica and formed a distinct genetic clade. PenA alleles with no mutations on the other hand were unique to meningococci. Under penicillin selective pressure, genetic transformation of N. lactamica penA alleles in meningococci was only possible for alleles encoding five mutations, but not for those encoding three mutations; the transfer resulted in MICs comparable to those of meningococci harboring penA alleles that encoded PBP2 with five mutations, but considerably lower than those of the corresponding N. lactamica donor strains. Due to a transformation barrier the complete N. lactamica penA could not be transformed into N. meningitidis. In summary, penicillin MICs in N. lactamica were associated with the number of mutations in the transpeptidase region of PBP2. Evidence for interspecific genetic transfer was only observed for penA alleles associated with higher MICs, suggesting that alleles encoding only three mutations in the transpeptidase region are biologically not effective in N. meningitidis. Factors other than PBP2 seem to be responsible for the high levels of penicillin resistance in N. lactamica. A reduction of penicillin susceptibility in N. meningitidis by horizontal gene transfer from N. lactamica is unlikely to happen. Copyright © 2015 Elsevier GmbH. All rights reserved.
Gose, Severin; Nguyen, Duylinh; Lowenberg, Daniella; Samuel, Michael; Bauer, Heidi; Pandori, Mark
2013-12-04
The spread of Neisseria gonorrhoeae strains with mosaic penA alleles and reduced susceptibility to extended-spectrum cephalosporins is a major public health problem. While much work has been performed internationally, little is known about the genetics or molecular epidemiology of N. gonorrhoeae isolates with reduced susceptibility to extended-spectrum cephalosporins in the United States. The majority of N. gonorrhoeae infections are diagnosed without a live culture. Molecular tools capable of detecting markers of extended-spectrum cephalosporin resistance are needed. Urethral N. gonorrhoeae isolates were collected from 684 men at public health clinics in California in 2011. Minimum inhibitory concentrations (MICs) to ceftriaxone, cefixime, cefpodoxime and azithromycin were determined by Etest and categorized according to the U.S. Centers for Disease Control 2010 alert value breakpoints. 684 isolates were screened for mosaic penA alleles using real-time PCR (RTPCR) and 59 reactive isolates were subjected to DNA sequencing of their penA alleles and Neisseria gonorrhoeae multi-antigen sequence typing (NG-MAST). To increase the specificity of the screening RTPCR in detecting isolates with alert value extended-spectrum cephalosporin MICs, the primers were modified to selectively amplify the mosaic XXXIV penA allele. Three mosaic penA alleles were detected including two previously described alleles (XXXIV, XXXVIII) and one novel allele (LA-A). Of the 29 isolates with an alert value extended-spectrum cephalosporin MIC, all possessed the mosaic XXXIV penA allele and 18 were sequence type 1407, an internationally successful strain associated with multi-drug resistance. The modified RTPCR detected the mosaic XXXIV penA allele in urethral isolates and urine specimens and displayed no amplification of the other penA alleles detected in this study. N. gonorrhoeae isolates with mosaic penA alleles and reduced susceptibility to extended-spectrum cephalosporins are currently
Pengembangan Media Ice Breaker Talking Pen pada Mata Pelajaran PAI Kelas X SMAN 100 Jakarta
Directory of Open Access Journals (Sweden)
Ati Sulastri
2017-07-01
Full Text Available This study aims to find out how to develop media ice breaker talking pen and media feasibility on the subjects of PAI. The research method used is Borg and Gall development model which includes requirement analysis, validation test, and test phase. The result of this development research is ice breaker talking pen media product which consists of command card and music developed through data collection, planning, product development, and validation and testing. Based on the validation results obtained the average score of the material experts of 4.75 (very good, and from the media experts of 3.78 (good, and the results of student responses about this media amounted to 4.39 or very good category. Therefore the ice breaker talking media on the eyes of learning PAI class X is declared eligible for use with very good category. Keywords: Development Model Study, Ice Breaker Talking Pen, PAI Abstrak Penelitian ini bertujuan untuk mengetahui cara mengembangkan media ice breaker talking pen dan kelayakan media tersebut pada mata pelajaran PAI. Metode yang digunakan adalah model pengembangan Borg dan Gall yang meliputi analisis kebutuhan, tahap validasi dan tahap uji coba. Hasil penelitian pengembangan ini adalah produk media ice breaker talking pen yang terdiri dari kartu perintah dan musik yang dikembangkan melalui tahap pengumpulan data, perencanaan, pengembangan produk, serta validasi dan uji coba. Berdasarkan pada hasil validasi didapat skor rata-rata dari ahli materi sebesar 4,75 (sangat baik, dan dari ahli media sebesar 3,78 (baik. Serta hasil dari tanggapan siswa mengenai media ini sebesar 4,39 atau kategori sangat baik. Maka dari itu media ice breaker talking pen pada mata pelajaran PAI kelas X dinyatakan layak untuk digunakan dengan kategori sangat baik. Kata Kunci : Pengembangan Model Pembelajaran, Ice Breaker Talking Pen, PAI
Dosing Accuracy of Insulin Aspart FlexPens After Transport Through the Pneumatic Tube System.
Ward, Leah G; Heckman, Michael G; Warren, Amy I; Tran, Kimberly
2013-01-01
The purpose of this study was to evaluate whether transporting insulin aspart FlexPens via a pneumatic tube system affects the dosing accuracy of the pens. A total of 115 Novo Nordisk FlexPens containing insulin aspart were randomly assigned to be transported via a pneumatic tube system (n = 92) or to serve as the control (n = 23). Each pen was then randomized to 10 international unit (IU) doses (n = 25) or 30 IU doses (n = 67), providing 600 and 603 doses, respectively, for the pneumatic tube group. The control group also received random assignment to 10 IU doses (n = 6) or 30 IU doses (n = 17), providing 144 and 153 doses, respectively. Each dose was expelled using manufacturer instructions. Weights were recorded, corrected for specific gravity, and evaluated based on acceptable International Organization for Standardization (ISO) dosing limits. In the group of pens transported through the pneumatic tube system, none of the 600 doses of 10 IU (0.0%; 95% CI, 0.0 to 0.6) and none of the 603 doses of 30 IU (0.0%; 95% CI, 0.0 to 0.6) fell outside of the range of acceptable weights. Correspondingly, in the control group, none of the 144 doses at 10 IU (0.0%; 95% CI, 0.0 to 2.5) and none of the 153 doses at 30 IU (0.0%; 95% CI, 0.0 to 2.4) were outside of acceptable ISO limits. Transportation via pneumatic tube system does not appear to compromise dosing accuracy. Hospital pharmacies may rely on the pneumatic tube system for timely and accurate transport of insulin aspart FlexPens.
The effect of sex, slaughter weight and weight gains in PEN-AR-LAN ...
African Journals Online (AJOL)
The aim of the study was to determine the effect of sex, body weight and growth rates on basic fattening and slaughter indexes in PEN-AR-LAN fatteners. The research was conducted on 274 PEN-ARLAN hybrid fatteners coming from sows of the Naïma maternal line and was sired by boars of the P-76 meat line. Recorded ...
Guía práctica para la identificación y manejo de plagas en hortalizas
Barrios G., Fernando; Gonzalez D., Fernando; Figueroa P., Adalberto
2010-01-01
Guía práctica para la identificación y manejo de plagas en hortalizas La guía práctica comprende una descripción de los insectos, ácaros y moluscos que atacan los cultivos hortícolas en nuestro país. Se registraron 33 especies hortícolas pertenecientes a 10 familias botánicas que por su afinidad bioquímica atraen las mismas plagas. Se describieron 52 plagas con las respectivas recomendaciones de manejo. También se presentan las alternativas para un control eficaz con enfoque ecológico....
International Nuclear Information System (INIS)
Lee, L.C.; Shandu, K.T.S.; Nor Syahirah Mohamad Razi; Ab Aziz Ishak; Khairul Osman
2015-01-01
Twelve varieties of blue ball point pens were selected and analyzed using UV-Vis spectrometer and ultra-performance liquid chromatography (UPLC). The aim of the study was to determine discrimination power (DP) of these methods in differentiating pen inks collected from the market in Malaysia. Discrimination analysis of 66 possible pen-pair of blue ball point pens was carried out via one-way ANOVA based on obtained chromatogram and spectra. A total of 18 peaks were determined as coming from inks based on the chromatographic data extracted at three different wavelengths (279, 370 and 400 nm). While for the UV-Vis spectrometer analysis, presence of peaks at 303, 545, 577 and 584 nm wavelengths were recorded. UV-Vis spectral data were mainly produced by the colorant components (for example, dyes) found in inks and UPLC may detect ink components other than dyes, for example, additives. As conclusion, the DP for UV-Vis and UPLC were determined to be 72.12 % and 98.48 %, respectively. This manuscript demonstrates the potential of UPLC for discriminating pen inks based on non-dye components. Additionally, the dye components in inks do not seem to play important role in discrimination of pen inks. (author)
Park, Minwoo; Min, Yuho; Lee, Yu-Jeong; Jeong, Unyong
2014-03-01
This study demonstrates the growth of long triisopropylsilyethynyl pentacene (TIPS-PEN) nanofibrils in a thin film of a crystalline polymer, poly(ε-caprolactone) (PCL). During spin-coating, TIPS-PEN molecules are locally extracted around the PCL grain boundaries and they crystallize into [010] direction forming long nanofibrils. Molecular weight of PCL and weight fraction (α) of TIPS-PEN in PCL matrix are key factors to the growth of nanofibrils. Long high-quality TIPS-PEN nanofibrils are obtained with high-molecular-weight PCL and at the α values in the range of 0.03-0.1. The long nanofibrils are used as an active layer in a field-effect organic transistor. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Spendere meno, spendere meglio: una proposta panottica di J.-C. Guédon
Directory of Open Access Journals (Sweden)
Maria Chiara Pievatolo
2013-06-01
Full Text Available J.-C. Guédon ha commentato la nostra campagna di crowdsourcing in merito alle spese delle biblioteche sulla mailing list Nexa. Offriamo, qui di seguito, la versione italiana delle sue osservazioni – che presuppongono un mondo accademico molto diverso da quello impostoci...
Low birth weight infants and Calmette-Guérin bacillus vaccination at birth
DEFF Research Database (Denmark)
Roth, Adam Anders Edvin; Jensen, Henrik; Garly, May-Lill
2004-01-01
In developing countries, low birth weight (LBW) children are often not vaccinated with Calmette-Guérin bacillus (BCG) at birth. Recent studies have suggested that BCG may have a nonspecific beneficial effect on infant mortality. We evaluated the consequences of not vaccinating LBW children at birth...
A Penning-assisted subkilovolt coaxial plasma source
International Nuclear Information System (INIS)
Wang Zhehui; Beinke, Paul D.; Barnes, Cris W.; Martin, Michael W.; Mignardot, Edward; Wurden, Glen A.; Hsu, Scott C.; Intrator, Thomas P.; Munson, Carter P.
2005-01-01
A Penning-assisted 20 MW coaxial plasma source (plasma gun), which can achieve breakdown at sub-kV voltages, is described. The minimum breakdown voltage is about 400 V, significantly lower than previously reported values of 1-5 kV. The Penning region for electrons is created using a permanent magnet assembly, which is mounted to the inside of the cathode of the coaxial plasma source. A theoretical model for the breakdown is given. A 900 V 0.5 F capacitor bank supplies energy for gas breakdown and plasma sustainment from 4 to 6 ms duration. Typical peak gun current is about 100 kA and gun voltage between anode and cathode after breakdown is about 200 V. A circuit model is used to understand the current-voltage characteristics of the coaxial gun plasma. Energy deposited into the plasma accounts for about 60% of the total capacitor bank energy. This plasma source is uniquely suitable for studying multi-MW multi-ms plasmas with sub-MJ capacitor bank energy
Coblentz, W K; Hoffman, P C; Esser, N M; Bertram, M G
2013-10-01
Our objectives were to describe and test refined procedures for quantifying excreta produced from whole pens of dairy heifers. Previous research efforts attempting to make whole-pen measurements of excreta output have been complicated by the use of organic bedding, which requires cumbersome analytical techniques to quantify excreta apart from the bedding. Research pens equipped with sand-bedded freestalls offer a unique opportunity for refinement of whole-pen fecal collection methods, primarily because sand-bedded freestall systems contain no organic bedding; therefore, concentrations of ash within the manure, sand, and feces can be used to correct for contamination of manure by sand bedding. This study was conducted on a subset of heifers from a larger production-scale feeding trial evaluating ensiled eastern gamagrass [Tripsacum dactyloides (L.) L.] haylage (EGG) that was incorporated into a corn silage/alfalfa haylage-based blended diet at rates of 0, 9.1, 18.3, or 27.4% of total DM. The diet without EGG also was offered on a limit-fed basis. Eighty Holstein dairy heifers were blocked (heavy weight, 424 ± 15.9 kg; light weight, 324 ± 22.4 kg) and then assigned to 10 individual pens containing 8 heifers/pen. One pen per block was assigned to each of the 5 research diets, and whole-pen fecal collections were conducted twice for each pen. Grab fecal samples also were gathered from individual heifers within each pen, and subsequent analysis of these whole-pen composites allowed reasonable estimates of OM and NDF excreta output. Under the conditions of our experimental design, pooled SEM for the excreta DM, OM, NDF, and NDF (ash corrected) output were 0.113, 0.085, 0.093, and 0.075 kg·heifer(-1)·d(-1), respectively. For DM excretion, this represented about one-third of the SEM reported for previous whole-pen collections from bedded-pack housing systems. Subsequent calculations of apparent DM and OM digestibilities indicated that the technique was sensitive, and
From Pen-and-Paper Sketches to Prototypes: The Advanced Interaction Design Environment
DEFF Research Database (Denmark)
Störrle, Harald
2014-01-01
Pen and paper is still the best tool for sketching GUIs. How-ever, sketches cannot be executed, at best we have facilitated or animated scenarios. The Advanced User Interaction Environment facilitates turn-ing hand-drawn sketches into executable prototypes.......Pen and paper is still the best tool for sketching GUIs. How-ever, sketches cannot be executed, at best we have facilitated or animated scenarios. The Advanced User Interaction Environment facilitates turn-ing hand-drawn sketches into executable prototypes....
Control of the conformations of ion Coulomb crystals in a Penning trap
Mavadia, Sandeep; Goodwin, Joseph F.; Stutter, Graham; Bharadia, Shailen; Crick, Daniel R.; Segal, Daniel M.; Thompson, Richard C.
2013-01-01
Laser-cooled atomic ions form ordered structures in radiofrequency ion traps and in Penning traps. Here we demonstrate in a Penning trap the creation and manipulation of a wide variety of ion Coulomb crystals formed from small numbers of ions. The configuration can be changed from a linear string, through intermediate geometries, to a planar structure. The transition from a linear string to a zigzag geometry is observed for the first time in a Penning trap. The conformations of the crystals are set by the applied trap potential and the laser parameters, and agree with simulations. These simulations indicate that the rotation frequency of a small crystal is mainly determined by the laser parameters, independent of the number of ions and the axial confinement strength. This system has potential applications for quantum simulation, quantum information processing and tests of fundamental physics models from quantum field theory to cosmology. PMID:24096901
Rody, Carlotta A.
High school biology classes traditionally follow a lecture format to disseminate content and new terminology. With the inclusive practices of No Child Left Behind, the Common Core State Standards, and end-of-course exam requirement for high school diplomas, classes include a large range of achievement levels and abilities. Teachers assume, often incorrectly, that students come to class prepared to listen and take notes. In a standard diploma, high school biology class in a separate school for students with emotional and behavioral disorders, five students participated in a single-subject, alternating treatment design study that compared the use of regular pens and digital pens to take notes during 21 lecture sessions. Behavior measures were threefold between the two interventions: (a) quantity of notes taken per minute during lectures, (b) quantity of notes or notations taken during review pauses, and (c) percent of correct responses on the daily comprehension quizzes. The study's data indicated that two students were inclined to take more lecture notes when using the digital pen. Two students took more notes with the regular pen. One student demonstrated no difference in her performance with either pen type. Both female students took more notes per minute, on average, than the three males regardless of pen type. During the review pause, three of the five students only added notes or notations to their notes when using the regular pen. The remaining two students did not add to their notes. Quiz scores differed in favor of the regular pen. All five participants earned higher scores on quizzes given during regular pen sessions. However, the differences were minor, and recommendations are made for specific training in note-taking, the pause strategy, and digital pen fluency which may produce different results for both note-taking and quiz scores.
Transport of three veterinary antimicrobials from feedlot pens via simulated rainfall runoff.
Sura, Srinivas; Degenhardt, Dani; Cessna, Allan J; Larney, Francis J; Olson, Andrew F; McAllister, Tim A
2015-07-15
Veterinary antimicrobials are introduced to wider environments by manure application to agricultural fields or through leaching or runoff from manure storage areas (feedlots, stockpiles, windrows, lagoons). Detected in manure, manure-treated soils, and surface and ground water near intensive cattle feeding operations, there is a concern that environmental contamination by these chemicals may promote the development of antimicrobial resistance in bacteria. Surface runoff and leaching appear to be major transport pathways by which veterinary antimicrobials eventually contaminate surface and ground water, respectively. A study was conducted to investigate the transport of three veterinary antimicrobials (chlortetracycline, sulfamethazine, tylosin), commonly used in beef cattle production, in simulated rainfall runoff from feedlot pens. Mean concentrations of veterinary antimicrobials were 1.4 to 3.5 times higher in surface material from bedding vs. non-bedding pen areas. Runoff rates and volumetric runoff coefficients were similar across all treatments but both were significantly higher from non-bedding (0.53Lmin(-1); 0.27) than bedding areas (0.40Lmin(-1); 0.19). In keeping with concentrations in pen surface material, mean concentrations of veterinary antimicrobials were 1.4 to 2.5 times higher in runoff generated from bedding vs. non-bedding pen areas. Water solubility and sorption coefficient of antimicrobials played a role in their transport in runoff. Estimated amounts of chlortetracycline, sulfamethazine, and tylosin that could potentially be transported to the feedlot catch basin during a one in 100-year precipitation event were 1.3 to 3.6ghead(-1), 1.9ghead(-1), and 0.2ghead(-1), respectively. This study demonstrates the magnitude of veterinary antimicrobial transport in feedlot pen runoff and supports the necessity of catch basins for runoff containment within feedlots. Crown Copyright © 2015. Published by Elsevier B.V. All rights reserved.
Pen confinement of yearling ewes with cows or heifers for 14 days to produce bonded sheep.
Fredrickson, E L.; Anderson, D M.; Estell, R E.; Havstad, K M.; Shupe, W L.; Remmenga, M D.
2001-06-01
Mixed species stocking is commonly a more ecologically sound and efficient use of forage resources than single species stocking, especially in pastures having complex assemblages of forage species. However, in many environments livestock predation on especially smaller ruminants adds an extra challenge to mixed species stocking. When mixed sheep and cattle remain consistently as a cohesive group (flerd), predation risks are lessened, while fencing and herding costs are reduced. To establish a cohesive group (bond), a 30-day bonding period in which young sheep and cattle pairs are penned together is currently recommended. The purpose of this research was to test if a bond could be produced in open field test. Other behaviors were also noted and recorded during the field test. Separation distance did not differ (P=0.973) between the PC and PH treatments; however, separation distance for NC versus NH (Ptime grazing and less time walking than animals not previously penned for 14 days. Penned animals also vocalized less than non-penned animals during the open field test. The bond sheep formed to the bovines was not affected by cow age. These data suggest that inter-specific bond formation using pen confinement can be accomplished within 14 days, representing a 53% savings in time and associated costs when compared to pen confinement lasting 30 days.
Xu XP; Deng DN; Gu YH; Ng CS; Cai X; Xu J; Zhang XS; Ke DG; Yu QH; Chan CK
2018-01-01
Xiao Ping Xu,* Dong Ning Deng,* Yong Hong Gu, Chui Shan Ng, Xiao Cai, Jun Xu, Xin Shi Zhang, Dong Ge Ke, Qian Hui Yu, Chi Kuen Chan Clinical Service Department, The University of Hong Kong - Shenzhen Hospital, Shenzhen, Guangdong, People’s Republic of China *These authors contributed equally to this work Background: The World Health Organization highlights that patient safety interventions are not lacking but that the local context affects their successful implementation. Increasing att...
Aronson, Ronnie; Gibney, Michael A; Oza, Kunjal; Bérubé, Julie; Kassler-Taub, Kenneth; Hirsch, Laurence
2013-07-01
Pen needles (PNs) are essential for insulin injections using pen devices. PN characteristics affect patients' injection experience. The goal of this study was to evaluate the impact of a new extra-thin wall (XTW) PN versus usual PNs on overall patient preference, ease of injection, perceived time to complete the full dose, thumb button force to deliver the injection, and dose delivery confidence in individuals with diabetes mellitus (DM). Subjects injected insulin with the KwikPen(TM) (Eli Lilly and Company, Indianapolis, Indiana), SoloSTAR(®) (sanofi-aventis U.S. LLC, Bridgewater, New Jersey), and FlexPen(®) (Novo Nordisk A/S, Bagsvaerd, Denmark) insulin pens, and included some with impaired hand dexterity. We first performed quantitative testing of XTW and comparable PNs with the 3 insulin pens for thumb force, flow rate, and time to deliver medication. A prospective, randomized, 2-period, open-label, crossover trial was then conducted in patients aged 35 to 80 years with type 1 or type 2 DM who injected insulin by pen for ≥2 months, with at least 1 daily dose ≥10 U. Patients who used 4- to 8-mm length PNs with 31- to 32-G diameter were randomly assigned to use their current PN or the same/similar size XTW PN at home for ~1 week and the other PN the second week. They completed several comparative 150-mm visual analog scales and direct questions at the end of period 2. XTW PNs had statistically significant better performance for each studied PN characteristic (thumb force, flow, and time to deliver medication) for all pens combined and each individual pen brand (all, P ≤ 0.05). Of 216 patients randomized to study groups (80, SoloSTAR; 77, FlexPen; 59, KwikPen), 209 completed both periods; 198 were evaluable. Baseline characteristics revealed a mean (SD) age of 60.8 (9.3) years, insulin pen use duration of 4.3 (4.1) years, and mean total daily dose of 75.1 (52.3) U (range, 10-420 U). Approximately 50% of patients were female; 81.5% were white and 14.8% were
Space-charge effects in Penning ion traps
Czech Academy of Sciences Publication Activity Database
Porobic, T.; Beck, M.; Breitenfeldt, M.; Couratin, C.; Finlay, P.; Knecht, A.; Fabian, X.; Friedag, P.; Flechard, X.; Lienard, E.; Ban, G.; Zákoucký, Dalibor; Soti, G.; Van Gorp, S.; Weinheimer, C.; Wursten, E.; Severijns, N.
2015-01-01
Roč. 785, JUN (2015), s. 153-162 ISSN 0168-9002 R&D Projects: GA MŠk LA08015; GA MŠk(CZ) LG13031 Institutional support: RVO:61389005 Keywords : Penning trap * space-charge * magnetron motion * ion trapping * buffer gas cooling * ion cyclotron resonance Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.200, year: 2015
Directory of Open Access Journals (Sweden)
Ying-Ju Lai
Full Text Available Gamma-secretase-mediated Notch3 signaling is involved in smooth muscle cell (SMC hyper-activity and proliferation leading to pulmonary arterial hypertension (PAH. In addition, Propylthiouracil (PTU, beyond its anti-thyroid action, has suppressive effects on atherosclerosis and PAH. Here, we investigated the possible involvement of gamma-secretase-mediated Notch3 signaling in PTU-inhibited PAH. In rats with monocrotaline-induced PAH, PTU therapy improved pulmonary arterial hypertrophy and hemodynamics. In vitro, treatment of PASMCs from monocrotaline-treated rats with PTU inhibited their proliferation and migration. Immunocyto, histochemistry, and western blot showed that PTU treatment attenuated the activation of Notch3 signaling in PASMCs from monocrotaline-treated rats, which was mediated via inhibition of gamma-secretase expression especially its presenilin enhancer 2 (Pen-2 subunit. Furthermore, over-expression of Pen-2 in PASMCs from control rats increased the capacity of migration, whereas knockdown of Pen-2 with its respective siRNA in PASMCs from monocrotaline-treated rats had an opposite effect. Transfection of PASMCs from monocrotaline-treated rats with Pen-2 siRNA blocked the inhibitory effect of PTU on PASMC proliferation and migration, reflecting the crucial role of Pen-2 in PTU effect. We present a novel cell-signaling paradigm in which overexpression of Pen-2 is essential for experimental pulmonary arterial hypertension to promote motility and growth of smooth muscle cells. Propylthiouracil attenuates experimental PAH via suppression of the gamma-secretase-mediated Notch3 signaling especially its presenilin enhancer 2 (Pen-2 subunit. These findings provide a deep insight into the pathogenesis of PAH and a novel therapeutic strategy.
Guía para la evaluación del riesgo de los polinizadores
La Guía para la evaluación del riesgo de los polinizadores de la EPA es parte de una estrategia de la evaluación de los riesgos que presentan los pesticidas para las abejas a fin de mejorar la protección de los polinizadores.
Miks tulite e-õppe konverentsile? / Tia Vene, Tatjana Guž, Eha Kaukveer...[jt.
2009-01-01
Konverentsist " Õppijalt õppijale". Küsimusele vastavad: Kallavere Keskkooli algklassiõpetaja Tia Vene, Lasnamäe Põhikooli inglise keele õpetaja Tatjana Guž, Tallinna Päikesejänku lasteaia õpetaja Eha Kaukveer, Pelgulinna Gümnaasiumi IT-arendusjuht, arvutiõpetaja Birgit Lorenz ja Haapsalu Sanatoorse Internaatkooli õpetaja Villu Baumann
Prevalence of digital dermatitis in young stock in Alberta, Canada, using pen walks.
Jacobs, C; Orsel, K; Barkema, H W
2017-11-01
Digital dermatitis (DD), an infectious bacterial foot lesion prevalent in dairy cattle worldwide, reduces both animal welfare and production. This disease was recently identified in replacement dairy heifers, with implications including increased risk of DD and decreased milk production in first lactation, poor reproductive performance, and altered hoof conformation. Therefore, a simple and effective method is needed to identify DD in young stock and to determine risk factors for DD in this group so that effective control strategies can be implemented. The objectives of this study were to (1) determine prevalence of DD in young stock (based on pen walks); and (2) identify potential risk factors for DD in young stock. A cross-sectional study was conducted on 28 dairy farms in Alberta, Canada; pen walks were used to identify DD (present/absent) on the hind feet of group-housed, young dairy stock. A subset of 583 young stock on 5 farms were selected for chute inspection of feet to determine the accuracy of pen walks for DD detection. Pen walks as a means of identifying DD lesions on the hind feet in young stock had sensitivity and specificity at the animal level of 65 and 98%, with positive and negative predictive values of 94 and 83%, respectively, at a prevalence of 37%. At the foot level, pen walks had sensitivity and specificity of 62 and 98%, respectively, with positive and negative predictive values of 92 and 88%, respectively, at a prevalence of 26%. Pen walks identified DD in 79 [2.9%; 95% confidence interval (95% CI): 2.3-3.6%] of 2,815 young stock on 11 (39%; 95% CI: 22-59%) of 28 farms, with all 79 DD-positive young stock ≥309 d of age. Apparent within-herd prevalence estimates ranged from 0 to 9.3%, with a mean of 1.4%. True within-herd prevalence of DD in young stock, calculated using the sensitivity and specificity of the pen walks, ranged from 0 to 12.6%, with a mean of 1.4%. On the 11 DD-positive farms, the proportion of young stock >12 mo of age
An audit of Colposcopy referrals from a GU/STD clinic
Directory of Open Access Journals (Sweden)
Ryan Ailis
2008-06-01
Full Text Available Abstract Background Cervical cancer is increasing at 1.5% per year in Ireland with 50% mortality giving 2.2% of all cancer deaths. In the Mid-West region a pilot screening programme has begun to screen all women 25–60 years. 66% of Genitourinary/Sexually transmitted disease (GU/STD clinics' abnormal smears are Methods 221(8.4% patients referred to colposcopy over 4 years were audited. Retrospective analysis was carried out on GU/STD clinic files, hospital files and computer records for biopsy reports. Ethical approval was prospectively granted. Results 2637 smears were carried out from November 1999 – September 2003. 221 patients referred to colposcopy were audited. 1%, 3%, 5% had severe, moderate and, mild dyskaryosis, respectively, on cervical screening while 0.8%, 1.2%, 1.5% had CIN3, CIN2, CIN1 abnormalities, respectively, on biopsy with 3.5% having no abnormality (Cervical Intraepithelial Neoplasia = CIN. 53% referred to colposcopy were Conclusion 2% had high grade lesions. 37% of high grade lesions are Of the high grade lesions 13% had Chlamydia trachomatis (27% of CIN3 and 44% had HPV despite Relative Risks (RR being 0.75 and 1.09 respectively. Older women had higher grade changes. No statistical difference was found for progression, regression and persistence in those over and under 25.
International Nuclear Information System (INIS)
Devgan, Kusum; Singh, Lakhwant; Samra, Kawaljeet Singh
2013-01-01
Highlights: • The present paper reports the effect of swift heavy ion irradiation on Polyethylene Naphthalate (PEN). • Swift heavy ion irradiation introduces structural modification and degradation of PEN at different doses. • Lower irradiation doses in PEN result in modification of structural properties and higher doses lead to complete degradation. • Strong correlation between structural, optical, and thermal properties. - Abstract: The effects of swift heavy ion irradiation on the structural characteristics of Polyethylene naphthalate (PEN) were studied. Samples were irradiated in vacuum at room temperature by lithium (50 MeV), carbon (85 MeV), nickel (120 MeV) and silver (120 MeV) ions with the fluence in the range of 1×10 11 –3×10 12 ions cm −2 . Ion induced changes were analyzed using X-ray diffraction (XRD), Fourier transform infra red (FT-IR), UV–visible spectroscopy, thermo-gravimetric analysis (TGA) and differential scanning calorimetry (DSC) techniques. Cross-linking was observed at lower doses resulting in modification of structural properties, however higher doses lead to the degradation of the investigated polymeric samples
An EPR at Penly: an outline from the SFEN to feed the public debate
International Nuclear Information System (INIS)
Anon.
2010-01-01
Penly-3 is the project to build an EPR reactor as a third unit on the Penly site (France). The authors have reviewed 5 reasons to back it: 1) nuclear power is a useful source of energy at the world scale, 2) nuclear power is an adequate solution to meet our future needs of energy, 3) the EPR is at the top of today's nuclear technology, 4) nuclear power is an efficient tool to diminish CO 2 releases, and 5) The EPR is a valuable asset to maintain France in the top group of world actors in the nuclear sector. A public debate will be held soon concerning the Penly-3 project. (A.C.)
DEFF Research Database (Denmark)
Dominiak, Katarina Nielsen; Hindsborg, Jeff; Pedersen, L. J.
to be generated at pen level or merged at section or herd level to reduce the number of alarms. Information on which specific pens or sections are of higher risk of stress or diseases is communicated to the farmer and target work effort to pens at risk. For Herd A, all model parameters defined at section level...... resulted in the best fit (MSE =13.85 litres2/hour). For Herd B, parameters defined at both pen and section level resulted in the best fit (MSE = 1.47 litres2/hour). For both Herd A and Herd B, preliminary results support the spatial approach by generating a reduced number of alarms when comparing section...
Energy Technology Data Exchange (ETDEWEB)
Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in
2016-07-15
The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.
A Prototype of Mathematical Treatment of Pen Pressure Data for Signature Verification.
Li, Chi-Keung; Wong, Siu-Kay; Chim, Lai-Chu Joyce
2018-01-01
A prototype using simple mathematical treatment of the pen pressure data recorded by a digital pen movement recording device was derived. In this study, a total of 48 sets of signature and initial specimens were collected. Pearson's correlation coefficient was used to compare the data of the pen pressure patterns. From the 820 pair comparisons of the 48 sets of genuine signatures, a high degree of matching was found in which 95.4% (782 pairs) and 80% (656 pairs) had rPA > 0.7 and rPA > 0.8, respectively. In the comparison of the 23 forged signatures with their corresponding control signatures, 20 of them (89.2% of pairs) had rPA values prototype could be used as a complementary technique to improve the objectivity of signature examination and also has a good potential to be developed as a tool for automated signature identification. © 2017 American Academy of Forensic Sciences.
Macroeconomía I. Guía de trabajos prácticos Nº5: el modelo de oferta agregada-demanda agregada
Gentile, Natacha
2011-01-01
Esta guía forma parte de un conjunto de guías de trabajos prácticos, elaboradas para la cátedra de Macroeconomía I de la Facultad de Ciencias Económicas y Sociales de la Universidad Nacional de Mar del Plata, durante los años que me tocó desempeñarme como Jefe de Trabajos Prácticos (años 2007-2011).
The influence of facility and home pen design on the welfare of the laboratory-housed dog.
Scullion Hall, Laura E M; Robinson, Sally; Finch, John; Buchanan-Smith, Hannah M
We have an ethical and scientific obligation to Refine all aspects of the life of the laboratory-housed dog. Across industry there are many differences amongst facilities, home pen design and husbandry, as well as differences in features of the dogs such as strain, sex and scientific protocols. Understanding how these influence welfare, and hence scientific output is therefore critical. A significant proportion of dogs' lives are spent in the home pen and as such, the design can have a considerable impact on welfare. Although best practice guidelines exist, there is a paucity of empirical evidence to support the recommended Refinements and uptake varies across industry. In this study, we examine the effect of modern and traditional home pen design, overall facility design, husbandry, history of regulated procedures, strain and sex on welfare-indicating behaviours and mechanical pressure threshold. Six groups of dogs from two facilities (total n=46) were observed in the home pen and tested for mechanical pressure threshold. Dogs which were housed in a purpose-built modern facility or in a modern design home pen showed the fewest behavioural indicators of negative welfare (such as alert or pacing behaviours) and more indicators of positive welfare (such as resting) compared to those in a traditional home pen design or traditional facility. Welfare indicating behaviours did not vary consistently with strain, but male dogs showed more negative welfare indicating behaviours and had greater variation in these behaviours than females. Our findings showed more positive welfare indicating behaviours in dogs with higher mechanical pressure thresholds. We conclude that factors relating to the design of home pens and implementation of Refinements at the facility level have a significant positive impact on the welfare of laboratory-housed dogs, with a potential concomitant impact on scientific endpoints. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights
Li, Zedong; Li, Fei; Xing, Yue; Liu, Zhi; You, Minli; Li, Yingchun; Wen, Ting; Qu, Zhiguo; Ling Li, Xiao; Xu, Feng
2017-12-15
Paper-based microfluidic biosensors have recently attracted increasing attentions in point-of-care testing (POCT) territories benefiting from their affordable, accessible and eco-friendly features, where technologies for fabricating such biosensors are preferred to be equipment free, easy-to-operate and capable of rapid prototyping. In this work, we developed a pen-on-paper (PoP) strategy based on two custom-made pens, i.e., a wax pen and a conductive-ink pen, to fully write paper-based microfluidic biosensors through directly writing both microfluidic channels and electrodes. Particularly, the proposed wax pen is competent to realize one-step fabrication of wax channels on paper, as the melted wax penetrates into paper during writing process without any post-treatments. The practical applications of the fabricated paper-based microfluidic biosensors are demonstrated by both colorimetric detection of Salmonella typhimurium DNA with detection limit of 1nM and electrochemical measurement of glucose with detection limit of 1mM. The developed PoP strategy for making microfluidic biosensors on paper characterized by true simplicity, prominent portability and excellent capability for rapid prototyping shows promising prospect in POCT applications. Copyright © 2017 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
S Bakhti
2015-09-01
Full Text Available Background & objectives: Several studies have described VacA and CagA as the two important virulence determinants of Helicobacter pylori, which are associated with gastric ulcer (GU and duodenal ulcer (DU. The aim of present study was to determine the associations of the i and d regions genotypes of H. pylori vacA gene and cagA status with GU and DU risk. Methods: A total of 177 isolates were cultured from the biopsies of Iranian patients with different geographic origins and genotyped. Data were collected and analyzed. Results: Frequency of the vacA i1, i2, i1i2, d1, and d2 alleles and cagA in all patients was 42.9%, 55.4%, 1.7%, 41.8%, 58.2% and 68.4%, respectively. There was a significant difference between the frequencies of vacA i1 in isolates from GU than those from non-atrophic gastritis (p<0.05. When the GU was considered as a dependant factor by the multiple logistic regression analysis, the vacA i1 genotype was significantly associated with the age- and sex-adjusted risk for GU (p=0.006, odds ratio [OR]=3.56 95% confidence interval [CI]=1.45–8.75. Statistical analysis showed no significant association between vacA d genotype and digestive diseases. After controlling for age and sex variables, the cagA genotype remained in the final model when the DU was considered as a dependant factor by the the multiple logistic regression analysis (p=0.021, OR=3.77 95% CI=1.22-11.60. Conclusion: We have proposed that the H. pylori vacA i1 and cagA genotypes could be considered as benefit biomarkers for prediction of risk of GU and DU in Iran, respectively.
Pen size and parity effects on maternal behaviour of Small-Tail Han sheep.
Lv, S-J; Yang, Y; Dwyer, C M; Li, F-K
2015-07-01
The aim of this experiment was to study the effects of pen size and parity on maternal behaviour of twin-bearing Small-Tail Han ewes. A total of 24 ewes were allocated to a 2×2 design (six per pen), with parity (primiparous or multiparous) and pen size (large: 6.0×3.0 m; small: 6.0×1.5 m) as main effects at Linyi University, Shandong Province, China. Behaviour was observed from after parturition until weaning. All ewes were observed for 6 h every 5 days from 0700 to1000 h and from 1400 to 1700 h. Continuous focal animal sampling was used to quantify the duration of maternal behaviours: sucking, grooming and following as well as the frequency of udder accepting, udder refusing and low-pitched bleating. Oestradiol and cortisol concentrations in the faeces (collected in the morning every 5 days) were detected using EIA kits. All lambs were weighed 24 h after parturition and again at weaning at 35 days of age. The small pen size significantly reduced following (Pbehaviour in sheep during lactation. The study is also the first to report on the maternal behaviour of Chinese native sheep breeds (Small-Tail Han sheep), with implications for the production of sheep in China.
Conversion of Squid Pens to Chitosanases and Proteases via Paenibacillus sp. TKU042
Directory of Open Access Journals (Sweden)
Chien Thang Doan
2018-03-01
Full Text Available Chitosanases and proteases have received much attention due to their wide range of applications. Four kinds of chitinous materials, squid pens, shrimp heads, demineralized shrimp shells and demineralized crab shells, were used as the sole carbon and nitrogen (C/N source to produce chitosanases, proteases and α-glucosidase inhibitors (αGI by four different strains of Paenibacillus. Chitosanase productivity was highest in the culture supernatants using squid pens as the sole C/N source. The maximum chitosanase activity of fermented squid pens (0.759 U/mL was compared to that of fermented shrimp heads (0.397 U/mL, demineralized shrimp shells (0.201 U/mL and demineralized crab shells (0.216 U/mL. A squid pen concentration of 0.5% was suitable for chitosanase, protease and αGI production via Paenibacillus sp. TKU042. Multi-purification, including ethanol precipitation and column chromatography of Macro-Prep High S as well as Macro-Prep DEAE (diethylaminoethyl, led to the isolation of Paenibacillus sp. TKU042 chitosanase and protease with molecular weights of 70 and 35 kDa, respectively. For comparison, 16 chitinolytic bacteria, including strains of Paenibacillus, were investigated for the production of chitinase, exochitinase, chitosanase, protease and αGI using two kinds of chitinous sources.
A multivariate dynamic linear model for early warnings of diarrhea and pen fouling in slaughter pigs
DEFF Research Database (Denmark)
Jensen, Dan Børge; Toft, Nils; Kristensen, Anders Ringgaard
2017-01-01
We present a method for providing early, but indiscriminant, predictions of diarrhea and pen fouling in grower/finisher pigs. We collected data on dispensed feed amount, water flow, drinking bouts frequency, temperature at two positions per pen, and section level humidity from 12 pens (6 double...... a set threshold a sufficient number of times, consecutively. Using this method with a 7 day prediction window, we achieved an area under the receiver operating characteristics curve of 0.84. Shorter prediction windows yielded lower performances, but longer prediction windows did not affect...
Pen Branch Delta and Savannah River Swamp Hydraulic Model
International Nuclear Information System (INIS)
Chen, K.F.
1999-01-01
The proposed Savannah River Site (SRS) Wetlands Restoration Project area is located in Barnwell County, South Carolina on the southwestern boundary of the SRS Reservation. The swamp covers about 40.5 km2 and is bounded to the west and south by the Savannah River and to the north and east by low bluffs at the edge of the Savannah River floodplain. Water levels within the swamp are determined by stage along the Savannah River, local drainage, groundwater seepage, and inflows from four tributaries, Beaver Dam Creek, Fourmile Branch, Pen Branch, and Steel Creek. Historic discharges of heated process water into these tributaries scoured the streambed, created deltas in the adjacent wetland, and killed native vegetation in the vicinity of the delta deposits. Future releases from these tributaries will be substantially smaller and closer to ambient temperatures. One component of the proposed restoration project will be to reestablish indigenous wetland vegetation on the Pen Branch delta that covers about 1.0 km2. Long-term predictions of water levels within the swamp are required to determine the characteristics of suitable plants. The objective of the study was to predict water levels at various locations within the proposed SRS Wetlands Restoration Project area for a range of Savannah River flows and regulated releases from Pen Branch. TABS-MD, a United States Army Corps of Engineer developed two-dimensional finite element open channel hydraulic computer code, was used to model the SRS swamp area for various flow conditions
A Decision Framework to Protect Coral Reefs in Guánica Bay, Puerto Rico
A Watershed Management Plan (WMP) for Guánica Bay, Puerto Rico, was introduced in 2008 by a nonprofit organization, the Center for Watershed Protection, with the intent of protecting coral reefs from damage related to watershed discharges. The plan was initially generated with th...
Students’ Attention when Using Touchscreens and Pen Tablets in a Mathematics Classroom
Directory of Open Access Journals (Sweden)
Chiung-Hui Chiu
2017-03-01
Full Text Available Aim/Purpose: The present study investigated and compared students’ attention in terms of time-on-task and number of distractors between using a touchscreen and a pen tablet in mathematical problem-solving activities with virtual manipulatives. Background: Although there is an increasing use of these input devices in educational practice, little research has focused on assessing student attention while using touchscreens or pen tablets in a mathematics classroom. Methodology: A qualitative exploration was conducted in a public elementary school in New Taipei, Taiwan. Six fifth-grade students participated in the activities. Video recordings of the activities and the students’ actions were analyzed. Findings: The results showed that students in the activity using touchscreens maintained greater attention and, thus, had more time-on-task and fewer distractors than those in the activity using pen tablets. Recommendations for Practitioners: School teachers could employ touchscreens in mathematics classrooms to support activities that focus on students’ manipulations in relation to the attention paid to the learning content. Recommendation for Researchers: The findings enhance our understanding of the input devices used in educational practice and provide a basis for further research. Impact on Society: The findings may also shed light on the human-technology interaction process involved in using pen and touch technology conditions. Future Research: Activities similar to those reported here should be conducted using more participants. In addition, it is important to understand how students with different levels of mathematics achievement use the devices in the activities.
Development and Evaluation of an Interactive Pen
Directory of Open Access Journals (Sweden)
Froilan G. Destreza
2015-11-01
Full Text Available Technologies have reached the classroom. It is one of the means of teaching strategies nowadays. Multimedia projectors have become one of the teaching tools the teacher cannot bear without it. The concept of making this tool to be interactive and easier to use was far conceived by the researcher. The researcher’s objective was to develop such tool and evaluate it according to its portability, simplicity, robustness, user-friendliness, effectiveness and efficiency. The respondents of the project were both the students and teachers of Batangas State University ARASOF-Nasugbu. The researcher has developed different prototypes for the interactive pen and tested in different environment and demonstrated the “know-how” of the project. The project was built using a simple infrared light emitting diode (IR LED, infrared tracker, and software which computes, detects and interact with the application program. Evaluation of the project followed the demonstration. The project got a high acceptance according to its portability, simplicity, robustness, user-friendliness, effectiveness and efficiency. The researcher is recommending the full implementation of the project in the Batangas State University ARASOF- Nasugbu and for better enhancement of the project by eliminating the pen.
Pen Culture of the Black-Chinned Tilapia, Sarotherodon ...
African Journals Online (AJOL)
Pen-fish-culture as a culture-based fisheries approach was investigated in the Aglor Lagoon from December 2003 to June, 2004. The fish used in the study was the Black-chinned tilapia Sarotherodon melanotheron. The growth performance of S. melanotheron cultured for six months in the Aglor Lagoon under three ...
Diseño participativo de una Guía para la Promoción de la Salud Mental en el medio penitenciario
Directory of Open Access Journals (Sweden)
R. Bustamante Navarro
2013-10-01
Full Text Available Objetivos: Describir los contenidos y el proceso participativo de construcción de una guía para promover la salud mental en el medio penitenciario a través de actividades grupales. Material y método: Se realizó una revisión de la literatura, de las políticas de salud mental, de un programa de talleres de hábitos mentales saludables y un vídeo sobre factores de protección y riesgo. Se identificaron a los actores implicados (stakeholders y se recabó su opinión sobre los temas de la guía. Se decidieron los contenidos de la guía y la incorporación del modelo de activos en salud y las perspectivas de género y diversidad cultural. Tras la elaboración inicial de los módulos y sesiones, se pilotaron en los centros penitenciarios de Valencia y Zaragoza con mujeres y hombres de distintas culturas, incorporando las mejoras sugeridas, unificándose contenidos y el estilo discursivo. Resultados: La guía consta de: prólogo, Introducción, descripción, módulos, sesiones y evaluación. Contiene 6 módulos y 19 sesiones sobre: salud y motivación; autoestima; salud y emociones; más activos para ganar salud: relajación, pensar en positivo, mantener la calma, comunicación y resolver problemas; avanzar es posible: resiliencia y ser protagonista de mi cambio. Cada sesión está compuesta por: las dinámicas (objetivos, material, tiempo asignado y desarrollo, material teórico y fichas para las actividades. La guía está disponible en edición impresa y electrónica. Conclusiones: Se ha construido una guía con participación de actores implicados y teniendo en cuenta la opinión de la población penitenciaria.
[A brief investigation on Gu Dehua, a female healer from Wuzhong in the Qing Dynasty].
Lin, Z K; Song, W J
2016-09-28
The female healer is a special community in traditional Chinese medical professionals. Since the Song-Yuan Dynasties, although the literati class holding the social voices and the male healers acting as medical orthodoxy were always suspicious of the female healers' behaviors and their medical morality, and tarnished their images through all kinds of media. Meanwhile, the female healers were still badly needed on the account of recognition of distinction between sexes between both sexes due to the rising of neo-Confucianism. An excellent female healer could still earn wide respect from the society. Gu Dehua was a famous female healer from Wuzhong in the Qing Dynasty's Daoguang-Xianfeng period. By investigating Gu Delua's family conditions, deeds and works, and her career, the community of the female healers in the Ming-Qing Dynasties can be thus understood.
A feature based comparison of pen and swipe based signature characteristics.
Robertson, Joshua; Guest, Richard
2015-10-01
Dynamic Signature Verification (DSV) is a biometric modality that identifies anatomical and behavioral characteristics when an individual signs their name. Conventionally signature data has been captured using pen/tablet apparatus. However, the use of other devices such as the touch-screen tablets has expanded in recent years affording the possibility of assessing biometric interaction on this new technology. To explore the potential of employing DSV techniques when a user signs or swipes with their finger, we report a study to correlate pen and finger generated features. Investigating the stability and correlation between a set of characteristic features recorded in participant's signatures and touch-based swipe gestures, a statistical analysis was conducted to assess consistency between capture scenarios. The results indicate that there is a range of static and dynamic features such as the rate of jerk, size, duration and the distance the pen traveled that can lead to interoperability between these two systems for input methods for use within a potential biometric context. It can be concluded that this data indicates that a general principle is that the same underlying constructional mechanisms are evident. Copyright © 2015 Elsevier B.V. All rights reserved.
DEFF Research Database (Denmark)
Williams, Charlotte Amdi; Lahrmann, H. P.; Oxholm, L. C.
2015-01-01
Straw stimulates explorative behaviour and is therefore attractive to pigs. Further, it can be effective in reducing negative pen-mate directed behaviours. Under most commercial conditions, straw can only be used in limited amounts as it can be difficult to handle in most vacuum slurry systems...... as a control treatment, against which the other treatments (quantities T25 and T50) and frequencies of straw allocations (T2×50 and T4×25) were tested. Three focal pigs per pen were randomly chosen and observed for 15 min per hour where tail-in-mouth, ear-in-mouth, aggression and other pen-mate directed...... behaviour were recorded. In addition, residual straw in the pens was assessed using four categories ranging from straw in a thin layer; little straw; few straws; and soiled straw. Pigs were active for about 30% of the registered time, but overall no differences in total pen-mate directed behaviour (tail...
Peter Brook tuleb koos etendusega festivalile "Talveöö unenägu" / Raivo Põldmaa
Põldmaa, Raivo
2008-01-01
Teatrikülgede küsimused Eesti teatrijuhtidele sügishooaja loomingulistest plaanidest, majanduslangusest tingitud muudatustest teatris, Kultuurkapitali reisirahastamise teemal, algava sügishooaja põhiteema. Tallinna Linnateatri festivali "Talveöö unenägu" tutvustab Laur Kaunissaare. Artikkel ilmub ajaleherubriigis "Teatriküljed 10/34"
Guía de los beneficiaros de subvenciones para el uso de las bases ...
International Development Research Centre (IDRC) Digital Library (Canada)
Corey Piccioni
de los documentos obtenidos a través de estas bases de datos. ... Guía para el uso de las bases de datos de investigación en IDRC .... Los campos donde usted busca utilizando palabras claves tienen un impacto en el número de resulta-.
Nacjonalizm zwyczajnych ludzi. Etnicyzowanie tradycji muzycznej na przykładzie festiwalu w Gučy
Directory of Open Access Journals (Sweden)
Waldemar Kuligowski
2015-08-01
In this paper, I discuss a few contradictions in the relationship between tradition, nationalism and music. An excellent example illustrating specific nature of these contradictions is Dragačevski sabor trubača (Guča Trumpet Festival in Guča, Serbia and particular music genre – brass music. In my opinion there are three distinctive discourses/narrations about history and meaning this festival and specific kind of music: dominating Serbian discourse, ‘weak’ Gypsy discourse, and researcher’s discourse. This study is effect an ethnographic fieldwork conducted in 2010 by an author and large group of students from Institute of Ethnology and Cultural Anthropology Adam Mickiewicz University Poznań, Poland.
Energy Technology Data Exchange (ETDEWEB)
Knapp, R.J.; Sharma, S.D.; Toth, G.; Duong, M.T.; Fang, L.; Bogert, C.L.; Weber, S.J.; Hunt, M.; Davis, T.P.; Wamsley, J.K. (Department of Pharmacology, University of Arizona, College of Medicine, Tucson (United States))
1991-09-01
(D-Pen2,4{prime}-125I-Phe4,D-Pen5)enkephalin ((125I)DPDPE) is a highly selective radioligand for the delta opioid receptor with a specific activity (2200 Ci/mmol) that is over 50-fold greater than that of tritium-labeled DPDPE analogs. (125I)DPDPE binds to a single site in rat brain membranes with an equilibrium dissociation constant (Kd) value of 421 {plus minus} 67 pM and a receptor density (Bmax) value of 36.4 {plus minus} 2.7 fmol/mg protein. The high affinity of this site for delta opioid receptor ligands and its low affinity for mu or kappa receptor-selective ligands are consistent with its being a delta opioid receptor. The distribution of these sites in rat brain, observed by receptor autoradiography, is also consistent with that of delta opioid receptors. Association and dissociation binding kinetics of 1.0 nM (125I) DPDPE are monophasic at 25 degrees C. The association rate (k + 1 = 5.80 {plus minus} 0.88 {times} 10(7) M-1 min-1) is about 20- and 7-fold greater than that measured for 1.0 nM (3H) DPDPE and 0.8 nM (3H) (D-Pen2,4{prime}-Cl-Phe4, D-Pen5)enkephalin, respectively. The dissociation rate of (125I)DPDPE (0.917 {plus minus} 0.117 {times} 10(-2) min-1) measured at 1.0 nM is about 3-fold faster than is observed for either of the other DPDPE analogs. The rapid binding kinetics of (125I)DPDPE is advantageous because binding equilibrium is achieved with much shorter incubation times than are required for other cyclic enkephalin analogs. This, in addition to its much higher specific activity, makes (125I)DPDPE a valuable new radioligand for studies of delta opioid receptors.
Cull, Charley A; Renter, David G; Dewsbury, Diana M; Noll, Lance W; Shridhar, Pragathi B; Ives, Samuel E; Nagaraja, Tiruvoor G; Cernicchiaro, Natalia
2017-06-01
The objective of this study was to determine feedlot- and pen-level fecal prevalence of seven enterohemorrhagic Escherichia coli (EHEC) belonging to serogroups (O26, O45, O103, O111, O121, O145, and O157, or EHEC-7) in feces of feedlot cattle in two feeding areas in the United States. Cattle pens from four commercial feedlots in each of the two major U.S. beef cattle areas were sampled. Up to 16 pen-floor fecal samples were collected from each of 4-6 pens per feedlot, monthly, for a total of three visits per feedlot, from June to August, 2014. Culture procedures including fecal enrichment in E. coli broth, immunomagnetic separation, and plating on selective media, followed by confirmation through polymerase chain reaction (PCR) testing, were conducted. Generalized linear mixed models were fitted to estimate feedlot-, pen-, and sample-level fecal prevalence of EHEC-7 and to evaluate associations between potential demographic and management risk factors with feedlot and within-pen prevalence of EHEC-7. All study feedlots and 31.0% of the study pens had at least one non-O157 EHEC-positive fecal sample, whereas 62.4% of pens tested positive for EHEC O157; sample-level prevalence estimates ranged from 0.0% for EHEC O121 to 18.7% for EHEC O157. Within-pen prevalence of EHEC O157 varied significantly by sampling month; similarly within-pen prevalence of non-O157 EHEC varied significantly by month and by the sex composition of the pen (heifer, steer, or mixed). Feedlot management factors, however, were not significantly associated with fecal prevalence of EHEC-7. Intraclass correlation coefficients for EHEC-7 models indicated that most of the variation occurred between pens, rather than within pens, or between feedlots. Hence, the potential combination of preharvest interventions and pen-level management strategies may have positive food safety impacts downstream along the beef chain.
Directory of Open Access Journals (Sweden)
Edilene de Cássia D. Nunes
1998-06-01
Full Text Available Este artigo contém uma revisão sobre o Poli(etileno naftalato - PEN e também inclui vários aspectos relacionados com as blendas poliméricas Poli(etileno tereftalato - PET / Poli(etileno naftalato - PEN. O artigo é resultado de um desenvolvimento conjunto da Alcoa Alumínio S.A.- Divisão de Embalagens e do Departamento de Engenharia de Materiais - Universidade Federal de São Carlos (UFSCar, que tem como objetivo pesquisar o tema aqui abordado.This paper presents a review on poly(ethylene naphtalate - PEN including several features related to poly(ethylene terephtalate - PET / poly(ethylene naphtalate - PEN blends.The paper is a result of a conjoint development of Alcoa S.A. - Packaging Divisions and of the Department of Materials Engineering - Federal University of São Carlos (UFSCar, whose scope is to investigate the subject here approached.
Le Pen õigustas natside tegevust Prantsusmaal / Margo Pajuste
Pajuste, Margo
2005-01-01
Prantsuse paremäärmusliku partei juht Jean-Marie Le Pen väitis, et Saksa okupatsioon II maailmasõja ajal Prantsusmaal ei olnud eriti ebainimlik ja et kui väited massimõrvade kohta Prantsusmaal vastaksid tõele, poleks olnud vaja luua koonduslaagreid poliitvangidele. Reageeringutest Le Peni väidete kohta Prantsusmaal
Directory of Open Access Journals (Sweden)
Kim Jaewhan
2010-04-01
Full Text Available Abstract Background Numerous pen devices are available to administer recombinant Human Growth Hormone (rhGH, and both patients and health plans have varying issues to consider when selecting a particular product and device for daily use. Therefore, the present study utilized multi-dimensional product analysis to assess potential time involvement, required weekly administration steps, and utilization costs relative to daily rhGH administration. Methods Study objectives were to conduct 1 Time-and-Motion (TM simulations in a randomized block design that allowed time and steps comparisons related to rhGH preparation, administration and storage, and 2 a Cost Minimization Analysis (CMA relative to opportunity and supply costs. Nurses naïve to rhGH administration and devices were recruited to evaluate four rhGH pen devices (2 in liquid form, 2 requiring reconstitution via TM simulations. Five videotaped and timed trials for each product were evaluated based on: 1 Learning (initial use instructions, 2 Preparation (arrange device for use, 3 Administration (actual simulation manikin injection, and 4 Storage (maintain product viability between doses, in addition to assessment of steps required for weekly use. The CMA applied micro-costing techniques related to opportunity costs for caregivers (categorized as wages, non-drug medical supplies, and drug product costs. Results Norditropin® NordiFlex and Norditropin® NordiPen (NNF and NNP, Novo Nordisk, Inc., Bagsværd, Denmark took less weekly Total Time (p ® Pen (GTP, Pfizer, Inc, New York, New York or HumatroPen® (HTP, Eli Lilly and Company, Indianapolis, Indiana. Time savings were directly related to differences in new package Preparation times (NNF (1.35 minutes, NNP (2.48 minutes GTP (4.11 minutes, HTP (8.64 minutes, p Conclusions Time-and-motion simulation data used to support a micro-cost analysis demonstrated that the pen device with the greater time demand has highest net costs.
Energy Technology Data Exchange (ETDEWEB)
Chang, Zhengshi; Zhang, Guanjun [School of Electrical Engineering, Xi' an Jiaotong University, Xi' an 710049 (China); Jiang, Nan; Cao, Zexian, E-mail: zxcao@iphy.ac.cn [Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China)
2014-03-14
Non-equilibrium atmospheric pressure plasma jet (APPJ) is a cold plasma source that promises various innovative applications. The influence of Penning effect on the formation, propagation, and other physical properties of the plasma bullets in APPJ remains a debatable topic. By using a 10 cm wide active electrode and a frequency of applied voltage down to 0.5 Hz, the Penning effect caused by preceding discharges can be excluded. It was found that the Penning effect originating in a preceding discharge helps build a conductive channel in the gas flow and provide seed electrons, thus the discharge can be maintained at a low voltage which in turn leads to a smaller propagation speed for the plasma bullet. Photographs from an intensified charge coupled device reveal that the annular structure of the plasma plume for He is irrelevant to the Penning ionization process arising from preceding discharges. By adding NH{sub 3} into Ar to introduce Penning effect, the originally filamentous discharge of Ar can display a rather extensive plasma plume in ambient as He. These results are helpful for the understanding of the behaviors of non-equilibrium APPJs generated under distinct conditions and for the design of plasma jet features, especially the spatial distribution and propagation speed, which are essential for application.
DVD. Alar Niineväli soovitab : "Läbi hägu" / Alar Niineväli
Niineväli, Alar
2007-01-01
Mängufilm Philip K. Dicki romaani järgi "Läbi hägu" ("A Scanner Darkly") : režissöör Richard Linklater : Ameerika Ühendriigid, 2006. Film on näitlejatega filmitud ja siis kaaderhaaval üleanimeeritud
Directory of Open Access Journals (Sweden)
Muhammad Naeim Mohamad Asri
2015-12-01
Full Text Available FTIR spectroscopic techniques have been shown to possess good abilities to analyse ballpoint pen inks. These in-situ techniques involve directing light onto ballpoint ink samples to generate an FTIR spectrum, providing “molecular fingerprints” of the ink samples thus allowing comparison by direct visual comparison. In this study, ink from blue (n=15 and red (n=15 ballpoint pens of five different brands: Kilometrico®, G-Soft®, Stabilo®, Pilot® and Faber Castell® was analysed using the FTIR technique with the objective of establishing a distinctive differentiation according to the brand. The resulting spectra were first compared and grouped manually. Due to the similarities in terms of colour and shade of the inks, distinctive differentiation could not be achieved by means of direct visual comparison. However, when the same spectral data was analysed by Principal Component Analysis (PCA software, distinctive grouping of the ballpoint pen inks was achieved. Our results demonstrate that PCA can be used objectively to investigate ballpoint pen inks of similar colour and more importantly of different brands.
CRESU studies of electron attachment and Penning ionization at temperatures down to 48 K
International Nuclear Information System (INIS)
Le Garrec, J.L.; Mitchell, J.B.A.; Rowe, B.R.
1996-01-01
The object of the present report is to present results obtained for electron attachment and Penning ionization, obtained with the addition of a Langmuir probe to the measurement apparatus. Measurements of the rate coefficients for electron attachment and Penning ionization are performed using the standard techniques for the flow reactors. Rate coefficients for the Penning ionisation of argon, nitrogen molecule, oxygen molecule by helium metastable are presented. The results obtained concerning the attachment of electrons to SF 6 (non-dissociative), CCl 2 F 2 (producing Cl - ), and CF 3 Br as a function of temperature are presented. The differences observed, and the variation of the value of β below 100 K, provides evidence of the strong influence of the internal state (probably vibrational) of the CF 3 Br molecule on its dissociative attachment
Directory of Open Access Journals (Sweden)
Sara Isabel Alcântara Lestre
2011-08-01
Full Text Available A imunoterapia com o Bacilo Calmette-Guérin é amplamente usada no tratamento e profilaxia da neoplasia urotelial superficial. As complicações associadas ao tratamento são comuns. Os autores relatam um caso de inflamação granulomatosa do pênis, associada à terapia intravesical com Bacilo Calmette-Guérin, com múltiplos nódulos eritematosos indolores localizados na glande. É também efetuada uma revisão da literatura. A balanopostite granulomatosa é uma complicação rara associada à imunoterapia com Bacilo Calmette-Guérin, com uma apresentação clinicamente heterogênea que pode dificultar o diagnóstico. O seu reconhecimento clínico é essencial para o início precoce de tuberculostáticos e interrupção de Bacilo Calmette-GuérinImmunotherapy with Bacillus Calmette-Guérin is widely used for treatment and prophylaxis of superficial urothelial cancer. Complications associated with Bacillus Calmette-Guérin treatment are common. The authors describe a case of granulomatous inflammation of the penis associated with intravesical Bacillus Calmette-Guérin therapy, presenting with multiple erythematous and painless nodules located on the glans. A review of the literature is also performed. Granulomatous balanoposthitis is a rare complication of Bacillus Calmette-Guérin immunotherapy, with heterogeneous clinical presentation, which can make the diagnosis difficult. Its clinical recognition is essential for early start of therapy with antitubercular agents and interruption of Bacillus Calmette-Guérin
Noble-gas ionization in the ion source with Penning effect
International Nuclear Information System (INIS)
Monchka, D.; Lyatushinskij, A.; Vasyak, A.
1982-01-01
By additional use of that the ion source efficiency can be increased the Penning ionization. The results of estimates of certain coefficients for the processes taking place in the plasma ion sources are presented
Directory of Open Access Journals (Sweden)
Sauer M
2017-12-01
Full Text Available Maritta Sauer,1 Carole Abbotts2 1Global Strategic Insights, Merck KGaA, Darmstadt, Germany; 2Pharmaceutical Market Research Consultant, London, UK Purpose: Adherence to recombinant human growth hormone (r-hGH is critical to growth and other outcomes in patients with growth disorders, but the requirement for daily injections means that ease of use is an important factor. This study assessed the perceived ease of use and functionality of the prototype of a reusable pen injector (pen device for r-hGH that incorporates several advanced features. Participants and methods: Semi-structured 60-minute qualitative interviews were conducted in 5 countries with 57 health care professionals (HCPs and 30 patients with GH deficiency/caregivers administering r-hGH to patients, including children. HCPs had to be responsible for training in the use of r-hGH pen devices and to see ≥4 r-hGH patients/caregivers per month. Patients/caregivers had to have experience with r-hGH administration for at least 6 months.Results: Thirty-seven (65% of HCPs described the pen device as “simple” or “easy” to use. The aluminum body was generally perceived as attractive, high quality and comfortable to hold and operate. The ease of preparation and use made it suitable for both children and adults. The ability to dial back the r-hGH dose, if entered incorrectly, was mentioned as a major benefit, because other devices need several user steps to reset. Patients/caregivers felt the pen device was easy to use and the injection-feedback features reassured them that the full dose had been given. Overall, 40 (70% HCPs and 16 (52% patients/caregivers were likely to recommend or request the pen device. Moreover, patients/caregivers rated the pen device higher than their current reusable pens and almost equal to the leading disposable device for ease of learning, preparation, administration and ease of use.Conclusion: The prototype pen device successfully met its design
Aspiration of a perforated pen cap: complete tracheal obstruction ...
African Journals Online (AJOL)
Foreign body aspiration is a common but underestimated event in children with potentially fatal outcome. Because of unreliable histories and inconsistent clinical and radiologic findings, diagnosis and treatment can represent a challenge. Inhaled pen caps predispose for complete airway obstruction and are difficult to ...
Guo, Zhidong; Song, Yukun; Zhang, Yunliang
2013-05-01
The purpose of this comment is to point out the inappropriate assumption of “3αH>1” and two problems in the proof of “Theorem 3.1” in section 3 of the paper “Time-changed geometric fractional Brownian motion and option pricing with transaction costs” by Hui Gu et al. [H. Gu, J.R. Liang, Y. X. Zhang, Time-changed geometric fractional Brownian motion and option pricing with transaction costs, Physica A 391 (2012) 3971-3977]. Then we show the two problems will be solved under our new assumption.
Precise mass measurements of exotic nuclei--the SHIPTRAP Penning trap mass spectrometer
International Nuclear Information System (INIS)
Herfurth, F.; Ackermann, D.; Block, M.; Dworschak, M.; Eliseev, S.; Hessberger, F.; Hofmann, S.; Kluge, H.-J.; Maero, G.; Martin, A.; Mazzocco, M.; Rauth, C.; Vorobjev, G.; Blaum, K.; Ferrer, R.; Neidherr, D.; Chaudhuri, A.; Marx, G.; Schweikhard, L.; Neumayr, J.
2007-01-01
The SHIPTRAP Penning trap mass spectrometer has been designed and constructed to measure the mass of short-lived, radioactive nuclei. The radioactive nuclei are produced in fusion-evaporation reactions and separated in flight with the velocity filter SHIP at GSI in Darmstadt. They are captured in a gas cell and transfered to a double Penning trap mass spectrometer. There, the cyclotron frequencies of the radioactive ions are determined and yield mass values with uncertainties ≥4.5·10 -8 . More than 50 nuclei have been investigated so far with the present overall efficiency of about 0.5 to 2%
Field-scale evaluation of water fluxes and manure solution leaching in feedlot pen soils.
García, Ana R; Maisonnave, Roberto; Massobrio, Marcelo J; Fabrizio de Iorio, Alicia R
2012-01-01
Accumulation of beef cattle manure on feedlot pen surfaces generates large amounts of dissolved solutes that can be mobilized by water fluxes, affecting surface and groundwater quality. Our objective was to examine the long-term impacts of a beef cattle feeding operation on water fluxes and manure leaching in feedlot pens located on sandy loam soils of the subhumid Sandy Pampa region in Argentina. Bulk density, gravimetric moisture content, and chloride concentration were quantified. Rain simulation trials were performed to estimate infiltration and runoff rates. Using chloride ion as a tracer, profile analysis techniques were applied to estimate the soil moisture flux and manure conservative chemical components leaching rates. An organic stratum was found over the surface of the pen soil, separated from the underlying soil by a highly compacted thin layer (the manure-soil interface). The soil beneath the organic layer showed greater bulk density in the A horizon than in the control soil and had greater moisture content. Greater concentrations of chloride were found as a consequence of the partial sealing of the manure-soil interface. Surface runoff was the dominant process in the feedlot pen soil, whereas infiltration was the main process in control soil. Soil moisture flux beneath pens decreased substantially after 15 yr of activity. The estimated minimum leaching rate of chloride was 13 times faster than the estimated soil moisture flux. This difference suggests that chloride ions are not exclusively transported by advective flow under our conditions but also by solute diffusion and preferential flow. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.
Mahony, Mary C; Patterson, Patricia; Hayward, Brooke; North, Robert; Green, Dawne
2015-05-01
To demonstrate, using human factors engineering (HFE), that a redesigned, pre-filled, ready-to-use, pre-asembled follitropin alfa pen can be used to administer prescribed follitropin alfa doses safely and accurately. A failure modes and effects analysis identified hazards and harms potentially caused by use errors; risk-control measures were implemented to ensure acceptable device use risk management. Participants were women with infertility, their significant others, and fertility nurse (FN) professionals. Preliminary testing included 'Instructions for Use' (IFU) and pre-validation studies. Validation studies used simulated injections in a representative use environment; participants received prior training on pen use. User performance in preliminary testing led to IFU revisions and a change to outer needle cap design to mitigate needle stick potential. In the first validation study (49 users, 343 simulated injections), in the FN group, one observed critical use error resulted in a device design modification and another in an IFU change. A second validation study tested the mitigation strategies; previously reported use errors were not repeated. Through an iterative process involving a series of studies, modifications were made to the pen design and IFU. Simulated-use testing demonstrated that the redesigned pen can be used to administer follitropin alfa effectively and safely.
Pervasive liquid metal based direct writing electronics with roller-ball pen
Directory of Open Access Journals (Sweden)
Yi Zheng
2013-11-01
Full Text Available A roller-ball pen enabled direct writing electronics via room temperature liquid metal ink was proposed. With the rolling to print mechanism, the metallic inks were smoothly written on flexible polymer substrate to form conductive tracks and electronic devices. The contact angle analyzer and scanning electron microscope were implemented to disclose several unique inner properties of the obtained electronics. An ever high writing resolution with line width and thickness as 200 μm and 80 μm, respectively was realized. Further, with the administration of external writing pressure, GaIn24.5 droplets embody increasing wettability on polymer which demonstrates the pervasive adaptability of the roller-ball pen electronics.
Properties of H- and D- beams from magnetron and Penning sources
International Nuclear Information System (INIS)
Sluyters, T.; Kovarik, V.
1979-01-01
The quality of negative hydrogen isotope beams are evaluated after extraction from magnetron and Penning sources. The general conclusions of these measurements are that: (a) the beam quality from these plasma sources are adequate for the transport of high current negative ion beams in bending magnets; (b) there is evidence of practically complete space charge neutralization in the drift space beyond the extractor; (c) the beam performance from the Penning source appears to be better compared with the magnetron source; and (d) it is likely that the high electric field gradient and a concave ion emission boundary are responsible for a beam cross-over near the anode aperture, which causes beam divergence practically independent of the extraction geometry
Development of compact size penning ion source for compact neutron generator.
Das, Basanta Kumar; Shyam, Anurag
2008-12-01
For long-life operation, easy to mount and compact in size penning type ion sources are widely used in different fields of research such as neutron generators, material research, and surface etching. One penning type ion source has been developed in our laboratory. Applying high voltage of 2 kV between two oppositely biased electrodes and using permanent magnet of 500 gauss magnetic field along the axis, we had produced the glow discharge in the plasma region. The performance of this source was investigated using nitrogen gas. Deuterium ions were produced and extracted on the basis of chosen electrodes and the angle of extraction. Using a single aperture plasma electrode, the beam was extracted along the axial direction. The geometry of plasma electrode is an important factor for the efficient extraction of the ions from the plasma ion source. The extracted ion current depends upon the shape of the plasma meniscus. A concave shaped plasma meniscus produces converged ion beam. The convergence of extracted ions is related to the extraction electrode angle. The greater the angle, the more the beam converges. We had studied experimentally this effect with a compact size penning ion source. The detailed comparison among the different extraction geometry and different electrode angle are discussed in this paper.
Aspiration of a perforated pen cap: complete tracheal obstruction ...
African Journals Online (AJOL)
Keywords: children, flexible bronchoscopy, Fogarty catheter, foreign body aspiration, pen cap, rigid ... plastic foreign body with central perforation occluding the trachea in supracarinal ... venous steroids and was discharged home on postoperative day 1 without ... history may not be as reliable, if not witnessed by an adult.
Pol, Françoise; Dorenlor, Virginie; Eono, Florent; Eudier, Solveig; Eveno, Eric; Liégard-Vanhecke, Dorine; Rose, Nicolas; Fablet, Christelle
2017-11-01
The aims of this study were to assess the feasibility of individual and pen-based oral fluid sampling (OFS) in 35 pig herds with group-housed sows, compare these methods to blood sampling, and assess the factors influencing the success of sampling. Individual samples were collected from at least 30 sows per herd. Pen-based OFS was performed using devices placed in at least three pens for 45min. Information related to the farm, the sows, and their living conditions were collected. Factors significantly associated with the duration of sampling and the chewing behaviour of sows were identified by logistic regression. Individual OFS took 2min 42s on average; the type of floor, swab size, and operator were associated with a sampling time >2min. Pen-based OFS was obtained from 112 devices (62.2%). The type of floor, parity, pen-level activity, and type of feeding were associated with chewing behaviour. Pen activity was associated with the latency to interact with the device. The type of floor, gestation stage, parity, group size, and latency to interact with the device were associated with a chewing time >10min. After 15, 30 and 45min of pen-based OFS, 48%, 60% and 65% of the sows were lying down, respectively. The time spent after the beginning of sampling, genetic type, and time elapsed since the last meal were associated with 50% of the sows lying down at one time point. The mean time to blood sample the sows was 1min 16s and 2min 52s if the number of operators required was considered in the sampling time estimation. The genetic type, parity, and type of floor were significantly associated with a sampling time higher than 1min 30s. This study shows that individual OFS is easy to perform in group-housed sows by a single operator, even though straw-bedded animals take longer to sample than animals housed on slatted floors, and suggests some guidelines to optimise pen-based OFS success. Copyright © 2017 Elsevier B.V. All rights reserved.
Quadrupole deflector of the double Penning trap system MLLTRAP
Energy Technology Data Exchange (ETDEWEB)
Gartzke, Eva; Kolhinen, Veli; Habs, Dietrich; Neumayr, Juergen; Schuermann, Christian; Szerypo, Jerzy; Thirolf, Peter [Fakultaet fuer Physik, LMU Muenchen, Garching (Germany); Maier-Leibnitz Laboratory, Garching (Germany)
2009-07-01
A cylindrical double Penning trap has been installed and successfully commissioned at the Maier-Leibnitz Laboratory in Garching. This trap system has been designed to isobarically purify low energy ion beams and perform highly accurate mass measurements. An electrostatic quadrupole deflector has been designed and installed at the injection line of the Penning trap system enabling a simultaneous use of an online ion beam with reference ions from an offline ion source. Alternatively two offline sources can be used concurrently e.g. an {alpha} recoil sources providing heavy radioactive species (e.g {sup 240}U) together with reference mass ions (which in the future will be e.g. a carbon cluster ion source). The bender has been designed for beam energies up to 1 keV with q/A ratios 1/1-1/250. This presentation shows the technical design and the operating parameters of the quadrupole beam bender and its implementation at the MLLTRAP system.
About the measurements systems with pen and thermoluminescent dosemeters
International Nuclear Information System (INIS)
Cortes I, M.E.; Ramirez G, F.P.
1998-01-01
In this work it is presented dosimetric data obtained with pen and thermoluminescent dosemeters, which are used by the Occupational Exposure Personnel (OEP) of the Mexican Petroleum Institute (IMP)(1). It was marked several great characteristics as for example, the differences among units which use one and another dosemeter type. Likewise, it is given to know diverse problems that were had in the IMP at relating the data obtained with these dosemeters (which utilizes OEP) and the ICRP 60 recommendations 1990. One of the most important difficulties is to satisfy the recommended limits by ICRP, particularly those that are referring to the units and their complex calculations. With respect to the unities, the ICRP makes reference at the concepts 'dose equivalent' and 'effective dose' with the sievert unit, that the General Regulations for Radiological Safety associates with 'dose equivalent' and 'effective dose equivalent'. It was illustrated the type of dosimetric statistics which are obtained with the TLD lectures and a OEP pen dosemeter during 1997. (Author)
Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti
2015-06-01
Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.
King, Andrea C; Smith, Lia J; McNamara, Patrick J; Cao, Dingcai
2018-01-05
Second generation electronic nicotine delivery systems (ENDS; also known as e-cigarettes, vaporizers or vape pens) are designed for a customized nicotine delivery experience and have less resemblance to regular cigarettes than first generation "cigalikes." The present study examined whether they generalize as a conditioned cue and evoke smoking urges or behavior in persons exposed to their use. Data were analyzed in N = 108 young adult smokers (≥5 cigarettes per week) randomized to either a traditional combustible cigarette smoking cue or a second generation ENDS vaping cue in a controlled laboratory setting. Cigarette and e-cigarette urge and desire were assessed pre- and post-cue exposure. Smoking behavior was also explored in a subsample undergoing a smoking latency phase after cue exposure (N = 26). The ENDS vape pen cue evoked both urge and desire for a regular cigarette to a similar extent as that produced by the combustible cigarette cue. Both cues produced similar time to initiate smoking during the smoking latency phase. The ENDS vape pen cue elicited smoking urge and desire regardless of ENDS use history, that is, across ENDS naїve, lifetime or current users. Inclusion of past ENDS or cigarette use as covariates did not significantly alter the results. These findings demonstrate that observation of vape pen ENDS use generalizes as a conditioned cue to produce smoking urge, desire, and behavior in young adult smokers. As the popularity of these devices may eventually overtake those of first generation ENDS cigalikes, exposure effects will be of increasing importance. This study shows that passive exposure to a second generation ENDS vape pen cue evoked smoking urge, desire, and behavior across a range of daily and non-daily young adult smokers. Smoking urge and desire increases after vape pen exposure were similar to those produced by exposure to a first generation ENDS cigalike and a combustible cigarette, a known potent cue. Given the increasing
Zakharia, Zeena
2017-01-01
This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…
[Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].
Liu, F W
2017-07-28
The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.
Study of argon-based Penning gas mixtures for use in proportional counters
International Nuclear Information System (INIS)
Agrawal, P.C.; Ramsey, B.D.; Weisskopf, M.C.
1989-01-01
Results from an experimental investigation of three Penning gas mixtures, namely argon-acetylene (Ar-C 2 H 2 ), argon-xenon (Ar-Xe) and argon-xenon-trimethylamine (Ar-Xe-TMA), are reported. The measurements, carried out in cylindrical geometry as well as parallel plate geometry detectors, demonstrate that the Ar-C 2 H 2 mixtures show a significant Penning effect even at an acetylene concentration of 10% and provide the best energy resolution among all the argon-based gas mixtures (≤13% FWHM at 5.9 keV and 6.7% at 22.2 keV). In the parallel plate detector the Ar-C 2 H 2 fillings provide a resolution of ≅7% FWHM at 22.2 keV up to a gas gain of at least ≅10 4 . The nonmetastable Penning mixture Ar-Xe provides the highest gas gain among all the argon-based gas mixtures and is well suited for use in long-duration space-based experiments. Best results are obtained with 5% and 20% Xe in Ar, the energy resolution being ≅7% FWHM at 22.2 keV and ≅4.5% at 59.6 keV for gas gain 3 . Addition of ≥1% TMA to an 80% Ar-20% Xe mixture produces a dramatic increase in gas gain but the energy resolution remains unaffected (≅7% FWHM at 22.2 keV). This increase in gas gain is attributed to the occurrence of a Penning effect between Xe and TMA, the ionization potential of TMA being 8.3 eV, just below the xenon metastable potential of 8.39 eV. (orig.)
Temperature and body weight affect fouling of pig pens.
Aarnink, A J A; Schrama, J W; Heetkamp, M J W; Stefanowska, J; Huynh, T T T
2006-08-01
Fouling of the solid lying area in pig housing is undesirable for reasons of animal welfare, animal health, environmental pollution, and labor costs. In this study the influence of temperature on the excreting and lying behavior of growing-finishing pigs of different BW (25, 45, 65, 85, or 105 kg) was studied. Ten groups of 5 pigs were placed in partially slatted pens (60% solid concrete, 40% metal-slatted) in climate respiration chambers. After an adaptation period, temperatures were raised daily for 9 d. Results showed that above certain inflection temperatures (IT; mean 22.6 degrees C, SE = 0.78) the number of excretions (relative to the total number of excretions) on the solid floor increased with temperature (mean increase 9.7%/ degrees C, SE = 1.41). Below the IT, the number of excretions on the solid floor was low and not influenced by temperature (mean 13.2%, SE = 3.5). On average, the IT for excretion on the solid floor decreased with increasing BW, from approximately 25 degrees C at 25 kg to 20 degrees C at 100 kg of BW (P temperature also affected the pattern and postural lying. The temperature at which a maximum number of pigs lay on the slatted floor (i.e., the IT for lying) decreased from approximately 27 degrees C at 25 kg to 23 degrees C at 100 kg of BW (P temperatures, pigs lay more on their sides and less against other pigs (P Temperature affects lying and excreting behavior of growing-finishing pigs in partially slatted pens. Above certain IT, pen fouling increases linearly with temperature. Inflection temperatures decrease at increasing BW.
International Nuclear Information System (INIS)
Shavandi, Amin; Bekhit, Adnan A.; Bekhit, Alaa El-Din A.; Sun, Zhifa; Ali, M. Azam
2015-01-01
The properties of chitosan from Arrow squid (Nototodarus sloanii) pen (CHS) and commercial crab shell (CHC) were investigated using FTIR, DSC, SEM and XRD before and after irradiation at the dose of 28 kGy in the presence or absence of 5% water. Also, the viscosity, deacetylation degree, water and oil holding capacities, colour and antimicrobial activities of the chitosan samples were determined. Irradiation decreased (P < 0.05) the viscosity of CHC from 0.21 to 0.03 Pa s and of CHS from 1.71 to 0.23 Pa s. The inclusion of water had no effect on the viscosity of irradiated chitosan. Irradiation did not affect the degree of deacetylation of CHC, but increased the deacetylation degree of CHS from 72.78 to 82.29% in samples with 5% water. Water and oil holding capacities of CHS (1197.30% and 873.3%, respectively) were higher (P < 0.05) than those found in CHC (340.70% and 264.40%, respectively). The water and oil holding capacities were decreased for both types of chitosan irradiation, but were not affected by the addition of water. Squid pen chitosan was whiter in colour (White Index = 90.06%) compared to CHC (White Index = 83.70%). Generally, the CHC samples (control and irradiated) exhibited better antibacterial activity compared to CHS, but the opposite was observed with antifungal activity. - Highlights: • Chitosan prepared from Arrow squid pens (Nototodarus sloanii). • Chitosan samples were gamma irradiated at 28 kGy. • Squid pen chitosan showed high fat and water uptake capacities compared to crab shell chitosan. • Gamma irradiation enhanced the DDA of squid pen chitosan but not crab shell chitosan.
Lund, Kirrin E; Maloney, Shane K; Milton, John T B; Blache, Dominique
2012-01-01
Confinement in metabolism pens may provoke a stress response in alpacas that will reduce the welfare of the animal and jeopardize the validity of scientific results obtained in such pens. In this study, we tested a protocol designed to successfully train alpacas to be held in a specially designed metabolism pen so that the animals' confinement would not jeopardize their welfare. We hypothesized that the alpacas would show fewer behaviors associated with a response to stress as training gradually progressed, and that they would adapt to being in the confinement of the metabolism pen. The training protocol was successful at introducing alpacas to the metabolism pens, and it did reduce the incidence of behavioral responses to stress as the training progressed. The success of the training protocol may be attributed to the progressive nature of the training, the tailoring of the protocol to suit alpacas, and the use of positive reinforcement. This study demonstrated that both animal welfare and the validity of the scientific outcomes could be maximized by the gradual training of experimental animals, thereby minimizing the stress imposed on the animals during experimental procedures.
DEFF Research Database (Denmark)
Weber, N. R.; Nielsen, J. P.; Hjulsager, Charlotte Kristiane
2017-01-01
Enterotoxigenic E. coli (ETEC) are a major cause of diarrhoea in weaned pigs. The objective of this study was to evaluate the agreement at pen level among three different diagnostic approaches for the detection of ETEC in groups of nursery pigs with diarrhoea. The diagnostic approaches used were...... to determine the quantity of F18 and F4 genes. The study was carried out in three Danish pig herds and included 31 pens with a pen-level diarrhoea prevalence of > 25%, as well as samples from 93 diarrhoeic nursery pigs from these pens. All E. coli isolates were analysed by PCR and classified as ETEC when genes...... was observed between the detection of ETEC by bacterial culture and qPCR in the same pen floor sample in 26 (83.9%, Kappa = 0.679) pens. Conclusion: We observed an acceptable agreement for the detection of ETEC-positive diarrhoeic nursery pigs in pen samples for both bacterial culture of pen floor samples...
Guía de gestores de proyectos, setiembre 2012
Morante Milla, Antoni
2012-01-01
Què és un projecte?, La gestió de projectes, aspectes clau en la definició i gestió d'un projecte, planificació d'un projecte eines informàtiques per a la planificació i gestió de projectes i guia d'ús del programari de gestió de projectes ClockingIT. ¿Qué es un proyecto?, la gestión de proyectos, aspectos clave en la definición y gestión de un proyecto, planificación de un proyecto herramientas informáticas para la planificación y gestión de proyectos y guía de uso del software de gestión...
Johannes Vermeer and Tom Gouws: textual discourse through pen ...
African Journals Online (AJOL)
Poems such as 'ars poetica' and 'die kantklosser' will be read as speaking paintings of visual texts and visual writing through which an exceptional merger of pen and brush come into being. Keywords: iconicity, tipography, cohesion, visual text, ars poetica, syntactic chiasm, texture, canto. Journal for Language Teaching Vol ...
Evaluation of drop versus trickle-feeding systems for crated or group-penned gestating sows.
Hulbert, L E; McGlone, J J
2006-04-01
A total of 160 gilts were used to evaluate the effects of pen vs. crated housing systems and drop- vs. trickle-fed feeding systems on sow productivity, occurrence of lesions during farrowing and weaning, immune measures, and behavioral responses during 2 consecutive gestation periods. Of the 160 eligible gilts, 117 farrowed in parity 1, and of those, 72 farrowed in parity 2. The gilts were randomly assigned to represent 1 of 4 factorially arranged treatment groups: pen drop-fed, crate drop-fed, pen trickle-fed, or crate trickle-fed. Replicate blocks were used for each parity with 5 sows per block initially in each treatment. At weaning, sows housed in pens had greater (P trickle-feeding system. Lesions scores and all other productivity measures did not differ among treatments. An interaction was observed for percentage of neutrophil phagocytosis (P trickle-fed sows, but in crates, drop-fed sows had a tendency for lower phagocytosis than trickle-fed sows. All other immune measures were not different among treatments. The occurrence of oral-nasal-facial (ONF) behaviors (chewing, rooting, and rubbing) and active behaviors increased, and lying behavior decreased (P trickle-feeding systems. None of the environments evaluated were associated with significant physiological stress responses among the sows. Thus, sows were able to adapt within each environment through behavioral mechanisms without the need to invoke major physiological adjustments.
2010-01-01
...; cleaning and disinfection of infected livestock pens and driveways. 309.7 Section 309.7 Animals and Animal... INSPECTION § 309.7 Livestock affected with anthrax; cleaning and disinfection of infected livestock pens and... followed immediately by a thorough disinfection of the exposed premises by soaking the ground, fences...
International Nuclear Information System (INIS)
Lee, L.C.; Siti Mariam Nunurung; Abdul Aziz Ishak
2014-01-01
Nowadays, crimes related to forged documents are increasing. Any erasure, addition or modification in the document content always involves the use of writing instrument such as ball point pens. Hence, there is an evident need to develop a fast and accurate ink analysis protocol to solve this problem. This study is aimed to determine the discrimination power of high performance thin layer chromatography (HPTLC) technique for analyzing a set of blue ball point pen inks. Ink samples deposited on paper were extracted using methanol and separated via a solvent mixture of ethyl acetate, methanol and distilled water (70: 35: 30, v/ v/ v). In this method, the discrimination power of 89.40 % was achieved, which confirm that the proposed method was able to differentiate a significant number of pen-pair samples. In addition, composition of blue pen inks was found to be homogeneous (RSD < 2.5 %) and the proposed method showed good repeatability and reproducibility (RSD < 3. 0%). As a conclusion, HPTLC is an effective tool to separate blue ball point pen inks. (author)
Organizaciones sanitarias integradas: una guía para el análisis
Directory of Open Access Journals (Sweden)
Ma. Luisa Vázquez Navarrete
2005-01-01
Full Text Available En los últimos años se observa una tendencia a abandonar la competencia e introducir políticas que favorezcan la colaboración entre proveedores de salud como vía para mejorar la eficiencia del sistema y la continuidad de la atención sanitaria. Distintos países han desarrollado experiencias con la integración de proveedores para proporcionar el continuo asistencial a una población definida, principalmente en Estados Unidos. En Cataluña han surgido progresivamente organizaciones sanitarias integradas (OSI pero los estudios sobre integración son escasos, a diferencia con los Estados Unidos. Como parte de una investigación que se está llevando a cabo, se desarrolló una guía para el estudio de las OSI catalanas a partir de una revisión sistemática clásica de la literatura y de la elaboración de un marco teórico. La guía propone el análisis del desempeño de las OSI en relación a sus objetivos finales de mejora de la eficiencia y continuidad de la atención mediante el análisis del tipo de integración (a partir de las características clave, de elementos del entorno (existencia de otros proveedores, tipo de mecanismos de pago de la provisión e internos (modelo de gobierno, organización y gestión que influyen la integración. La evaluación de desempeño de las OSI valora las estrategias globales, así como los resultados de coordinación asistencial y eficiencia. Se evalúa la coordinación de la información a través de la red y de la gestión de la atención. El análisis de la eficiencia de la OSI se refiere a la eficiencia técnica y asignativa. El uso de esta guía en el contexto catalán puede requerir adaptación adicional.
Forensic analysis of ballpoint pen inks using paper spray mass spectrometry.
da Silva Ferreira, Priscila; Fernandes de Abreu e Silva, Débora; Augusti, Rodinei; Piccin, Evandro
2015-02-07
A novel analytical approach based on paper spray mass spectrometry (PS-MS) is developed for a fast and effective forensic analysis of inks in documents. Ink writings made in ordinary paper with blue ballpoint pens were directly analyzed under ambient conditions without any prior sample preparation. Firstly, the method was explored on a set of distinct pens and the results obtained in the positive ion mode, PS(+)-MS, demonstrated that pens from different brands provide typical profiles. Simple visual inspection of the PS(+)-MS led to the distinction of four different combinations of dyes and additives in the inks. Further discrimination was performed by using the concept of relative ion intensity (RII), owing to the large variability of dyes BV3 and BB26 regarding their demethylated homologues. Following screening and differentiation studies, the composition changes of ink entries subjected to light exposure were also monitored by PS-MS. The results of these tests revealed distinct degradation behaviors which were reflected on the typical chemical profiles of the studied inks, attesting that PS-MS may be also useful to verify the fading of dyes thus allowing the discrimination of entries on a document. As proof of concept experiments, PS-MS was successfully utilized for the analysis of archived documents and characterization of overlapped ink lines made on simulated forged documents.
Guía para el diagnóstico, seguimiento y tratamiento de la enfermedad de Fabry
Directory of Open Access Journals (Sweden)
Pablo Neumann
2013-10-01
Full Text Available La enfermedad de Fabry es un trastorno de almacenamiento lisosomal hereditario ligado al cromosoma X, ocasionado por el déficit de la enzima alfa galactosidasa A. El conocimiento sobre esta patología, y en particular su manejo médico, ha progresado notablemente en la última década, incluyendo el desarrollo de su tratamiento específico. La presente guía fue desarrollada por profesionales médicos de diversas especialidades involucrados en la atención de pacientes con enfermedad de Fabry. La discusión y análisis de las evidencias científicas disponibles, sumado a la experiencia de cada uno de los participantes, ha permitido desarrollar los conceptos vertidos en esta guía con el objetivo de brindar una herramienta útil para todos los profesionales que asisten a pacientes con enfermedad de Fabry.
Status of the Penning trap project in Munich
International Nuclear Information System (INIS)
Szerypo, J.; Kolhinen, V.S.; Gartzke, E.; Habs, D.; Neumayr, J.; Schuermann, C.; Sewtz, M.; Thirolf, P.G.; Bussmann, M.; Schramm, U.
2009-01-01
The MLLTRAP at the Maier-Leibnitz-Laboratory (Garching) is a new Penning trap facility designed to combine several novel technologies to decelerate, charge breed, cool, bunch and purify the reaction products and perform high-accuracy nuclear and atomic mass measurements. It is now in the commissioning phase, achieving a mass-resolving power of about 10 5 in the purification trap for stable ions. (orig.)
Status of the Penning trap project in Munich
Energy Technology Data Exchange (ETDEWEB)
Szerypo, J.; Kolhinen, V.S.; Gartzke, E.; Habs, D.; Neumayr, J.; Schuermann, C.; Sewtz, M.; Thirolf, P.G. [University of Munich (LMU) and Maier-Leibnitz-Laboratory (MLL), Faculty of Physics, Garching (Germany); Bussmann, M.; Schramm, U. [University of Munich (LMU) and Maier-Leibnitz-Laboratory (MLL), Faculty of Physics, Garching (Germany); Forschungszentrum Dresden-Rossendorf, Dresden (Germany)
2009-12-15
The MLLTRAP at the Maier-Leibnitz-Laboratory (Garching) is a new Penning trap facility designed to combine several novel technologies to decelerate, charge breed, cool, bunch and purify the reaction products and perform high-accuracy nuclear and atomic mass measurements. It is now in the commissioning phase, achieving a mass-resolving power of about 10{sup 5} in the purification trap for stable ions. (orig.)
Wright, Kristi; Herro, Holly
2016-01-01
Many historically and culturally significant documents from the mid-to-late twentieth century were written in ballpoint pen inks, which contain light-sensitive dyes that present problems for collection custodians and paper conservators. The conservation staff at the National Library of Medicine (NLM), National Institutes of Health, conducted a multiphase project on the chemistry and aging of ballpoint pen ink that culminated in the development of a new method to detect aging of ballpoint pen ink while examining a variety of storage environments. NLM staff determined that ballpoint pen ink color shift can be detected noninvasively using image editing software. Instructions are provided on how to detect color shift in digitized materials using a technique developed specifically for this project-Photoshop Assisted Spectroscopy. 1 The study results offer collection custodians storage options for historic documents containing ballpoint pen ink.
Pen Branch fault: Confirmatory drilling results
International Nuclear Information System (INIS)
Stieve, A.; Coruh, C.; Costain, J.K.
1994-01-01
The Confirmatory Drilling Project is the final investigation under the Pen Branch Fault Program initiated to determine the capability of the Pen Branch fault (PBF) to release seismic energy. This investigation focused on a small zone over the fault where previously collected seismic reflection data had indicated the fault deforms the subsurface at 150 msec (with reference to an 80 m reference datum). Eighteen drill holes, 2 to basement and the others to 300 ft, were arranged in a scatter pattern over the fault. To adequately define configuration of the layers deformed by the fault boreholes were spaced over a zone of 800 ft, north to south. The closely spaced data were to confirm or refute the existence of flat lying reflectors observed in seismic reflection data and to enable the authors to identify and correlate lithologic layers with seismic reflection data. Results suggest that deformation by the fault in sediments 300 ft deep ad shallower is subtle. Corroboration of the geologic interpretation with the seismic reflection profile is ongoing but preliminary results indicate that specific reflectors can be assigned to lithologic layers. A large amplitude package of reflections below a flat lying continuous reflection at 40 msec can be correlated with a lithology that corresponds to carbonate sediments in geologic cross-section. Further, data also show that a geologic layer as shallow as 30 ft can be traced on these seismic data over the same subsurface distance where geologic cross-section shows corresponding continuity. The subsurface structure is thus corroborated by both methods at this study site
76 FR 52952 - Student Services Contract EP-11-D-000403 Yin Gu; Transfer of Data
2011-08-24
... will enable Student Services Contract EP-11-D-000403 Yin Gu to fulfill the obligations of the contract... ENVIRONMENTAL PROTECTION AGENCY [EPA-HQ-OPP-2011-0038; FRL-8884-1] Student Services Contract EP-11... Business Information (CBI) by the submitter, will be transferred to Student Services Contract EP- 11-D...
Guías clinicas de RCP y SRI enfermería
Donis Mulero, Elena
2015-01-01
La reanimación cardiopulmonar (RCP) es un procedimiento de emergencia para salvar vidas que se lleva a cabo cuando una persona se encuentra en parada cardiorrespiratoria (PCR). Tanto la técnica de RCP como la de intubación, son aspectos olvidados por los profesionales de la salud. Recopilar las últimas recomendaciones sobre RCP para poder elaborar un programa sencillo enfocado a la enfermería. Elaborar una guía sencilla de secuencia rápida de intubación (SRI). Revisión bibliográfica en la que...
Fabrication of a pen-shaped portable biochemical reaction system based on magnetic bead manipulation
International Nuclear Information System (INIS)
Shikida, Mitsuhiro; Inagaki, Noriyuki; Okochi, Mina; Honda, Hiroyuki; Sato, Kazuo
2011-01-01
A pen-shaped platform that is similar to a mechanical pencil is proposed for producing a portable reaction system. A reaction unit, as the key component in the system, was produced by using a heat shrinkable tube. A mechanical pencil supplied by Mitsubishi Pencil Co. Ltd was used as the pen-shaped platform for driving the reaction cylinder. It was actuated using an inchworm motion. We confirmed that the magnetic beads were successfully manipulated in the droplet in the cylinder-shaped reaction units. (technical note)
Sanãtana dharma / René Guénon ; tõlkinud ja kommenteerinud Haljand Udam
Guénon, René
2004-01-01
René Guénoni essee "Sanãtana dharma" ilmus 1949. a. ja uuesti 1989. a. raamatus "Études sur ľhindouisme" lk. 105-116 ja käsitleb mõiste "sanãtana dharma" ja "philosophia perennis" tõlgendusi ja tähendust. Esseele on lisatud põhjalik tõlkijapoolne kommentaar
DEFF Research Database (Denmark)
Weber, N. R.; Nielsen, J. P.; Hjulsager, Charlotte Kristiane
2017-01-01
Enterotoxigenic E. coli (ETEC) are a major cause of diarrhoea in weaned pigs. The objective of this study was to evaluate the agreement at pen level among three different diagnostic approaches for the detection of ETEC in groups of nursery pigs with diarrhoea. The diagnostic approaches used were......: bacterial culturing of faecal samples from three pigs (per pen) with clinical diarrhoea and subsequent testing for virulence genes in E. coli isolates; bacterial culturing of pen floor samples and subsequent testing for virulence genes in E. coli isolates; qPCR testing of pen floor samples in order...... to determine the quantity of F18 and F4 genes. The study was carried out in three Danish pig herds and included 31 pens with a pen-level diarrhoea prevalence of > 25%, as well as samples from 93 diarrhoeic nursery pigs from these pens. All E. coli isolates were analysed by PCR and classified as ETEC when genes...
Evaluación neuropsicológica en adicciones: guía clínica
Directory of Open Access Journals (Sweden)
Antonio Verdejo-García
Full Text Available Resumen El objetivo de este artículo de opinión es proporcionar pautas para la evaluación neuropsicológica en el contexto terapéutico de las adicciones. Se proponen guías básicas para la evaluación neuropsicológica en dos contextos: (1 la determinación de los perfiles neuropsicológicos de usuarios consumidores de drogas; (2 la predicción de los resultados del tratamiento de las adicciones, en términos de retención y adherencia a las recomendaciones terapéuticas y de riesgo de recaídas en el consumo. Se describen también nuevas aproximaciones terapéuticas derivadas de una comprensión neuropsicológica de los trastornos por uso de sustancias. Las pautas recogidas en este artículo pretenden servir para facilitar la transición entre el descubrimiento científico y la implementación asistencial, proporcionando guías básicas para incorporar estas herramientas en la práctica clínica con pacientes drogodependientes.
Study on the effect of Huo Xue Bo Gu Pill on secretion of endogenous bFGF after fracture
International Nuclear Information System (INIS)
Li Qiang; Wang Xiping; Guo E; Ye Liyan; Liu Yingjie
2006-01-01
Objective: To study the effect of a Chinese traditional preparation Huo Xue Bo Gu Pill on the serum contents of basic fibroblast growth factor (bFGF) after forearm fractures. Method: Serum bFGF contents were measured (with ELISA) in 62 patients with forearm fractures on d1, d8, d14 and d20 after the accident. Thirty-two of the patients were treated with Huo Xue Bo Gu Pills and thirty patients were not. Results: The serum contents of bFGF on d8 and d14 were significantly higher in the patients treated with the pills than those in patients not treated with the pills (P<0.05). Conclusion: This pill could promote the secretion of endogenous bFGF with proliferation of capillaries at the fracture site. (authors)
Federle, Michael P; Jaffe, Tracy A; Davis, Peter L; Al-Hawary, Mahmoud M; Levine, Marc S
2017-01-01
One of the significant challenges facing radiologists who perform and interpret studies of the gastrointestinal and genitourinary systems have been periodic interruptions in the availability of barium and iodinated contrast media specially formulated for gastrointestinal (GI) and genitourinary (GU) studies. These interruptions are due to the US Food and Drug Administration's recent requirement for more stringent documentation of the safety and efficacy of contrast media and the consolidation among contrast manufacturers. Therefore, radiologists may be required to recommend an alternative means of evaluation, such as computed tomography, magnetic resonance, or endoscopy, or they may need to substitute a different formulation of a contrast agent not specifically developed for GI or GU use, for example the utilization of an agent designed and marketed for vascular use. This article reviews the current status of fluoroscopic contrast media, and provides suggestions and recommendations for the optimal and alternative use of contrast media formulations.
First reliability test of a surface micromachined microengine using SHiMMeR
Energy Technology Data Exchange (ETDEWEB)
Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others
1997-08-01
The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.
Directory of Open Access Journals (Sweden)
Welcker J
2010-09-01
Full Text Available Abstract Background Self-administration of recombinant human follicle-stimulating hormone (r-hFSH can be performed using injection pen devices by women undergoing assisted reproductive technology procedures. The objective of this study was to explore the use of the prefilled follitropin alfa pen in routine assisted reproductive technology procedures in Germany. Methods This prospective, observational study was conducted across 43 German IVF centres over a period of 1.75 years. Patients who had used the prefilled follitropin alfa pen in the current or a previous cycle of controlled ovarian stimulation completed a questionnaire to assess their opinions of the device. Results A total of 5328 patients were included in the study. Of these, 2888 reported that they had previous experience of daily FSH injections. Significantly more patients reported that less training was required to use the prefilled follitropin alfa pen than a syringe and lyophilized powder (1997/3081 [64.8%]; p Conclusions In this questionnaire-based survey, routine use of the prefilled follitropin alfa pen was well accepted and associated with favourable patient perceptions. Users of the pen found it easier to initially learn how to use, and subsequently use, than other injection methods. In general, the prefilled follitropin alfa pen was the preferred method for self-administration of gonadotrophins. Together with previous findings, the results here indicate a high level of patient satisfaction among users of the prefilled follitropin alfa pen for daily self-administration of r-hFSH.
Review: Factors affecting fouling in conventional pens for slaughter pigs
DEFF Research Database (Denmark)
Larsen, Mona Lilian Vestbjerg; Bertelsen, Maja; Pedersen, Lene Juul
2018-01-01
and pigs’ earlier experience. Further, these primary factors are affected by secondary factors such as the shape of the pen, the weight of the pigs and especially the heat balance of the pigs, which is affected by several tertiary factors including, for example, temperature, humidity and draught. Results...
Dynamics of a single ion in a perturbed Penning trap: Octupolar perturbation
International Nuclear Information System (INIS)
Lara, Martin; Salas, J. Pablo
2004-01-01
Imperfections in the design or implementation of Penning traps may give rise to electrostatic perturbations that introduce nonlinearities in the dynamics. In this paper we investigate, from the point of view of classical mechanics, the dynamics of a single ion trapped in a Penning trap perturbed by an octupolar perturbation. Because of the axial symmetry of the problem, the system has two degrees of freedom. Hence, this model is ideal to be managed by numerical techniques like continuation of families of periodic orbits and Poincare surfaces of section. We find that, through the variation of the two parameters controlling the dynamics, several periodic orbits emanate from two fundamental periodic orbits. This process produces important changes (bifurcations) in the phase space structure leading to chaotic behavior
Suurprojekt "Suveöö unenägu" saab kõrged hääled Eestist / Andres Laasik
Laasik, Andres, 1960-2016
2009-01-01
Pärnu ooperifestivali korraldava Promfest ja Opera Studio Nederland poolt 2010. aasta suvel lavale toodavast ooperist "Suveöö unenägu", ooperit mängitakse 2. juulil Tallinnas ja 24. juulil Amsterdamis, lavastaja John Copley. Osatäitjate leidmiseks korraldatud katsetest
Rahman, Mohd Nasrull Abdol; Mohamad, Siti Shafika
2017-01-01
Computer works are associated with Musculoskeletal Disorders (MSDs). There are several methods have been developed to assess computer work risk factor related to MSDs. This review aims to give an overview of current techniques available for pen-and-paper-based observational methods in assessing ergonomic risk factors of computer work. We searched an electronic database for materials from 1992 until 2015. The selected methods were focused on computer work, pen-and-paper observational methods, office risk factors and musculoskeletal disorders. This review was developed to assess the risk factors, reliability and validity of pen-and-paper observational method associated with computer work. Two evaluators independently carried out this review. Seven observational methods used to assess exposure to office risk factor for work-related musculoskeletal disorders were identified. The risk factors involved in current techniques of pen and paper based observational tools were postures, office components, force and repetition. From the seven methods, only five methods had been tested for reliability. They were proven to be reliable and were rated as moderate to good. For the validity testing, from seven methods only four methods were tested and the results are moderate. Many observational tools already exist, but no single tool appears to cover all of the risk factors including working posture, office component, force, repetition and office environment at office workstations and computer work. Although the most important factor in developing tool is proper validation of exposure assessment techniques, the existing observational method did not test reliability and validity. Futhermore, this review could provide the researchers with ways on how to improve the pen-and-paper-based observational method for assessing ergonomic risk factors of computer work.
Wright, Kristi; Herro, Holly
2016-01-01
Many historically and culturally significant documents from the mid-to-late twentieth century were written in ballpoint pen inks, which contain light-sensitive dyes that present problems for collection custodians and paper conservators. The conservation staff at the National Library of Medicine (NLM), National Institutes of Health, conducted a multiphase project on the chemistry and aging of ballpoint pen ink that culminated in the development of a new method to detect aging of ballpoint pen ...
Nest building and posture changes and activity budget of gilts housed in pens and crates
DEFF Research Database (Denmark)
Andersen, Inger Lise; Vasdal, Guro; Pedersen, Lene Juul
2014-01-01
was born until 8 h after the birth of the first piglet. There was no significant effect of the sows breeding value on any of the sow behaviours. Sows housed in pens spent significantly more time nest building than crated sows from 4 to 12 h prepartum (P ...The aim of the present work was to study nest building, posture changes and the overall activity budget of gilts in pens vs. crates. Twenty-three HB gilts (high piglet survival day 5) and 21 LB gilts (low piglet survival day 5) were video recorded from day 110 in pregnancy to four days after...... farrowing in either a farrowing pen or farrowing crate. The gilts were provided with 2 kg of chopped straw daily from day 113 of pregnancy until farrowing in both environments. Nest building and other activity measures of the sows were analysed using continuous sampling the last 12 h before the first piglet...
Xenon-based Penning mixtures for proportional counters
International Nuclear Information System (INIS)
Ramsey, B.D.; Agrawal, P.C.; National Aeronautics and Space Administration, Huntsville, AL
1989-01-01
The choice of quench gas can have a significant effect on the gas gain and energy resolution of gas-filed proportional counters. Details are given on the performance obtained with a variety of quench additives of varying ionization potentials for use in xenon-filled systems. It is confirmed that optimum performance is obtained when the ionization potential is closely matched to the first metastable level of xenon (8.3 eV) as is the case with xenon + trimethylamine and xenon + dimethylamine. For these mixtures the Penning effect is at its strongest. (orig.)
Mechanism of force mode dip-pen nanolithography
Energy Technology Data Exchange (ETDEWEB)
Yang, Haijun, E-mail: yanghaijun@sinap.ac.cn, E-mail: swguo@sjtu.edu.cn, E-mail: wanghuabin@cigit.ac.cn [Key Laboratory for Thin Film and Microfabrication of the Ministry of Education, Research Institute of Micro/Nano Science and Technology, Shanghai Jiao Tong University, Shanghai 200240 (China); Interfacial Water Division and Key Laboratory of Interfacial Physics and Technology, Shanghai Institute of Applied Physics, CAS, Shanghai 201800 (China); Xie, Hui; Rong, Weibin; Sun, Lining [State Key Laboratory of Robotics and Systems, Harbin Institute of Technology, Harbin 150080 (China); Wu, Haixia; Guo, Shouwu, E-mail: yanghaijun@sinap.ac.cn, E-mail: swguo@sjtu.edu.cn, E-mail: wanghuabin@cigit.ac.cn [Key Laboratory for Thin Film and Microfabrication of the Ministry of Education, Research Institute of Micro/Nano Science and Technology, Shanghai Jiao Tong University, Shanghai 200240 (China); Wang, Huabin, E-mail: yanghaijun@sinap.ac.cn, E-mail: swguo@sjtu.edu.cn, E-mail: wanghuabin@cigit.ac.cn [Centre for Tetrahertz Research, Chongqing Institute of Green and Intelligent Technology, Chinese Academy of Sciences, Chongqing 400714 (China)
2014-05-07
In this work, the underlying mechanism of the force mode dip-pen nanolithography (FMDPN) is investigated in depth by analyzing force curves, tapping mode deflection signals, and “Z-scan” voltage variations during the FMDPN. The operation parameters including the relative “trigger threshold” and “surface delay” parameters are vital to control the loading force and dwell time for ink deposition during FMDPN. A model is also developed to simulate the interactions between the atomic force microscope tip and soft substrate during FMDPN, and verified by its good performance in fitting our experimental data.
Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J
2015-01-01
The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data
Directory of Open Access Journals (Sweden)
Robin B Thomson
Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as
Prevalence of consanguineous marriages among shi'a populations of Lebanon.
El-Kheshen, Ghadir; Saadat, Mostafa
2013-09-01
In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).
Ke, Zhi-Xin; Xie, Ping; Guo, Long-Gen; Xu, Jun; Zhou, Qiong
2012-08-01
In 2005, a large bio-manipulation pen with the stock of silver carp and bighead carp was built to control the cyanobacterial bloom in Meiliang Bay of Taihu Lake. This paper investigated the seasonal variation of the community structure of crustacean zooplankton and the water quality within and outside the pen. There were no significant differences in the environmental parameters and phytoplankton biomass within and outside the pen. The species composition and seasonal dynamics of crustacean zooplankton within and outside the pen were similar, but the biomass of crustacean zooplankton was greatly suppressed by silver carp and bighead carp. The total crustacean zooplankton biomass and cladocerans biomass were significantly lower in the pen (P < 0.05). In general, silver carp and bighead carp exerted more pressure on cladoceran species than on copepod species. A distinct seasonal succession of crustacean zooplankton was observed in the Bay. Many crustacean species were only dominated in given seasons. Large-sized crustacean (mainly Daphnia sp. and Cyclops vicnus) dominated in winter and spring, while small-sized species (mainly Bosmina sp., Ceriodaphnia cornuta, and Limnoithona sinensis) dominated in summer and autumn. Canonical correspondence analysis showed that water transparency, temperature, and phytoplankton biomass were the most important factors affecting the seasonal succession of the crustacean.
Micro Penning Trap for Continuous Magnetic Field Monitoring in High Radiation Environments
Latorre, Javiera; Bollen, Georg; Gulyuz, Kerim; Ringle, Ryan; Bado, Philippe; Dugan, Mark; Lebit Team; Translume Collaboration
2016-09-01
As new facilities for rare isotope beams, like FRIB at MSU, are constructed, there is a need for new instrumentation to monitor magnetic fields in beam magnets that can withstand the higher radiation level. Currently NMR probes, the instruments used extensively to monitor magnetic fields, do not have a long lifespans in radiation-high environments. Therefore, a radiation-hard replacement is needed. We propose to use Penning trap mass spectrometry techniques to make high precision magnetic field measurements. Our Penning microtrap will be radiation resistant as all of the vital electronics will be at a safe distance from the radiation. The trap itself is made from materials not subject to radiation damage. Penning trap mass spectrometers can determine the magnetic field by measuring the cyclotron frequency of an ion with a known mass and charge. This principle is used on the Low Energy Beam Ion Trap (LEBIT) minitrap at NSCL which is the foundation for the microtrap. We have partnered with Translume, who specialize in glass micro-fabrication, to develop a microtrap in fused-silica glass. A microtrap is finished and ready for testing at NSCL with all of the electronic and hardware components setup. DOE Phase II SBIR Award No. DE-SC0011313, NSF Award Number 1062410 REU in Physics, NSF under Grant No. PHY-1102511.
Directory of Open Access Journals (Sweden)
Michelle Hale Williams
2011-10-01
Full Text Available With 2012 elections looming on the horizon in France, much political attention has focused on the new leader of the National Front, Marine Le Pen. She is polling quite well outpacing many of her mainstream party candidate rivals for the 2012 French presidency and the public appears to have embraced her with open arms. Hailed as a promising new face of French politics, a wide swath of the French electorate indicates confidence in her ability to bring needed changes to France. Yet does she really represent a dramatic departure from former FN policies and positions? This article examines the model of the FN during the leadership of Jean-Marie Le Pen in comparison with that seen in the first eight months of Marine Le Pen’s leadership in order to address this question.Com a iminência das eleições francesas de 2012, muita da atenção política se tem centrado na nova líder da Frente Nacional, Marine Le Pen, que tem tido um desempenho notável nas sondagens, ultrapassando muitos dos seus rivais dos partidos tradicionais na corrida para a presidência francesa, e sendo aparentemente acolhida de braços abertos por grande parte do eleitorado. Considerada uma nova e promissora figura no panorama político francês, uma larga fatia do eleitorado demonstra confiança na sua capacidade para trazer ao país a mudança necessária. Mas será que ela representa, de facto, uma ruptura com as antigas posições políticas da FN? O presente artigo examina o modelo da FN sob a liderança de Jean-Marie Le Pen comparando-o com o dos primeiros oito meses da liderança de Marine Le Pen por forma a analisar esta questão.
AHP 44: Interview: FILMMAKER: GU RU 'PHRINS LAS1
Directory of Open Access Journals (Sweden)
AHP
2017-02-01
Full Text Available Please introduce yourself. I am Gu ru 'phrin las, born in 1993 in Smin thang Township, Gjig sgril County, Mgo log (Guoluo Tibetan Autonomous Prefecture, Mtsho sngon (Qinghai Province, PR China. My family members are herders. My paternal grandmother (Ngang rus, 1923-2008 raised me. My family had neither a radio nor television, so Grandmother's folktales and stories about her childhood were the main form of entertainment for me. When I was six years old, Father began to teach me basic Tibetan and mathematics. I started school when I was eight years old. I later studied at Mgo log High School in Rta bo (Dawu, at Northwest Nationalities University in Lan gru (Lanzhou, and in Zhi an (Xi'an. My dream is to become a film director. ...
Directory of Open Access Journals (Sweden)
Figueroa P. Adalberto
1986-03-01
Full Text Available Guía práctica para la identificación y manejo de plagas en hortalizas La guía práctica comprende una descripción de los insectos, ácaros y moluscos que atacan los cultivos hortícolas en nuestro país. Se registraron 33 especies hortícolas pertenecientes a 10 familias botánicas que por su afinidad bioquímica atraen las mismas plagas. Se describieron 52 plagas con las respectivas recomendaciones de manejo. También se presentan las alternativas para un control eficaz con enfoque ecológico.This work is proposed as a practical guide for the identification and management of the vegetables pests. It comprises a description of insects, acarimolluscs that attack the vegetable crops in our country. The 33 horticultural especies here registered as attacked by insect pest belong to 10 botanical families, which due to their biochemical affinity, attract the same insects. 52 insect pests are described management, with the corresponding recommendations for the han dling of each one, also alternative for the efficacious control are given, from an ecological point of view.
Particle-in-cell simulations of anomalous transport in a Penning discharge
Carlsson, Johan; Kaganovich, Igor; Powis, Andrew; Raitses, Yevgeny; Romadanov, Ivan; Smolyakov, Andrei
2018-06-01
Electrostatic particle-in-cell simulations of a Penning discharge are performed in order to investigate azimuthally asymmetric, spoke-like structures previously observed in experiments. Two-dimensional simulations show that for Penning-discharge conditions, a persistent nonlinear spoke-like structure forms readily and rotates in the direction of E × B and electron diamagnetic drifts. The azimuthal velocity is within about a factor of 2 of the ion acoustic speed. The spoke frequency follows the experimentally observed scaling with ion mass, which indicates the importance of ion inertia in spoke formation. The spoke provides enhanced (anomalous) radial electron transport, and the effective cross-field conductivity is several times larger than the classical (collisional) value. The level of anomalous current obtained in the simulations is in good agreement with the experimental data. The rotating spoke channels most of the radial current, observable by an edge probe as short pulses.
Penning traps with unitary architecture for storage of highly charged ions.
Tan, Joseph N; Brewer, Samuel M; Guise, Nicholas D
2012-02-01
Penning traps are made extremely compact by embedding rare-earth permanent magnets in the electrode structure. Axially-oriented NdFeB magnets are used in unitary architectures that couple the electric and magnetic components into an integrated structure. We have constructed a two-magnet Penning trap with radial access to enable the use of laser or atomic beams, as well as the collection of light. An experimental apparatus equipped with ion optics is installed at the NIST electron beam ion trap (EBIT) facility, constrained to fit within 1 meter at the end of a horizontal beamline for transporting highly charged ions. Highly charged ions of neon and argon, extracted with initial energies up to 4000 eV per unit charge, are captured and stored to study the confinement properties of a one-magnet trap and a two-magnet trap. Design considerations and some test results are discussed.
Penning traps with unitary architecture for storage of highly charged ions
International Nuclear Information System (INIS)
Tan, Joseph N.; Guise, Nicholas D.; Brewer, Samuel M.
2012-01-01
Penning traps are made extremely compact by embedding rare-earth permanent magnets in the electrode structure. Axially-oriented NdFeB magnets are used in unitary architectures that couple the electric and magnetic components into an integrated structure. We have constructed a two-magnet Penning trap with radial access to enable the use of laser or atomic beams, as well as the collection of light. An experimental apparatus equipped with ion optics is installed at the NIST electron beam ion trap (EBIT) facility, constrained to fit within 1 meter at the end of a horizontal beamline for transporting highly charged ions. Highly charged ions of neon and argon, extracted with initial energies up to 4000 eV per unit charge, are captured and stored to study the confinement properties of a one-magnet trap and a two-magnet trap. Design considerations and some test results are discussed.
Risk of Inflammatory Bowel Disease following Bacille Calmette-Guérin and Smallpox Vaccination
DEFF Research Database (Denmark)
Villumsen, Anne Marie; Jess, Tine; Sørup, Signe
2013-01-01
Childhood immunology has been suggested to play a role in development of inflammatory bowel disease (IBD) based on the studies of childhood vaccinations, infections, and treatment with antibiotics. Bacille Calmette-Guérin (BCG) and smallpox vaccinations were gradually phased-out in Denmark...... for children born between 1965 and 1976, hence allowing the study of subsequent risk of Crohn's disease and ulcerative colitis in a unique prospective design....
Guía de uso de la base de datos SPORTDiscus (EBSCOhost)
Biblioteca de la Universidad de Málaga
2014-01-01
Guía de uso de la base de datos SPORTDiscus en la versión de EBSCOHost. Es una base de datos referencial de cobertura internacional gestionada por el SIRC (Sport Information Resource Centre de Canada). Ofrece información sobre: medicina deportiva, fisioterapia, rehabilitación, biomecánica, kinesiología, ciencia del movimiento, fisiología del ejercicio, técnicas de entrenamiento, personas discapacitadas, educación física, psicología del deporte y el ejercicio, fármacos, salud, e...
Fujisawa, Yuhki; Okajima, Yasutomo
2015-11-01
There are several functional tests for evaluating manual performance; however, quantitative manual tests for ataxia, especially those for evaluating handwriting, are limited. This study aimed to investigate the characteristics of cerebellar ataxia by analyzing handwriting, with a special emphasis on correlation between the movement of the pen tip and the movement of the finger or wrist. This was an observational study. Eleven people who were right-handed and had cerebellar ataxia and 17 people to serve as controls were recruited. The Scale for the Assessment and Rating of Ataxia was used to grade the severity of ataxia. Handwriting movements of both hands were analyzed. The time required for writing a character, the variability of individual handwriting, and the correlation between the movement of the pen tip and the movement of the finger or wrist were evaluated for participants with ataxia and control participants. The writing time was longer and the velocity profile and shape of the track of movement of the pen tip were more variable in participants with ataxia than in control participants. For participants with ataxia, the direction of movement of the pen tip deviated more from that of the finger or wrist, and the shape of the track of movement of the pen tip differed more from that of the finger or wrist. The severity of upper extremity ataxia measured with the Scale for the Assessment and Rating of Ataxia was mostly correlated with the variability parameters. Furthermore, it was correlated with the directional deviation of the trajectory of movement of the pen tip from that of the finger and with increased dissimilarity of the shapes of the tracks. The results may have been influenced by the scale and parameters used to measure movement. Ataxic handwriting with increased movement noise is characterized by irregular pen tip movements unconstrained by the finger or wrist. The severity of ataxia is correlated with these unconstrained movements. © 2015 American
Novel methods for improvement of a Penning ion source for neutron generator applications.
Sy, A; Ji, Q; Persaud, A; Waldmann, O; Schenkel, T
2012-02-01
Penning ion source performance for neutron generator applications is characterized by the atomic ion fraction and beam current density, providing two paths by which source performance can be improved for increased neutron yields. We have fabricated a Penning ion source to investigate novel methods for improving source performance, including optimization of wall materials and electrode geometry, advanced magnetic confinement, and integration of field emitter arrays for electron injection. Effects of several electrode geometries on discharge characteristics and extracted ion current were studied. Additional magnetic confinement resulted in a factor of two increase in beam current density. First results indicate unchanged proton fraction and increased beam current density due to electron injection from carbon nanofiber arrays.
Discrimination of Black Ball-point Pen Inks by High Performance Liquid Chromatography (HPLC)
International Nuclear Information System (INIS)
Mohamed Izzharif Abdul Halim; Norashikin Saim; Rozita Osman; Halila Jasmani; Nurul Nadhirah Zainal Abidin
2013-01-01
In this study, thirteen types of black ball-point pen inks of three major brands were analyzed using high performance liquid chromatography (HPLC). Separation of the ink components was achieved using Bondapak C-18 column with gradient elution using water, ethanol and ethyl acetate. The chromatographic data obtained at wavelength 254.8 nm was analyzed using agglomerative hierarchical clustering (AHC) and principle component analysis (PCA). AHC was able to group the inks into three clusters. This result was supported by PCA, whereby distinct separation of the three different brands was achieved. Therefore, HPLC in combination with chemometric methods may be a valuable tool for the analysis of black ball-point pen inks for forensic purposes. (author)
Nam, Yun Sik; Park, Jin Sook; Lee, Yeonhee; Lee, Kang-Bong
2014-05-01
Questioned documents examined in a forensic laboratory sometimes contain signatures written with ballpoint pen inks; these signatures were examined to assess the feasibility of micro-attenuated total reflectance (ATR) Fourier transform infrared (FTIR) spectroscopy as a forensic tool. Micro-ATR FTIR spectra for signatures written with 63 ballpoint pens available commercially in Korea were obtained and used to construct an FTIR spectral database. A library-searching program was utilized to identify the manufacturer, blend, and model of each black ballpoint pen ink based upon their FTIR peak intensities, positions, and patterns in the spectral database. This FTIR technique was also successfully used in determining the sequence of homogeneous line intersections from the crossing lines of two ballpoint pen signatures. We have demonstrated with a set of sample documents that micro-ATR FTIR is a viable nondestructive analytical method that can be used to identify the origin of the ballpoint pen ink used to mark signatures. © 2014 American Academy of Forensic Sciences.
The early behaviour of cow and calf in an individual calving pen
DEFF Research Database (Denmark)
Jensen, Margit Bak
2011-01-01
The aim was to investigate the early behaviour in dairy cows and their calves. Thirty-eight multiparous Danish Holstein Frisian cows and their calves were housed in individual calving pens during the first twelve days post-partum and their behaviour was observed during 24 h on days 3, 7 and 11....... Cows gradually reduced the time spent sniffing and licking their calves from 59 to 49 min over the days studied (P cow from less than half a minute on days 3 and 7 to 1 min on day 11 (P ... studied (P cows’ behavioural priorities, the cows were tested on either day 4, 8 or 12 after calving by removing them from their pens during 3 h and subsequently reintroducing them. Behavioural observations during 3 h after reintroduction showed...
Particle-In-Cell simulations of the Ball-pen probe
Czech Academy of Sciences Publication Activity Database
Komm, M.; Adámek, Jiří; Pekárek, Z.; Pánek, Radomír
2010-01-01
Roč. 50, č. 9 (2010), s. 814-818 ISSN 0863-1042 R&D Projects: GA AV ČR KJB100430901 Institutional research plan: CEZ:AV0Z20430508 Keywords : Ball- pen * tokamak * plasma * plasma potential * PIC * simulation * I-V characteristics Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.006, year: 2010 http://onlinelibrary.wiley.com/doi/10.1002/ctpp.201010137/pdf
Orobanche flava Mart. ex F.W. Schultz (Orobanchaceae: en la Península Ibérica
Directory of Open Access Journals (Sweden)
Pujadas Salvá, Antonio J.
2003-12-01
Full Text Available Orobanche flava is reported in the N of the Iberian Península. Its diversity and distribution is analyzed for the península: var. flava in the Pyrenees and var. albicans Rhiner in the Cantabrian Mountain chain. Lectotypification of O. flava var. albicans Rhiner [ZT] is proposed. To facilítate the identification of O. flava we emphasize its differential morphological characters and an original icon is contributed.Se indica la presencia de Orobanche flava en el N de la Península Ibérica. Se analiza su diversidad y su distribución en el territorio: var. flava en el Pirineo y var. albicans Rhiner en la Cordillera Cantábrica. Se propone el lectótipo de O. flava var. albicans Rhiner [ZT]. Para facilitar la identificación de O. flava destacamos sus caracteres morfológicos diferenciales y aportamos un icono original.
Directory of Open Access Journals (Sweden)
M. Martino
2016-06-01
Full Text Available The aim of this trial was to determine the effect of the presence of wire or plastic mesh elevated platforms on carcass traits and meat quality characteristics, with particular attention to the oxidative status of growing rabbits. A total of 174 five-week old rabbits were randomly divided into 3 groups with 2 replications (6 pens; 29 rabbits/pen: pens without platforms (NoP with a stocking density of 16 rabbits/m2 and pens with wire-mesh platforms (WP or plastic-mesh platforms (PP that were placed on 2 levels, with a stocking density of 16 rabbits/m2 on the floor or 9.14 rabbits/m2 when the platform were included. At 84 d rabbits were slaughtered. The slaughter traits and Longissimus lumborum (LL physical and chemical compositition were not affected by treatments. Rabbits from the PP group showed the highest retinol and γ-tocotrienol content on LL muscle, whereas the NoP ones showed a higher α-tocotrienol and α-tocopherol level. The absence of platforms led to decreased (P<0.001 thiobarbituric acid-reactive substances values and induced an improvement in n-3 polyunsaturated fatty acids. Levels of linoleic, linolenic and docosahexaenoic acids were equal to those of the WP group (23.45, 3.75, 0.64% in NoP and 22.6, 4.14, 0.53% in WP, respectively but higher than in PP rabbits (20.86, 3.05, 0.45%, respectively. It can be concluded that the pens with elevated platforms provide greater possibilities for movement, which is beneficial from the viewpoint of animal welfare. However, this greater activity influences the oxidative status of the meat, decreasing the antioxidant content and worsening the lipid oxidation of rabbit meat.
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Rivada, A.; Tore, C.
2014-07-01
For improvement and validation of neutron codes with calculated burning requires experimental measurements of the isotope inventory of irradiated fuel. The quality of these codes of calculation is fundamental to the security of the transport and storage of the same studies. The comparison was conducted between the calculated values and experimental measures MONTEBURNS and SCALE of the sample codes GU3. (Author)
Defining the Pen Islands Caribou Herd of southern Hudson Bay
Directory of Open Access Journals (Sweden)
Kenneth F. Abraham
1998-03-01
Full Text Available In this paper, we describe the Pen Islands Herd of caribou, the largest aggregation of caribou in Ontario (it also occupies a portion of northeastern Manitoba. Photographic counts showed the herd had a minimum population of 2300 in 1979, 4660 in 1986, 7424 in 1987 and 10 798 in 1994. Throughout the 1980s, the Pen Islands caribou exhibited population behaviour similar to migratory barren-ground caribou herds, although morphology suggests they are woodland caribou or possibly a mixture of subspecies. The herd had well-defined traditional tundra calving grounds, formed nursery groups and large mobile post-calving aggregations, and migrated over 400 km between tundra summer habitats and boreal forest winter habitats. Its migration took it into three Canadian jurisdictions (Ontario, Manitoba, Northwest Territories and it was important to residents of both Manitoba and Ontario. It is clear that the herd should be managed as a migratory herd and the critical importance of both the coastal and variable large winter ranges should be noted in ensuring the herd's habitat needs are secure.
Bacillus Calmette-Guérin vaccination at birth
DEFF Research Database (Denmark)
Kjærgaard, Jesper; Stensballe, Lone Graff; Birk, Nina Marie
2016-01-01
BACKGROUND: Bacillus Calmette-Guérin vaccine (BCG) induces a complex, pro-inflammatory immune response. Obesity is associated with low-grade inflammation. AIMS: The purpose of the study was to test whether BCG at birth has effects on infant growth and body composition. STUDY DESIGN, SUBJECTS......, AND OUTCOME MEASURES: The Danish Calmette Study is a randomized, clinical trial. The study was conducted at three university hospitals and randomized 4262 children of gestational age ≥32weeks to receive BCG within seven days of birth or to a no-intervention control group. Follow-up consisted of clinical......-up was 94% complete at 3 and 13months after birth. The children were bigger than the WHO reference population. There was no effect of BCG on weight z-score at 13months (-0.028 [95% confidence interval: -0.085 to 0.029], p=0.34). There was no effect on weight and length at 3months, or length, mid...
Dose measurement in periapical radiographic exams using dosemeter pen: a look at the radioprotection
Energy Technology Data Exchange (ETDEWEB)
Oliveira, Renato; Ferreira, Vanessa, E-mail: vanessamachado@ufmg.br [Curso Superior de Tecnologia em Radiologia. Faculdade de Medicina. Universidade Federal de Minas Gerais, Belo Horizonte, MG (Brazil); Pereira, Claubia; Oliveira, Arno H.; Veloso, M.A.F., E-mail: gbarros@nuclear.ufmg.br, E-mail: claubia@nuclear.ufmg.br, E-mail: heeren@nuclear.ufmg.br, E-mail: Dora@nuclear.ufmg.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear
2011-07-01
The use of radiology has been a large increase with the crescent accessibility to dental care, orthodontics and aesthetic. Besides the increase in the number of exams, there was an increase in radiation dose during dental exams such as computed tomography. The objective of this work is to evaluate the radiation dose to which the patient is subjected in a peri apical dental radiography. The dose values were measured with a dosimeter pen during radiographs in real exams peri apical with the X-ray equipment Timex 70 C Gnatus. During the exams realization, was maintained, in the holder, the dosimeter pen near to the region of interest. The values collected were recorded in dosimeter pen. These values were compared with the reference doses of the Portaria 453 of ANVISA, this procedure allows to verify if the recommended dose limits for this exam are being respected. These data indicates if the used equipment is calibrated and in good condition of use. It was performed a comparison between the obtained experimental dose values and the values found from computer simulation with the code MCNPX 2.6.0. (author)
Dose measurement in periapical radiographic exams using dosemeter pen: a look at the radioprotection
International Nuclear Information System (INIS)
Oliveira, Renato; Ferreira, Vanessa; Pereira, Claubia; Oliveira, Arno H.; Veloso, M.A.F.
2011-01-01
The use of radiology has been a large increase with the crescent accessibility to dental care, orthodontics and aesthetic. Besides the increase in the number of exams, there was an increase in radiation dose during dental exams such as computed tomography. The objective of this work is to evaluate the radiation dose to which the patient is subjected in a peri apical dental radiography. The dose values were measured with a dosimeter pen during radiographs in real exams peri apical with the X-ray equipment Timex 70 C Gnatus. During the exams realization, was maintained, in the holder, the dosimeter pen near to the region of interest. The values collected were recorded in dosimeter pen. These values were compared with the reference doses of the Portaria 453 of ANVISA, this procedure allows to verify if the recommended dose limits for this exam are being respected. These data indicates if the used equipment is calibrated and in good condition of use. It was performed a comparison between the obtained experimental dose values and the values found from computer simulation with the code MCNPX 2.6.0. (author)
Windmiller, G.; Orosz, J. A.; Etzel, P. B.
2010-04-01
GU Boo is one of only a relatively small number of well-studied double-lined eclipsing binaries that contain low-mass stars. López-Morales & Ribas present a comprehensive analysis of multi-color light and radial velocity curves for this system. The GU Boo light curves presented by López-Morales & Ribas had substantial asymmetries, which were attributed to large spots. In spite of the asymmetry, López-Morales & Ribas derived masses and radii accurate to sime2%. We obtained additional photometry of GU Boo using both a CCD and a single-channel photometer and modeled the light curves with the ELC software to determine if the large spots in the light curves give rise to systematic errors at the few percent level. We also modeled the original light curves from the work of López-Morales & Ribas using models with and without spots. We derived a radius of the primary of 0.6329 ± 0.0026 R sun, 0.6413 ± 0.0049 R sun, and 0.6373 ± 0.0029 R sun from the CCD, photoelectric, and López-Morales & Ribas data, respectively. Each of these measurements agrees with the value reported by López-Morales & Ribas (R 1 = 0.623 ± 0.016 R sun) at the level of ≈2%. In addition, the spread in these values is ≈1%-2% from the mean. For the secondary, we derive radii of 0.6074 ± 0.0035 R sun, 0.5944 ± 0.0069 R sun, and 0.5976 ± 0.0059 R sun from the three respective data sets. The López-Morales & Ribas value is R 2 = 0.620 ± 0.020 R sun, which is ≈2%-3% larger than each of the three values we found. The spread in these values is ≈2% from the mean. The systematic difference between our three determinations of the secondary radius and that of López-Morales & Ribas might be attributed to differences in the modeling process and codes used. Our own fits suggest that, for GU Boo at least, using accurate spot modeling of a single set of multi-color light curves results in radii determinations accurate at the ≈2% level.
International Nuclear Information System (INIS)
Windmiller, G.; Orosz, J. A.; Etzel, P. B.
2010-01-01
GU Boo is one of only a relatively small number of well-studied double-lined eclipsing binaries that contain low-mass stars. Lopez-Morales and Ribas present a comprehensive analysis of multi-color light and radial velocity curves for this system. The GU Boo light curves presented by Lopez-Morales and Ribas had substantial asymmetries, which were attributed to large spots. In spite of the asymmetry, Lopez-Morales and Ribas derived masses and radii accurate to ≅2%. We obtained additional photometry of GU Boo using both a CCD and a single-channel photometer and modeled the light curves with the ELC software to determine if the large spots in the light curves give rise to systematic errors at the few percent level. We also modeled the original light curves from the work of Lopez-Morales and Ribas using models with and without spots. We derived a radius of the primary of 0.6329 ± 0.0026 R sun , 0.6413 ± 0.0049 R sun , and 0.6373 ± 0.0029 R sun from the CCD, photoelectric, and Lopez-Morales and Ribas data, respectively. Each of these measurements agrees with the value reported by Lopez-Morales and Ribas (R 1 = 0.623 ± 0.016 R sun ) at the level of ∼2%. In addition, the spread in these values is ∼1%-2% from the mean. For the secondary, we derive radii of 0.6074 ± 0.0035 R sun , 0.5944 ± 0.0069 R sun , and 0.5976 ± 0.0059 R sun from the three respective data sets. The Lopez-Morales and Ribas value is R 2 = 0.620 ± 0.020 R sun , which is ∼2%-3% larger than each of the three values we found. The spread in these values is ∼2% from the mean. The systematic difference between our three determinations of the secondary radius and that of Lopez-Morales and Ribas might be attributed to differences in the modeling process and codes used. Our own fits suggest that, for GU Boo at least, using accurate spot modeling of a single set of multi-color light curves results in radii determinations accurate at the ∼2% level.
The EPA is developing a valuation protocol for southwest Puerto Rico that will support the US Coral Reef Task Force’s (USCRTF) Partnership Initiative in the Guánica Bay/Rio Loco (GB/RL) Watershed. The GB/RL watershed is located in southwestern Puerto Rico and includes the urbaniz...
Baladia, Eduard; Frutos Pérez-Surio, Alberto; Martínez-Rodríguez, Rodrigo
2016-01-01
Objetivos: dar a conocer las recomendaciones relacionadas con la Nutrición Humana y Dietética (NHyD) de la Guía de Práctica Clínica para el manejo de la enfermedad de Parkinson del Sistema Nacional de Salud (GPC-EP/SNS) y favorecer su difusión e implementación en la práctica. El objetivo secundario es presentar la implicación de los profesionales de la NHyD en la elaboración de la guía. Material y métodos: siguiendo el Manual Metodológico de Elaboración de Guías de Práctica Clínica en el Sist...
Guías de actuación clínica en el deterioro de la integridad cutánea: ¿dicen todas lo mismo?
Directory of Open Access Journals (Sweden)
José Navarro Yepes
Full Text Available Introducción: la gran proliferación de guías, protocolos y otros intrumentos de apoyo a la decisión clínica en la prevención y tratamiento de las úlceras por presión (UPP está acompañada de una amplia variabilidad que refleja inconsistencia y baja calidad de algunos documentos. La evaluación de las guías de práctica clínica (GPC sobre úlceras por presión en España se hace difícil debido a que frecuentemente hay ausencia de elementos clave para su identificación. Así, al usuario de la GPC, antes de utilizarlas, le interesa averiguar si una guía es de calidad, válida, útil y fiable. Las GPC deben estar adaptadas a la población a la que se va a aplicar. Esto trae consigo la necesidad de someterlas a un proceso de análisis de su calidad. Objetivos: determinar la calidad de las GPC sobre UPP mediante la versión española del instrumento AGREE. Comparar la calidad de las GPC de UPP utilizadas en el Sistema Nacional de Salud (SNS. Material y métodos: este estudio pretende someter a evaluación mediante el intrumento AGREE (Appraisal of Guidelines Research and Evaluation de 8 GPC sobre deterioro de la integridad cutánea, utilizadas en distintos hospitales del Sistema Nacional de Salud. Resultados: al comparar las puntuaciones estandarizadas por áreas, obtenemos que 5 GPC superan los 60 puntos, siendo catalogadas como "muy recomendadas", tres GPC con puntuaciones entre 60-30 puntos, catalogadas como "recomendadas con condiciones". No se encontró ninguna GPC con puntuaciones inferiores a 30 puntos, catalogadas como "no recomendadas". Conclusiones: 1. El proceso de elaboración de una GPC en el deterioro de la integridad cutánea, es costoso, requiere mucho tiempo y recursos humanos, así como personal con experiencia en el desarrollo de guías, habilidades en la búsqueda bibliográfica y en lectura crítica de artículos, lo que supone una barrera importante para la elaboración de estas. 2. La adaptación de las GPC de alta
Escribano Tébar, Inmaculada
2015-01-01
El presente Trabajo Fin de Grado está basado en el estudio de los Trastornos del Espectro Autista (TEA). Se realiza una revisión bibliográfica sobre el tema utilizando libros, artículos, guías y otras fuentes relacionadas con el tema, los cuales se pueden ver reflejados en la bibliografía de este trabajo. A partir de este estudio, se pretende que pueda servir de guía de intervención sobre alumnos con TEA pertenecientes al segundo ciclo de Educación Infantil y dirigida principalmente a maes...
Lin, Yu-Chen; Chao, Yen-Li; Wu, Shyi-Kuen; Lin, Ho-Hsio; Hsu, Chieh-Hsiang; Hsu, Hsiao-Man; Kuo, Li-Chieh
2017-10-01
Numerous tools have been developed to evaluate handwriting performances by analysing written products. However, few studies have directly investigated kinetic performances of digits when holding a pen. This study thus attempts to investigate pen-grip kinetics during writing tasks of school-age children and explore the relationship between the kinetic factors and fine motor skills. This study recruited 181 children aged from 5 to 12 years old and investigated the effects of age on handwriting kinetics and the relationship between these and fine motor skills. The forces applied from the digits and pen-tip were measured during writing tasks via a force acquisition pen, and the children's fine motor performances were also evaluated. The results indicate that peak force and average force might not be direct indicators of handwriting performance for normally developing children at this age. Younger children showed larger force variation and lower adjustment frequency during writing, which might indicate they had poorer force control than the older children. Force control when handling a pen is significantly correlated with fine motor performance, especially in relation to the manual dexterity. A novel system is proposed for analysing school-age children's force control while handwriting. We observed the development of force control in relation to pen grip among the children with different ages in this study. The findings suggested that manipulation skill may be crucial when children are establishing their handwriting capabilities. © 2017 Occupational Therapy Australia.
Jorge Alberto Cortés; Diego Perdomo; Renán Morales; Carlos Arturo Álvarez; Sonia Isabel Cuervo; Aura Lucía Leal; Julio César Gómez; Patricia Reyes; Análida Elizabeth Pinilla; Edgar Castellanos; Wilfredo Donoso
2015-01-01
Mediante un proceso de adaptación de guías de práctica clínica se seleccionaron y evaluaron guías de infección de vías urinarias en mujeres premenopáusicas no embarazadas; se identificaron 3 de alta calidad. Con base en las evidencias y las recomendaciones aportadas por estas guías, se realizó un consenso para realizar recomendaciones para personal de salud -médicos, personal de laboratorio y enfermeros- sobre el diagnóstico de las infecciones urinarias -cistitis y pielonefritis-, sus tratami...
Directory of Open Access Journals (Sweden)
M. Carmen Hidalgo
2017-04-01
Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being
Development of the Pirani and penning vacuum gauges
International Nuclear Information System (INIS)
Oh, B. H.; In, S. R.; Yoon, B. J.; Yoon, J. S.
2000-02-01
The Pirani and penning gauges developed during this study had made good characteristics compared with the measured results of customized other gauges, and this results show the possibility of developing the gauges by ourselves in Korea. In order to make a competition with the customized gauges of other countries, it is necessary to upgrade several points to have good characteristics over the large range of the pressure. The new efforts will be made in developing the full scale gauge in the next year. (author)
Directory of Open Access Journals (Sweden)
Lan-Yu Liu
2017-12-01
Full Text Available We review the three species currently placed in the genus Xylopertha Guérin-Méneville, 1845, and describe a new species, Xylopertha elegans sp. nov., from Turkey. We propose the following new synonymy: Xylopertha Guérin-Méneville, 1845 (= Paraxylogenes Damoiseau, 1968; Xylopertha reflexicauda (Lesne, 1937 (= Paraxylogenes pistaciae Damoiseau, 1968. We give details of the sexual dimorphism, and summarise information on the distribution and biology of all species. A key to the species of Xylopertha is provided.
Dwight, Ian; Coates, Peter S.; Stoute, Simone T.; Senties-Cue, C. Gabriel; Gharpure, Radhika V.; Pitesky, Maurice E.
2018-01-01
We investigated exposure to infectious diseases in wild (n=33) and pen-reared (n=12) Ring-necked Pheasants (Phasianus colchicus) in the Central Valley of California during 2014 and 2015. Serologic tests were positive for antibodies against hemorrhagic enteritis (HE), infectious bursal disease (IBD), and Newcastle disease (ND) viruses in both wild and pen-reared pheasants.
Sahoo, Satya S; Wei, Annan; Valdez, Joshua; Wang, Li; Zonjy, Bilal; Tatsuoka, Curtis; Loparo, Kenneth A; Lhatoo, Samden D
2016-01-01
The recent advances in neurological imaging and sensing technologies have led to rapid increase in the volume, rate of data generation, and variety of neuroscience data. This "neuroscience Big data" represents a significant opportunity for the biomedical research community to design experiments using data with greater timescale, large number of attributes, and statistically significant data size. The results from these new data-driven research techniques can advance our understanding of complex neurological disorders, help model long-term effects of brain injuries, and provide new insights into dynamics of brain networks. However, many existing neuroinformatics data processing and analysis tools were not built to manage large volume of data, which makes it difficult for researchers to effectively leverage this available data to advance their research. We introduce a new toolkit called NeuroPigPen that was developed using Apache Hadoop and Pig data flow language to address the challenges posed by large-scale electrophysiological signal data. NeuroPigPen is a modular toolkit that can process large volumes of electrophysiological signal data, such as Electroencephalogram (EEG), Electrocardiogram (ECG), and blood oxygen levels (SpO2), using a new distributed storage model called Cloudwave Signal Format (CSF) that supports easy partitioning and storage of signal data on commodity hardware. NeuroPigPen was developed with three design principles: (a) Scalability-the ability to efficiently process increasing volumes of data; (b) Adaptability-the toolkit can be deployed across different computing configurations; and (c) Ease of programming-the toolkit can be easily used to compose multi-step data processing pipelines using high-level programming constructs. The NeuroPigPen toolkit was evaluated using 750 GB of electrophysiological signal data over a variety of Hadoop cluster configurations ranging from 3 to 30 Data nodes. The evaluation results demonstrate that the toolkit
Directory of Open Access Journals (Sweden)
Lange J
2014-06-01
Full Text Available Jakob Lange,1 Philipp Richard,1 Nick Bradley21Ypsomed AG, Burgdorf, Switzerland; 2Bergo, Glasgow, United KingdomAbstract: This article presents a late-stage formative usability study of a pen-injector platform device. Such devices are used for the subcutaneous delivery of biopharmaceuticals, primarily for self-administration by the patient. The study was conducted with a broad user population, defined to represent user characteristics across a range of indications. The goals of the study were to confirm that the pen could be used without recurring patterns of use errors leading to hazardous situations, to evaluate the comprehension of the instructions for use (IFU, and to determine if training is necessary. In the study, a total of 36 participants in six groups (health care providers, caregivers, adolescents, diabetics with retinopathy, diabetics with neuropathy, and patients with arthritis each read the IFU, prepared the device, and performed two simulated injections into an injection pad. Any use errors, near misses, or deviations from the IFU procedure were recorded. The overall success rate (injection completed by the participant without need for assistance was 94% for the first and 100% for the second injection. Ninety-two percent of the participants reported that they felt confident using the device, 100% found the IFU helpful, and 75% found the device positively comfortable to use. Overall, a total average of 3.35 deviations and errors per user and injection were recorded (there were no near misses. Subtracting the errors without any potential for negative consequences for the injection or the user (trivial deviations, as well as those related to attaching and removing the pen needle (independent of the design of the pen itself, led to an average of 1.31 potentially relevant deviations per user and injection. It was concluded that the pen injector together with the IFU could be safely and efficiently used by all user groups without any
Directory of Open Access Journals (Sweden)
Shevchenko V.
2017-01-01
Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.
International Nuclear Information System (INIS)
Hirose, P.S.
1997-01-01
Funding from Bonneville Power Administration was provided to the Oregon Department of Fish and Wildlife and the Clatsop County Economic Development Council's Fisheries Project to identify and develop terminal fishing opportunities. The 1991 and 1992 brood fingerling coho from Oregon Department of Fish and Wildlife hatcheries were successfully reared during the winter period to smolt stage in Youngs Bay utilizing floating net pens. Based on coded-wire-tag recoveries during 1991--93 from 2-week net-pen acclimation releases, total accountability of coho adults averaged 40,540 fish, with the Youngs Bay commercial harvest accounting for 39%. With reduced ocean harvest impacts during 1994 and 1995, 92% of 51,640 coho in 1994 and 68% of 23,599 coho in 1995 (based on coded-wire-tag recoveries) were accounted for in the Youngs Bay commercial fishery for combined 2-week and overwinter acclimation net-pen releases. Overwinter net-pen acclimation coho accounted for 35,063 and 15,775 coho adults in 1994 and 1995 with 93% and 68% accountable in the Youngs Bay commercial harvest. Based on coded-wire-tag recoveries, less than 1% of the adults resulting from releases at Youngs Bay net pens strayed to hatcheries, while none were recovered on spawning ground surveys during 1991--95. The highest survival rates were observed for 1991 and 1992 brood overwinter coho released in early May. Time of release, not rearing strategy, appears to be the determining factor affecting survival in Youngs Bay
Thermoplastic polymers surfaces for Dip-Pen Nanolithography of oligonucleotides
International Nuclear Information System (INIS)
Suriano, Raffaella; Biella, Serena; Cesura, Federico; Levi, Marinella; Turri, Stefano
2013-01-01
Different thermoplastic polymers were spin-coated to prepare smooth surfaces for the direct deposition of end-group modified oligonucleotides by Dip-Pen Nanolithography. A study of the diffusion process was done in order to investigate the dependence of calibration coefficient and quality of deposited features on environmental parameters (temperature, relative humidity) and ink's molecular weight and functionality. The optimization of the process parameters led to the realization of high quality and density nanoarrays on plastics.
Directory of Open Access Journals (Sweden)
José María Lobos Bejaran
2015-01-01
Full Text Available La publicación en Estados Unidos de la guía de 2013 de American College of Cardiology/American Heart Association para el tratamiento del colesterol elevado ha tenido gran impacto por el cambio de paradigma que supone. El Comité Español Interdisciplinario de Prevención Cardiovascular y la Sociedad Española de Cardiología han revisado esa guía, en comparación con la vigente guía europea de prevención cardiovascular y de dislipemias. El aspecto más destacable de la guía estadounidense es el abandono de los objetivos de colesterol unido a lipoproteínas de baja densidad, de modo que proponen el tratamiento con estatinas en cuatro grupos de riesgo aumentado. En pacientes con enfermedad cardiovascular establecida, ambas guías conducen a una estrategia terapéutica similar (estatinas potentes, dosis altas. Sin embargo, en prevención primaria, la aplicación de la guía estadounidense supondría tratar con estatinas a un número de personas excesivo, particularmente de edades avanzadas. Abandonar la estrategia según objetivos de colesterol, fuertemente arraigada en la comunidad científica, podría tener un impacto negativo en la práctica clínica y crear cierta confusión e inseguridad entre los profesionales y quizá menos seguimiento y adherencia de los pacientes. Por todo ello, el presente documento reafirma las recomendaciones de la guía europea. Ambas guías tienen aspectos positivos pero, en general y mientras no se resuelvan las dudas planteadas, la guía europea, además de utilizar tablas basadas en la población autóctona, ofrece mensajes más apropiados para el entorno español y previene del posible riesgo de sobretratamiento con estatinas en prevención primaria.
Guía de Práctica Clínica para el manejo nutricional de personas con Fibrosis Quística (GPC-FQ
Directory of Open Access Journals (Sweden)
María Garriga
2017-04-01
Full Text Available La fibrosis quística (FQ es una enfermedad multiorgánica, hereditaria, autosómica y recesiva cuyos problemas más frecuentes están relacionados con las alteraciones de los pulmones y del páncreas exocrino. El objetivo de esta guía es establecer unas pautas en la práctica clínica para el manejo nutricional de personas con FQ, pudiéndose encontrar recomendaciones sobre la evaluación del estado clínico-nutricional (anamnesis, exploración física, composición corporal, bioquímica, función pulmonar, valoración dietético-nutricional, función del páncreas y malabsorción intestinal, y valoración de enfermedades asociadas, tratamiento nutricional de la enfermedad y sus síntomas (estado nutricional y pérdida de peso, intervención nutricional, suplementación con vitaminas y minerales, tratamiento de insuficiencia pancreática, diabetes, y enfermedad hepática, y otras circunstancias (embarazo, lactancia, y trasplante pulmonar. La guía ha sido elaborada mediante revisión simple por un grupo de expertos/as que tomó decisiones a través del consenso para ayudar en la toma de decisiones de los profesionales implicados en la atención de pacientes. Esta guía ha sido revisada y aprobada por el Comité Científico de la Fundación Española de Dietistas-Nutricionistas (FEDN. La guía no pretende ser de obligado cumplimiento ni sustituye el juicio clínico del personal sanitario.
Improvements in the injection system of the Canadian Penning trap mass spectrometer
Clark, J; Boudreau, C; Buchinger, F; Crawford, J E; Gulick, S; Hardy, J C; Heinz, A; Lee, J K P; Moore, R B; Savard, G; Seweryniak, D; Sharma, K S; Sprouse, G; Vaz, J; Wang, J C; Zhou, Z
2003-01-01
The Canadian Penning Trap (CPT) mass spectrometer is designed to make precise mass measurements on a variety of stable and short-lived isotopes. Modifications to the injection system of the CPT have been implemented in recent months, the purpose being to more efficiently collect and transfer weakly-produced reaction products from the target to the Penning trap. These include a magnetic triplet situated after the target chamber to increase the acceptance of the Enge spectrograph, a velocity filter to more effectively separate the beam from the reaction products and the replacement of the Paul trap with a linear trap resulting in more efficient capture and accumulation of ions from the ion cooler. This paper will discuss these recent modifications and how they have increased our ability in making mass measurements on isotopes of low abundance, including those from a sup 2 sup 5 sup 2 Cf fission source.
Vegetation survey of Pen Branch and Four Mile Creek wetlands
Energy Technology Data Exchange (ETDEWEB)
1992-01-01
One hundred-fifty plots were recently sampled (vegetational sampling study) at the Savannah River Site (SRS). An extensive characterization of the vascular flora, in four predetermined strata (overstory, Understory, shrub layer, and ground cover), was undertaken to determine dominance, co-dominance, and the importance value (I.V.) of each species. These results will be used by the Savannah River Laboratory (SRL) to evaluate the environmental status of Four Mile Creek, Pen Branch, and two upland pine stands. Objectives of this study were to: Describe in detail the plant communities previously mapped with reference to the topography and drainage, including species of plants present: Examine the successional trends within each sampling area and describe the extent to which current vegetation communities have resulted from specific earlier vegetation disturbances (e.g., logging and grazing); describe in detail the botanical field techniques used to sample the flora; describe the habitat and location of protected and/or rare species of plants; and collect and prepare plant species as herbarium quality specimens. Sampling was conducted at Four Mile Creek and Pen Branch, and in two upland pine plantations of different age growth.
Vegetation survey of Pen Branch and Four Mile Creek wetlands
Energy Technology Data Exchange (ETDEWEB)
1992-10-01
One hundred-fifty plots were recently sampled (vegetational sampling study) at the Savannah River Site (SRS). An extensive characterization of the vascular flora, in four predetermined strata (overstory, Understory, shrub layer, and ground cover), was undertaken to determine dominance, co-dominance, and the importance value (I.V.) of each species. These results will be used by the Savannah River Laboratory (SRL) to evaluate the environmental status of Four Mile Creek, Pen Branch, and two upland pine stands. Objectives of this study were to: Describe in detail the plant communities previously mapped with reference to the topography and drainage, including species of plants present: Examine the successional trends within each sampling area and describe the extent to which current vegetation communities have resulted from specific earlier vegetation disturbances (e.g., logging and grazing); describe in detail the botanical field techniques used to sample the flora; describe the habitat and location of protected and/or rare species of plants; and collect and prepare plant species as herbarium quality specimens. Sampling was conducted at Four Mile Creek and Pen Branch, and in two upland pine plantations of different age growth.
Holt, Maria
2013-03-01
In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.
Guía para la localización de fuentes relativas al País Vasco en el Archivo Secreto Vaticano [RESEÑA
Ferrer-del-Río, E. (Estefanía)
2015-01-01
Reseña de "Valeria BEOLCHINI – Marta PAVÓN RAMÍREZ, Guía para la localización de fuentes relativas al País Vasco en el Archivo Secreto Vaticano. Documentación medieval. Díaz de Durana, José Ramón; Jular Pérez-Alfaro, Cristina (coords.), Universidad del País Vasco, Bilbao 2014, 91 pp." y "Marta PAVÓN RAMÍREZ, Guía para la localización de fuentes relativas al País Vasco en el Archivo Secreto Vaticano. Documentación de época moderna (1458-1830) Porres Marijuán, Rosario et al. (coords.), Unive...
2013-11-07
... GuLF STUDY is to investigate potential short- and long-term health effects associated with oil spill... non-Cleanup Workers Supplemental Mental Health 4,600 4 15/60 4,600 1,533 Telephone Questionnaire... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Proposed Collection; 60-Day...
Application of the CO2-PENS risk analysis tool to the Rock Springs Uplift, Wyoming
Stauffer, P.H.; Pawar, R.J.; Surdam, R.C.; Jiao, Z.; Deng, H.; Lettelier, B.C.; Viswanathan, H.S.; Sanzo, D.L.; Keating, G.N.
2011-01-01
We describe preliminary application of the CO2-PENS performance and risk analysis tool to a planned geologic CO2 sequestration demonstration project in the Rock Springs Uplift (RSU), located in south western Wyoming. We use data from the RSU to populate CO2-PENS, an evolving system-level modeling tool developed at Los Alamos National Laboratory. This tool has been designed to generate performance and risk assessment calculations for the geologic sequestration of carbon dioxide. Our approach follows Systems Analysis logic and includes estimates of uncertainty in model parameters and Monte-Carlo simulations that lead to probabilistic results. Probabilistic results provide decision makers with a range in the likelihood of different outcomes. Herein we present results from a newly implemented approach in CO 2-PENS that captures site-specific spatially coherent details such as topography on the reservoir/cap-rock interface, changes in saturation and pressure during injection, and dip on overlying aquifers that may be impacted by leakage upward through wellbores and faults. We present simulations of CO 2 injection under different uncertainty distributions for hypothetical leaking wells and faults. Although results are preliminary and to be used only for demonstration of the approach, future results of the risk analysis will form the basis for a discussion on methods to reduce uncertainty in the risk calculations. Additionally, we present ideas on using the model to help locate monitoring equipment to detect potential leaks. By maintaining site-specific details in the CO2-PENS analysis we provide a tool that allows more logical presentations to stakeholders in the region. ?? 2011 Published by Elsevier Ltd.
Puder, Jardena J; Atar, Michael; Muller, Beat; Pavan, Marco; Keller, Ulrich
2005-02-01
Reusing insulin pen needles could help to reduce the increasing economic burden of diabetes. We tested the hypothesis that reusing insulin pen needles leads to needle tip deformity and increased pain. Three blinded reviewers assessed 123 electron microscope pictures analyzing needle tip deformity of insulin pen needles used up to four times by diabetic subjects and up to five times by blinded non-diabetic volunteers. The estimated frequency of needle use was correlated to the actual number of needle use. Pain intensity and unpleasantness of each injection were measured by a visual analogue scale and their differences analyzed by Kruskal-Wallis analysis of variance. Unused needles could be differentiated visually from used needles. However, there was no correlation between the actual and guessed number of times a needle was used (r = 0.07, P = 0.2). Evaluating all 270 injections, neither pain intensity nor unpleasantness increased with repeated injections of the same needles in people with diabetes (P = 0.1 and 0.96) and in the volunteers (P = 0.63 and 0.92). Using pen needles four to five times does not lead to progressive needle tip deformity and does not increase pain intensity or unpleasantness, but could increase convenience and lead to substantial financial savings in Europe of around EUR 100 million/year.
Thermoplastic polymers surfaces for Dip-Pen Nanolithography of oligonucleotides
Energy Technology Data Exchange (ETDEWEB)
Suriano, Raffaella [Dipartimento di Chimica, Materiali e Ingegneria Chimica “Giulio Natta”, Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Biella, Serena, E-mail: serena.biella@polimi.it [Dipartimento di Chimica, Materiali e Ingegneria Chimica “Giulio Natta”, Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy); Cesura, Federico; Levi, Marinella; Turri, Stefano [Dipartimento di Chimica, Materiali e Ingegneria Chimica “Giulio Natta”, Politecnico di Milano, Piazza Leonardo da Vinci 32, 20133 Milano (Italy)
2013-05-15
Different thermoplastic polymers were spin-coated to prepare smooth surfaces for the direct deposition of end-group modified oligonucleotides by Dip-Pen Nanolithography. A study of the diffusion process was done in order to investigate the dependence of calibration coefficient and quality of deposited features on environmental parameters (temperature, relative humidity) and ink's molecular weight and functionality. The optimization of the process parameters led to the realization of high quality and density nanoarrays on plastics.
High-voltage switching for in-flight capture of keV antiprotons in a Penning trap
International Nuclear Information System (INIS)
Fei, X.; Davisson, R.; Gabrielse, G.
1987-01-01
The recently observed in-flight capture of keV antiprotons and protons in a Penning trap requires that the -3-kV potentials on electrodes of a Penning trap near 4.2 K be switched on and off with switching times less than 20 ns. These rapidly switched potentials are applied via transmission lines which are not terminated at the trap, thereby avoiding unacceptable heat load on the helium Dewar. Simple high-voltage switching circuits are constructed using krytrons and reed relays. A krytron provides the rapid switching and stays on just long enough for a reed relay to kick in and maintain the switched state indefinitely
International Nuclear Information System (INIS)
1996-01-01
Airborne multispectral scanner data were used to monitor natural succession of wetland vegetation species over a three-year period from 1992 through 1994 for Pen Branch on the Savannah River Site in South Carolina. Image processing techniques were used to identify and measure wetland vegetation communities in the lower portion of the Pen Branch corridor and delta. The study provided a reliable means for monitoring medium- and large-scale changes in a diverse environment. Findings from the study will be used to support decisions regarding remediation efforts following the cessation of cooling water discharge from K reactor at the Department of Energy's Savannah River Site in South Carolina
Estilo desornamentado, arquitetura-chã: alguns aspectos do renascimento na Península Ibérica
Directory of Open Access Journals (Sweden)
Andrea Buchidid Loewen
2011-12-01
Full Text Available En el siglo 16, en la Península Ibérica, la asimilación del romano dale impulsión a una corriente arquitectónica en la cual un clasicismo progresivo e la desnudez decorativa anuncian la llegada del llamado Renacimiento. A despecho de sus peculiaridades, tanto el estilo-chão portugués cuanto el desornamentado español se sostienen sobre doctrinas arquitectónicas de origen itálica. Traídas sea por los artífices que estuvieran en tales tierras - o por los arquitectos desde allá llamados a trabajar en la Península - sea por los tratados de arquitectura importados y, más tarde, traducidos al castellano y al portugués, tales doctrinas alimentaran todavía la publicación de otras significativas obras de sistematización teórica, como la sagrediana Medidas del romano. Esto artículo discute tales aspectos del Renacimiento en la Península Ibérica.
Effect of sand and rubber surface on the lying behavior of lame dairy cows in hospital pens
DEFF Research Database (Denmark)
Bak, Anne Sandgrav; Herskin, Mette S.; Jensen, Margit Bak
2016-01-01
Housing lame cows in designated hospital pens with a soft surface may lessen the pain the animals feel when lying and changing position. This study investigated the effect of the lying surface on the behavior of lame cows in hospital pens. Thirty-two lame dairy cows were kept in individual hospital...... pens, provided with either 30-cm deep-bedded sand or 24-mm rubber mats during 24 h in a crossover design. On each surface, the lying behavior of each cow was recorded during 18 h. On deep-bedded sand, cows lay down more and changed position more often than when housed on the rubber surface. Furthermore......, a shorter duration of lying down and getting up movements and a shorter duration of lying intention movements were observed. These results suggest that lame dairy cows are more reluctant to change position on rubber compared with sand, and that sand is more comfortable to lie on. Thus, deep bedding...
Francisco David Ramirez Betancourt; Clara María Martínez Maienzo; Ariel Romero Fernández
2011-01-01
El presente trabajo, tiene como objetivo determinar el nivel de satisfacción de los estudiantes y profesores con las Guías de Estudio en la formación semipresencial, desde una perspectiva de mejora, proporcionándole a la institución una estrategia para el cambio en uno de los materiales de que disponen los estudiantes para la adquisición de los conocimientos en este caso, la guía de estudio, que constituye un medio fundamental para realizar la ...
Musicoterapia en personas con demencia: intervenciones no farmacológicas. Guía de orientación
García Valverde, Esther
2014-01-01
Esta guía pretende ofrecer una visión integral de la musicoterapia especializada en personas con demencia, proporcionando estrategias de intervención basadas en la evidencia científica y en la práctica profesional. Va dirigida a musicoterapeutas que intervienen en el ámbito de la enfermedad de Alzheimer y otras demencias.
Biodiversité et santé : Tuons-nous les plantes qui peuvent nous guérir
International Development Research Centre (IDRC) Digital Library (Canada)
1 févr. 2011 ... En outre, le déboisement et la désertification, réduisant tant la qualité du bois que la quantité, ont eu des effets néfastes sur la demande, tandis que la ... La popularité des guérisseurs traditionnels et de leurs remèdes repose en partie sur le faible coût des services et des médicaments, affirme Messanvi ...
Optimal design of a 7 T highly homogeneous superconducting magnet for a Penning trap
International Nuclear Information System (INIS)
Wu Wei; He Yuan; Ma Lizhen; Huang Wenxue; Xia Jiawen
2010-01-01
A Penning trap system called Lanzhou Penning Trap (LPT) is now being developed for precise mass measurements at the Institute of Modern Physics(IMP). One of the key components is a 7 T actively shielded superconducting magnet with a clear warm bore of 156 mm. The required field homogeneity is 3 x 10 -7 over two 1 cubic centimeter volumes lying 220 mm apart along the magnet axis. We introduce a two-step method which combines linear programming and a nonlinear optimization algorithm for designing the multi-section superconducting magnet. This method is fast and flexible for handling arbitrary shaped homogeneous volumes and coils. With the help of this method an optimal design for the LPT superconducting magnet has been obtained. (authors)
Directory of Open Access Journals (Sweden)
Pablo Lekue
2016-11-01
Full Text Available Las guías docentes son instrumentos imprescindibles a la hora de planificar los procesos de enseñanza y de aprendizaje pues hacen explícitos los elementos constitutivos de dichos procesos (objetivos, competencias, contenidos, metodologías y evaluación y sirven como documento para el consenso entre los agentes educativos. Las guías docentes de las asignaturas de educación artística han sido diseñadas y son renovadas anualmente con el objetivo último de ayudar al alumnado en la consecución de las competencias propias del área. En la incipiente investigación aquí presentada, se pretende estudiar la consideración del alumnado de los grados en magisterio en Educación Infantil y Primaria de la Facultad de Educación y Deporte de la Universidad del País Vasco (UPV/EHU sobre las guías docentes del área. Los primeros resultados muestran una discreta conformidad del alumnado con esas guías, en las que perciben claridad informativa, coherencia entre planteamiento teórico y desarrollo metodológico y funcionalidad.
Preparation of a tritium Q-value measurement in a double penning trap
Energy Technology Data Exchange (ETDEWEB)
Diehl, Christoph; Orth, Christoph; Blaum, Klaus [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Physikalisches Institut, Ruprecht-Karls-Universitaet, Heidelberg (Germany); Pinegar, David [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Van Dyck, Robert Jr. [Department of Physics, University of Washington, Seattle (United States)
2009-07-01
A precise determination of the Q-value of tritium ({sup 3}H) is of relevance for the determination of the electron anti-neutrino mass as aspired by the Karlsruhe Tritium Neutrino Experiment (KATRIN). In our double Penning trap mass spectrometer we aim to measure the mass ratio of {sup 3}H and its {beta}-decay product {sup 3}He to an accuracy of 10{sup -11}, which would determine the Q-value to an accuracy of 30 meV. The spectrometer we utilize is an enhanced version of the University of Washington Penning trap mass spectrometer (UW-PTMS) and was recently transfered from Seattle to Heidelberg, where it is set up at the moment as the MPIK/UW-PTMS. We present the necessary preparation work at the Max-Planck-Institut fuer Kernphysik. This includes major reconstructions of the building as well as studies and control of environmental parameters in the laboratory, like temperature and magnetic field.
Influence of pen area and trough space on feedlot performance of ...
African Journals Online (AJOL)
performance. There was no advantage in allowing more than 170 mm trough space or more than 5,5 m2 floor area per animal with the conditions and climate under which these trials were conducted ... pen area on feed intake and feedlot performance. A total of 196 dehorned ... Standard deviation (kg). 0,19. 0,18. 0,19. 0,15.
Directory of Open Access Journals (Sweden)
Jorge Alberto Cortés
2015-10-01
Full Text Available Mediante un proceso de adaptación de guías de práctica clínica se seleccionaron y evaluaron guías de infección de vías urinarias en mujeres premenopáusicas no embarazadas; se identificaron 3 de alta calidad. Con base en las evidencias y las recomendaciones aportadas por estas guías, se realizó un consenso para realizar recomendaciones para personal de salud —médicos, personal de laboratorio y enfermeros— sobre el diagnóstico de las infecciones urinarias —cistitis y pielonefritis—, sus tratamientos y prevención de la recurrencia.
Directory of Open Access Journals (Sweden)
Tao Li
2017-03-01
Full Text Available Chorebus (Stiphrocera hexomyzae sp. n. (Hymenoptera, Braconidae, Alysiinae, Dacnusini is described and illustrated. It was reared from twig galls of Hexomyza caraganae Gu (Diptera, Agromyzidae on Caragana korshinskii Kom. f. (Fabaceae in Ningxia and Inner Mongolia (NW China. A partial key to related or similar Chorebus species is provided.
Testing and Evaluation of a Pen Input Device Using an Inertial/Magnetic Sensor Module
National Research Council Canada - National Science Library
Drakopoulos, Leonidas
2008-01-01
.... Before continuing to evaluate the 3-D writing, a calibration algorithm is implemented for computing the length between the nose of the pen input device and the point where the inertial/magnetic...
Natalia Sanchez Vargas
2011-01-01
Este trabajo fue realizado durante un año, entre el 2009 y 2010, con estudiantes del taller de granja en los grados cuarto-quinto del Instituto Pedagógico Nacional (IPN). Se desarrolló un Programa Guía de Actividades (PGA) para aplicar en la granja, teniendo en cuenta las dificultades que presentaban los estudiantes en la comprensión de los conceptos interacción y red Trofíca. La enseñanza de los conceptos trabajados desde el Programa Guía de Actividades (PGA) mostro ser eficiente ya que perm...
Penning trap mass measurements on nobelium isotopes
International Nuclear Information System (INIS)
Dworschak, M.; Block, M.; Ackermann, D.; Herfurth, F.; Hessberger, F. P.; Hofmann, S.; Vorobyev, G. K.; Audi, G.; Blaum, K.; Droese, C.; Marx, G.; Schweikhard, L.; Eliseev, S.; Ketter, J.; Fleckenstein, T.; Haettner, E.; Plass, W. R.; Scheidenberger, C.; Ketelaer, J.; Kluge, H.-J.
2010-01-01
The Penning trap mass spectrometer SHIPTRAP at GSI Darmstadt allows accurate mass measurements of radionuclides, produced in fusion-evaporation reactions and separated by the velocity filter SHIP from the primary beam. Recently, the masses of the three nobelium isotopes 252-254 No were determined. These are the first direct mass measurements of transuranium elements, which provide new anchor points in this region. The heavy nuclides were produced in cold-fusion reactions by irradiating a PbS target with a 48 Ca beam, resulting in production rates of the nuclei of interest of about one atom per second. In combination with data from decay spectroscopy our results are used to perform a new atomic-mass evaluation in this region.
Directory of Open Access Journals (Sweden)
Tatiana A. Gridina
2017-07-01
Full Text Available The article investigates into the role of pen-names in the self-presentation of a regional newspaper’s journalist, the pen name being analyzed as a kind of micro-text that models the reporter’s image according to their position within the edition’s information field, its stylistic and generic strategies of presenting information. From the onomasiological point of view, the authors distinguish between four types of journalistic pseudonyms: 1 pen names intended to present the author as an unspecified individual; 2 pseudonyms patterned after speaking names whose internal form stresses the characteristics of the journalist’s image; 3 pen names based on the culturally specific associative meaning of the motivating name — such names impose cultural and historical presuppositions governing the perception of the journalist’s image; 4 pen names with various role specializations that manifest the journalist’s inclination to ludic self-presentation. Each type corresponds to several ways of name creation. The latter include abbreviation, onymization of common nouns, different techniques of language game. The authors also establish the generalized strategies of communicational interaction between journalists and their readers: strategy of distancing, strategy of adhesion, and strategy of game interaction. The paper argues that there is correlation between the choice of an interaction strategy and the journalist’s image reflected in their pen name.
Guía para restricción física de fauna silvestre
Torres-Chaparro, María Yanneth; Quintero-Sánchez, Vladimir
2016-01-01
Esta guía presenta los protocolos y actividades que deben realizarse durante la manipulación de fauna silvestre en los Centros de Atención y Valoración (CAV). Como bien es sabido, el tráfico de fauna silvestre es una actividad ilícita que trae consigo unos problemas profundos de pérdida de biodiversidad. Dentro de las estrategias de control de tráfico de fauna se realizan actividades de control y monitoreo, presentándose situaciones en las cuales un gran número de animales son rescatados, dec...
Directory of Open Access Journals (Sweden)
Leah R. Vincent
2018-04-01
Full Text Available Resistance to ceftriaxone in Neisseria gonorrhoeae is mainly conferred by mosaic penA alleles that encode penicillin-binding protein 2 (PBP2 variants with markedly lower rates of acylation by ceftriaxone. To assess the impact of these mosaic penA alleles on gonococcal fitness, we introduced the mosaic penA alleles from two ceftriaxone-resistant (Cror clinical isolates (H041 and F89 into a Cros strain (FA19 by allelic exchange and showed that the resultant Cror mutants were significantly outcompeted by the Cros parent strain in vitro and in a murine infection model. Four Cror compensatory mutants of FA19 penA41 were isolated independently from mice that outcompeted the parent strain both in vitro and in vivo. One of these compensatory mutants (LV41C displayed a unique growth profile, with rapid log growth followed by a sharp plateau/gradual decline at stationary phase. Genome sequencing of LV41C revealed a mutation (G348D in the acnB gene encoding the bifunctional aconitate hydratase 2/2 methylisocitrate dehydratase. Introduction of the acnBG348D allele into FA19 penA41 conferred both a growth profile that phenocopied that of LV41C and a fitness advantage, although not as strongly as that exhibited by the original compensatory mutant, suggesting the existence of additional compensatory mutations. The mutant aconitase appears to be a functional knockout with lower activity and expression than wild-type aconitase. Transcriptome sequencing (RNA-seq analysis of FA19 penA41 acnBG348D revealed a large set of upregulated genes involved in carbon and energy metabolism. We conclude that compensatory mutations can be selected in Cror gonococcal strains that increase metabolism to ameliorate their fitness deficit.
Analysis on composition and inclusions of ballpoint pen tip steel
Yang, Qian-kun; Shen, Ping; Zhang, Dong; Wu, Yan-xin; Fu, Jian-xun
2018-04-01
Ballpoint pen tip steel, a super free-cutting stainless steel, exhibits excellent corrosion resistance and good machining properties. In this study, inductively coupled plasma spectroscopy, metallographic microscopy, and scanning electron microscopy were used to determine the elemental contents in five ballpoint pen tips and their components, morphologies, and inclusion distributions. The results showed that the steels were all S-Pb-Te super free-cutting ferritic stainless steel. The free-cutting phases in the steels were mainly MnS, Pb, and small amounts of PbTe. MnS inclusions were in the form of chain distributions, and the aspect ratio of each size inclusion in the chain was small. The stress concentration effect could substantially reduce the cutting force when the material was machined. Some of the Pb was distributed evenly in the steel matrix as fine particles (1-2 μm), and the rest of the Pb was distributed at the middle or at both ends of the MnS inclusions. The Pb plays a role in lubrication and melting embrittlement, which substantially increases the cutting performance. PbTe was also usually distributed in the middle and at both ends of the MnS inclusions, and Te could convert the sulfides into spindles, thereby improving the cutting performance of the steel.
The role of self-esteem and gender in pen scores and risk-taking ...
African Journals Online (AJOL)
The role of self-esteem and gender in pen scores and risk-taking behaviour of learners in a South African school. ... RTB to some extent but not on the moderation effects of self-esteem (SE) and gender on RTB ... AJOL African Journals Online.
Tonnu, P-A; Ho, T; Newson, T; El Sheikh, A; Sharma, K; White, E; Bunce, C; Garway-Heath, D
2005-07-01
To evaluate the influence of central corneal thickness (CCT) on intraocular pressure (IOP) measurements made with the Goldmann applanation tonometer (GAT), Tono-Pen XL, ocular blood flow tonograph (OBF), and Canon TX-10 non-contact tonometer (NCT). CCT was recorded for either eye (randomly selected) of each of 105 untreated patients with ocular hypertension and glaucoma attending the glaucoma research unit at Moorfields Eye Hospital. For each of the selected eyes, IOP was measured with the GAT (two observers), Tono-Pen, OBF, and NCT in a randomised order. The relation of measured IOP and of inter-tonometer differences with CCT and subject age was explored by linear regression analysis. A significant association between measured IOP and CCT was found with each instrument. The change in measured IOP for a 10 mum increase in CCT was 0.28, 0.31, 0.38, and 0.46 for the GAT, Tono-Pen, OBF, and NCT, respectively (all p< or = 0.05). There was a significant association between the NCT/GAT differences and CCT, with a tendency of NCT to overestimate GAT in eyes with thicker corneas. There was a significant association between GAT/Tono-Pen and OBF/Tono-Pen differences and age, with a tendency of GAT and OBF to overestimate the Tono-Pen in eyes of older subjects. IOP measurement by all four methods is affected by CCT. The NCT is affected by CCT significantly more than the GAT. Subject age has a differential effect on the IOP measurements made by the GAT and OBF compared to the Tono-Pen.
Kinetic model of a Ne-H2 Penning Recombination Laser operating in the hollow cathode discharge
International Nuclear Information System (INIS)
Pramatarov, P.M.; Stefanova, M.S.; Petrov, G.M.
1995-01-01
The Penning Recombination Laser (PRL) requires the presence of both a recombination plasma populating the upper laser level (ULL) and a gas component efficiently depopulating the lower laser level (LLL) by Penning reactions. Such requirements are met in the negative glow plasma of a pulsed high voltage Ne-H 2 discharge with a helical hollow cathode. High rates of ionizations followed by recombinations are reached due to the beam component of non-Maxwellian electrons of 1-2 keV energy present in the tail of the electron energy distribution function. The H 2 , on the one hand plays the role of Penning component and on the other hand effectively cools the electrons by rotational and vibrational levels excitation. The latter contributes to the effectiveness of the recombination processes. A kinetic model of the physical processes determining the inversion population on the NeI(2p 1 -1s 2 ) transition (the 585.3 nm line) in a Ne-H 2 PRL operating in a high voltage hollow cathode discharge at intermediate pressures is proposed. About 60 plasma-chemical reactions are considered in the model. These include: two-electron recombination of Ne + ; dissociative recombination of Ne 2 + , NeH + and H 2 + ; ion-ion recombination of Ne + and H - ; Ne and H 2 direct ionization by fast electrons; Ne stepwise ionization; Penning ionization; Ne excitation by fast electrons; Ne stepwise excitation and de-excitation; radiative transitions; electron mixing between Ne excited states; H 2 rotational and vibrational levels excitation; H 2 dissociative attachment; elastic electron collisions with H 2 and Ne. The rate constants for the reactions are either taken from the literature or calculated in this work
Computational prediction of the effective temperature in the lying area of pig pens
DEFF Research Database (Denmark)
Bjerg, Bjarne; Rong, Li; Zhang, Guoqiang
2018-01-01
Using solid floor instead of drained or slatted floor in the lying areas of pig pens has distinct advantages in relation to animal welfare, odour abatement and ammonia emission, energy consumption and reduced building costs. However, pig producers often opt out of providing a solid floor due......, individually contribute to the combined effect of the thermal condition raising pigs are exposed to. Computational Fluid Dynamics (CFD) simulations were conducted to estimate the relevant parameters and, finally, the ET. Furthermore, the developed ET equation was implemented in the CFD model as a Custom Field...... Function to calculate the distribution of ET in the animal occupied zone. It was assumed that a traditional diffuse ceiling air inlet would deliver the required airflow rate as long as the outdoor temperature was below 10. °C. At higher outdoor temperature, a ceiling-jet inlet above each pen was opened...
Yick, Alice G.; Oomen-Early, Jody
2009-01-01
Purpose: The purpose of this article is two-fold. First, it applies the PEN-3 model to the topic of domestic violence within the Chinese American and Chinese immigrant community. The PEN-3 model was developed by Collins Airhihenbuwa, and it focuses on placing culture at the forefront of health promotion. It consists of three dimensions: cultural…
Guía clínica de consenso en el uso de desbridamiento enzimático en quemaduras con NexoBrid®
Directory of Open Access Journals (Sweden)
José-Ramón Martínez-Méndez
Full Text Available Introducción y Objetivo: El desbridamiento precoz es la base del tratamiento de las quemaduras. La retirada de la escara durante las primeras 72 horas es la mejor opción para reducir la estancia hospitalaria y los eventos infecciosos. Sin embargo, en muchas ocasiones se compromete la dermis viable necesaria para obtener los mejores resultados estéticos y funcionales, obligando a injertar el lecho. Hay numerosa evidencia acerca de la reducción de las tasas de injerto, la pérdida hemática y el número de intervenciones cuando se utiliza un desbridante enzimático, NexoBrid®. El objetivo de esta publicación es establecer una guía clínica basada en la opinión de los expertos españoles. Material y Método: Se diseñó un panel de 7 expertos de las principales Unidades de Quemados españolas, con más de 350 pacientes tratados, que discutió las diferentes fases del tratamiento con Nexo-Brid® para obtener una guía clínica de consenso acerca de la indicación, uso y manejo del desbridamiento enzimático. Resultados: Se alcanzó un alto nivel de consenso, con más del 70% de acuerdo en cada una de las fases de tratamiento. Todos los aspectos del tratamiento con NexoBrid® fueron discutidos durante la reunión, así como las indicaciones y limitaciones de su uso, incluyendo todas las nuevas evidencias publicadas hasta el momento. También las diversas opciones utilizadas por los diferentes centros de quemados españoles, alcanzando una recomendación global sobre su uso. Conclusiones: Se redactó un documento como guía clínica preliminar sobre el uso de NexoBrid® hasta que se creen nuevas guías basadas en evidencia. No existe ningún otro consenso similar publicado hasta el momento.
Vos, Margreet C.; de Haas, Petra E. W.; Verbrugh, Henri A.; Renders, Nicole H. M.; Hartwig, Nico G.; de Man, Peter; Kolk, Arend H. J.; van Deutekom, Henk; Yntema, J. L.; Vulto, Arnold G.; Messemaker, Marja; van Soolingen, Dick
2003-01-01
We studied nosocomial infections due to Mycobacterium bovis bacille Calmette-Guérin (BCG) Onco-TICE bacteria, transmitted by contamination of medication prepared in BCG Onco-TICE-contaminated hoods in the pharmacy, in 5 immunocompromised patients at 3 hospitals. The BCG strains cultured from the
Feechan, A; Jermakow, A M; Ivancevic, A; Godfrey, D; Pak, H; Panstruga, R; Dry, I B
2013-10-01
Challenge by a nonadapted powdery mildew fungal pathogen leads to the formation of a local cell-wall apposition (papilla) beneath the point of attempted penetration. Several plasma membrane (PM) proteins with opposing roles in powdery mildew infection, including Arabidopsis thaliana PENETRATION1 (PEN1) and barley (Hordeum vulgare) MILDEW RESISTANCE LOCUS O (MLO), are localized to the site of powdery mildew attack. PEN1 contributes to penetration resistance to nonadapted powdery mildews, whereas MLO is a susceptibility factor required by adapted powdery mildew pathogens for host cell entry. Our previous studies have demonstrated that the vesicle and endosomal trafficking inhibitors, brefeldin A and wortmannin, have opposite effects on the penetration rates of adapted and nonadapted powdery mildews on grapevine. These findings prompted us to study the pathogen-induced intracellular trafficking of grapevine variants of MLO and PEN1. We first identified grapevine (Vitis vinifera) VvPEN1 and VvMLO orthologs that rescue Arabidopsis Atpen1 and Atmlo2 mlo6 mlo12 null mutants, respectively. By using endomembrane trafficking inhibitors in combination with fluorescence microscopy, we demonstrate that VvMLO3/VvMLO4 and VvPEN1 are co-trafficked together from the PM to the site of powdery mildew challenge. This focal accumulation of VvMLO3/VvMLO4 and VvPEN1 to the site of attack seems to be required for their opposing functions during powdery mildew attack, because their subcellular localization is correlated with the outcome of attempted powdery mildew penetration.
The immunological effect of revaccination with Bacille Calmette-Guérin vaccine at 19 months of age
DEFF Research Database (Denmark)
Andersen, Andreas; Roth, Adam; Jensen, Kristoffer Jarlov
2013-01-01
Bacille Calmette-Guérin (BCG) vaccination has important non-specific immune effects. In a randomized trial in Guinea-Bissau, BCG revaccination was associated with significantly increased survival in children who received diphtheria-tetanus-pertussis (DTP)-booster vaccine before enrolment and in c...... and in children who did not receive micronutrient supplementation (MN). Within the trial we assessed the immunological effects of BCG revaccination....
Brouwer, Albert; Brown, David; Tomuta, Elena
2017-04-01
To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.
Increased sediment loading to reservoirs and, ultimately, to Guánica Bay and reef areas is a significant concern in Puerto Rico. Sediment deposition has significantly reduced storage capacity of reservoirs, and sediment-attached contaminants can stress corals and negative...
Reaction of calves to two flooring materials offered simultaneously in one pen.
Stefanowska, J.; Swierstra, D.; Smits, A.C.; Berg, van den J.V.; Metz, J.H.M.
2002-01-01
Now that group housing is replacing individual crates, so that calves can lie, stand and walk on the pen floor, the quality of the floor for group-housed calves has become the focus of attention. The reaction of two groups of four calves to a double area of floor made from two materials (wooden
Een nieuw voersysteem voor versgras : Netwerk: Vers en veilig in de pens
Philipsen, A.P.; Duinkerken, van G.
2006-01-01
De melkveehouders binnen het netwerk 'Vers en veilig in de pens' staan voor het voeren van vers gras, willen dat graag blijven doen, maar willen liever niet twee maal per dag hoeven te voeren. Daarvoor moet het gras wel langer vers blijven. Nu kan het met een halve dag al warm worden door broei. Het
Directory of Open Access Journals (Sweden)
John Jairo Zuleta Tobón
2008-11-01
Full Text Available INTRODUCCIÓN: la implementación de guías de manejo como apoyo al equipo médico optimiza los recursos y disminuye las complicaciones en el tratamiento de pacientes con una enfermedad determinada. Aunque las guías se conocen y se elaboran en todo el mundo, su uso es discutible, la adherencia es variable y el impacto depende de la adherencia. Su uso se ha extendido mundialmente, por lo que existen guías para diferentes enfermedades, las cuales han sido analizadas desde diversos puntos de su desarrollo, incluyendo el soporte de la evidencia existente, la adherencia dentro de los servicios de salud y, por último, el impacto de su uso sobre la morbilidad y la mortalidad en un grupo específico de la población. El Hospital Universitario San Vicente de Paúl diseñó su primera Guía de Manejo del Síndrome Hipertensivo asociado al embarazo hace 20 años y su última actualización fue en agosto de 2005. Este síndrome continúa siendo una de las principales causas de morbilidad y mortalidad maternas tanto local como nacionalmente, con indicadores superiores a los de otros países, y comparándolo con países con igual desarrollo económico, razón por la cual es pertinente contar con esta guía en las instituciones de nuestro país, como una herramienta para el cumplimiento de las metas planteadas por el Ministerio de Protección Social para la disminución de la morbilidad y mortalidad maternas. Sin embargo, esta guía no ha sido objeto de análisis. Para medir su impacto sobre los indicadores, es imprescindible conocer primero la adherencia a las recomendaciones de la guía. En un segundo paso podrá corroborarse el efecto que tienen las recomendaciones sobre la evolución de la enfermedad. OBJETIVO: evaluar la adherencia a las recomendaciones de la Guía de Manejo del Sindrome Hipertensivo Asociado a la Gestación del Hospital Universitario San Vicente de Paúl. MATERIALES Y MÉTODOS: estudio descriptivo, retrospectivo. CONTEXTO: Hospital
Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan
Directory of Open Access Journals (Sweden)
Stefania Travagnin
2006-01-01
Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.
Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome
International Nuclear Information System (INIS)
Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.
1984-01-01
A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)
arXiv Search for new physics with the SHiP experiment at CERN
Lantwin, Oliver
2017-12-01
SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...
Electron Cooling of Protons in a Nested Penning Trap
International Nuclear Information System (INIS)
Hall, D.S.; Gabrielse, G.
1996-01-01
Trapped protons cool via collisions with trapped electrons at 4 K.This first demonstration of sympathetic cooling by trapped species of opposite sign of charge utilizes a nested Penning trap. The demonstrated interaction of electrons and protons at very low relative velocities, where recombination is predicted to be most rapid, indicates that this may be a route towards the study of low temperature recombination. The production of cold antihydrogen is of particular interest, and electron cooling of highly stripped ions may also be possible. copyright 1996 The American Physical Society
Proportional counter with uniform electric field with Penning's mixture
International Nuclear Information System (INIS)
Pawlowski, Z.; Marzec, J.; Zaremba, K.
1984-01-01
Some calculations are given and the design of proportional counters with a homogeneous electric field filled with Penning's mixtures, which ensure the best energy resolution is described. The counters with mixtures of Ne+Ar, Ne+CH 4 , Ne+CO 2 and Ar+C 2 H 2 have been checked. The admixtures (Ar, CH 4 , CO 2 , C 2 H 2 ) constitute from 0.1 to 2%, with pressure from 125 Tr to 760 Torr. The best energy resolution has been obtained for the mixture of Ne+1%CH 4 at the pressure of 190 Torr
No between-pen transmission of foot-and-mouth disease virus in vaccinated pigs
Roermund, van H.J.W.; Eblé, P.L.; Jong, de M.C.M.; Dekker, A.
2010-01-01
Many studies have shown transmission of foot-and-mouth disease virus (FMDV) within groups of pigs, even when vaccinated, but only limited information is available on transmission between pens. Three new experiments were carried out in two replicates, which consisted of infectious pigs housed in a
Fiber supercapacitors utilizing pen ink for flexible/wearable energy storage.
Fu, Yongping; Cai, Xin; Wu, Hongwei; Lv, Zhibin; Hou, Shaocong; Peng, Ming; Yu, Xiao; Zou, Dechun
2012-11-08
A novel type of flexible fiber/wearable supercapacitor that is composed of two fiber electrodes - a helical spacer wire and an electrolyte - is demonstrated. In the carbon-based fiber supercapacitor (FSC), which has high capacitance performance, commercial pen ink is directly utilized as the electrochemical material. FSCs have potential benefits in the pursuit of low-cost, large-scale, and efficient flexible/wearable energy storage systems. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Fiber supercapacitors utilizing pen ink for flexible/wearable energy storage
Energy Technology Data Exchange (ETDEWEB)
Fu, Yongping; Cai, Xin; Wu, Hongwei; Lv, Zhibin; Hou, Shaocong; Peng, Ming; Yu, Xiao; Zou, Dechun [Beijing National Laboratory for Molecular Sciences, Key Laboratory of Polymer Chemistry and Physics of the Ministry of Education, College of Chemistry and Molecular Engineering, Peking University, Beijing (China)
2012-11-08
A novel type of flexible fiber/wearable supercapacitor that is composed of two fiber electrodes - a helical spacer wire and an electrolyte - is demonstrated. In the carbon-based fiber supercapacitor (FSC), which has high capacitance performance, commercial pen ink is directly utilized as the electrochemical material. FSCs have potential benefits in the pursuit of low-cost, large-scale, and efficient flexible/wearable energy storage systems. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Confirmation of a second EPR to be built at Penly
International Nuclear Information System (INIS)
Anon.
2009-01-01
The French government has made public its decision to launch the construction of a second EPR in France. This EPR is planned to be built on the Penly site (northern region of France). EDF will manage this project but other investors like GDF-Suez are invited to participate. The construction works are planned to begin in 2012 for a commissioning in 2017. This reactor will be the fifth EPR being built in the world. (A.C.)
Directory of Open Access Journals (Sweden)
C Beleño Agudelo
2015-01-01
Conclusión: se llegó al punto que a mayor nivel académico mayor conocimiento de las guías de práctica clínica y que como barreras se encuentran la falta de tiempo y falta de difusión de las guías.
Commissioning of the double Penning trap system MLLTRAP
International Nuclear Information System (INIS)
Kolhinen, V.S.; Bussmann, M.; Gartzke, E.; Habs, D.; Neumayr, J.B.; Schuermann, C.; Szerypo, J.; Thirolf, P.G.
2009-01-01
A cylindrical double Penning trap system has been installed and commissioned at the Maier-Leibnitz-Laboratory (MLL) in Garching. This trap system has been designed to isobarically purify low-energy ion beams and perform highly accurate mass measurements. Technical details of the device and the first results of the commissioning measurements will be presented. The mass resolving power achieved in the first trap for 85 Rb ions is R=139(2)x10 3 , while a relative mass uncertainty of δm/m=2.9x10 -8 was reached with the second trap (no analysis of systematic uncertainties included) when using 87 Rb as a reference ion for 85 Rb.
The Ramsey method in high-precision mass spectrometry with Penning traps Experimental results
George, S; Herfurth, F; Herlert, A; Kretzschmar, M; Nagy, S; Schwarz, S; Schweikhard, L; Yazidjian, C
2007-01-01
The highest precision in direct mass measurements is obtained with Penning trap mass spectrometry. Most experiments use the interconversion of the magnetron and cyclotron motional modes of the stored ion due to excitation by external radiofrequency-quadrupole fields. In this work a new excitation scheme, Ramsey's method of time-separated oscillatory fields, has been successfully tested. It has been shown to reduce significantly the uncertainty in the determination of the cyclotron frequency and thus of the ion mass of interest. The theoretical description of the ion motion excited with Ramsey's method in a Penning trap and subsequently the calculation of the resonance line shapes for different excitation times, pulse structures, and detunings of the quadrupole field has been carried out in a quantum mechanical framework and is discussed in detail in the preceding article in this journal by M. Kretzschmar. Here, the new excitation technique has been applied with the ISOLTRAP mass spectrometer at ISOLDE/CERN fo...
Papageorgiou, George Z; Tsanaktsis, Vasilios; Bikiaris, Dimitrios N
2014-05-07
Poly(ethylene-2,5-furandicarboxylate) (PEF) is a new alipharomatic polyester that can be prepared from monomers derived from renewable resources like furfural and hydroxymethylfurfural. For this reason it has gained high interest recently. In the present work it was synthesized from the dimethylester of 2,5-furandicarboxylic acid and ethylene glycol by applying the two-stage melt polycondensation method. The thermal behavior of PEF was studied in comparison to its terephthalate and naphthalate homologues poly(ethylene terephthalate) (PET) and poly(ethylene naphthalate) (PEN), which were also synthesized following the same procedure. The equilibrium melting point of PEF was found to be 265 °C while the heat of fusion for the pure crystalline PEF was estimated to be about 137 J g(-1). The crystallization kinetics was analyzed using various models. PET showed faster crystallization rates than PEN and this in turn showed faster crystallization than PEF, under both isothermal and non-isothermal conditions. The spherulitic morphology of PEF during isothermal crystallization was investigated by polarized light microscopy (PLM). A large nucleation density and a small spherulite size were observed for PEF even at low supercoolings, in contrast to PET or PEN. Thermogravimetric analysis indicated that PEF is thermally stable up to 325 °C and the temperature for the maximum degradation rate was 438 °C. These values were a little lower than those for PET or PEN.
Dimitrova, M.; Popov, Tsv K.; Adamek, J.; Kovačič, J.; Ivanova, P.; Hasan, E.; López-Bruna, D.; Seidl, J.; Vondráček, P.; Dejarnac, R.; Stöckel, J.; Imríšek, M.; Panek, R.; the COMPASS Team
2017-12-01
The radial distributions of the main plasma parameters in the scrape-off-layer of the COMPASS tokamak are measured during L-mode and H-mode regimes by using both Langmuir and ball-pen probes mounted on a horizontal reciprocating manipulator. The radial profile of the plasma potential derived previously from Langmuir probes data by using the first derivative probe technique is compared with data derived using ball-pen probes. A good agreement can be seen between the data acquired by the two techniques during the L-mode discharge and during the H-mode regime within the inter-ELM periods. In contrast with the first derivative probe technique, the ball-pen probe technique does not require a swept voltage and, therefore, the temporal resolution is only limited by the data acquisition system. In the electron temperature evaluation, in the far scrape-off layer and in the limiter shadow, where the electron energy distribution is Maxwellian, the results from both techniques match well. In the vicinity of the last closed flux surface, where the electron energy distribution function is bi-Maxwellian, the ball-pen probe technique results are in agreement with the high-temperature components of the electron distribution only. We also discuss the application of relatively large Langmuir probes placed in parallel and perpendicularly to the magnetic field lines to studying the main plasma parameters. The results obtained by the two types of the large probes agree well. They are compared with Thomson scattering data for electron temperatures and densities. The results for the electron densities are compared also with the results from ASTRA code calculation of the electron source due to the ionization of the neutrals by fast electrons and the origin of the bi-Maxwellian electron energy distribution function is briefly discussed.
Los líderes en las empresas como guías del conocimiento.
Directory of Open Access Journals (Sweden)
Jorge Pila Prieto
2006-03-01
Full Text Available Nuestro trabajo realiza una reflexión sobre la función del Líder en cualquier empresa o centro de estudios en el cual se tomen sus aspectos mas especifico para cualquier directivo, sirviendo de guía al resto de sus trabajadores, de esta forma puede servir a cualquier problema presentado en cualquier lugar y desarrollar un clima laboral y organizacional en la empresa y porque no en el aula donde los docentes interpreten este trabajo y sientan, ante todo realizar los cambios que tanto se solicitan para un perfeccionamiento tanto empresarial como de la dirección del proceso docente-educativo.
The Pen Branch Project: Restoration of a Forested Wetland in South Carolina
Randall K. Kolka; Eric A. Nelson; Ronald E. Bonar; Neil C. Dulohery; David Gartner
1998-01-01
The Pen Branch Project is a program to restore a forested riparian wetland that has been subject to thermal disturbance caused by nuclear reactor operations at the Department of Energy's (DOE) Savannah River Site (SRS), an 80,200-hectare nuclear facility located in South Carolina. Various levels of thermal discharges to streams located across the US. have occurred...
Random Walk Model for the Growth of Monolayer in Dip Pen Nanolithography
International Nuclear Information System (INIS)
Kim, H; Ha, S; Jang, J
2013-01-01
By using a simple random-walk model, we simulate the growth of a self-assembled monolayer (SAM) pattern generated in dip pen nanolithography (DPN). In this model, the SAM pattern grows mainly via the serial pushing of molecules deposited from the tip. We examine various SAM patterns, such as lines, crosses, and letters by changing the tip scan speed.
Directory of Open Access Journals (Sweden)
Anang Kristianto
2012-11-01
Full Text Available One of the important requirements for earthquake resistant building related to confinement is the use of seismic hooks in the hoop or confining reinforcement of reinforced-concrete column elements. However, installation of a confining reinforcement with a 135-degree hook is not easy. Therefore, in practice, many construction workers apply a confining reinforcement with a 90-degreehook (non-code compliant. Based on research and records of recent earthquakes in Indonesia, the use of a non-code compliant confining reinforcement for concrete columns produces structures with poor seismic performance. This paper presents a study that introduces an additional element that is expected to improve the effectiveness of concrete columns confined with a non-code compliant confining reinforcement. The additional element, named a pen-binder, is used to keep the non-code compliant confining reinforcement in place. The effectiveness of this element under pure axial concentric loading was investigatedcomprehensively.The specimens tested in this study were 18 concrete columns,with a cross-section of 170 mm x 170 mm and a height of 480 mm. The main test variables were the material type of the pen-binder, the angle of the hook, and the confining reinforcement configuration.The test results indicate that adding pen-binders can effectively improve the strength and ductility of the column specimens confined with a non-code compliant confining reinforcement
Paaver, Ene, 1963-
2001-01-01
Rahvusvaheline festival "Talveöö unenägu" Tallinna Linnateatris 28.- 30. dets. Lavastused : "K. I. Kuritööst" (lav. Kama Ginkas, Moskva Noorsooteater), "Gargantua ja Pantagruel" (lav. Stanislavas Rubinovas, Kaunase Noorsooteater), "Preili Pollinger" (lav. Edith Koerber, Saksa Tri-Bühne), "Rusudekorjajad" (lav. Nika Brettschneider, Viini Brett Theater)
Escobar Duque, Iván Dario; Fundación Colombiana de Obesidad
2017-01-01
Objetivo: Generar recomendaciones para la prevención del sobrepeso y la obesidad en niños, adolescentes y adultos, así como el manejo del sobrepeso y la obesidad en la población adulta, Materiales y métodos: Se conformó el Grupo Desarrollador de la Guía (GDG) con un grupo interdisciplinario de profesionales y representantes de pacientes. Se definieron alcance, objetivos, preguntas y desenlaces de la guía. Se realizó una búsqueda de literatura de revisiones sistemáticas-metanálisis, ensayos cl...
Energy Technology Data Exchange (ETDEWEB)
Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)
2014-02-25
Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.
Design of a high field uniformity electromagnet for Penning trap
International Nuclear Information System (INIS)
Itteera, Janvin; Singh, Kumud; Teotia, Vikas; Ukarde, Priti; Malhotra, Sanjay; Taly, Y.K.; Joshi, Manoj; Rao, Pushpa
2013-01-01
An ion trap (Penning trap) facility is being developed at BARC for spectroscopy studies. This requires the design of an iron core electromagnet capable of generating high magnetic fields (∼1.7T) at the centre of an 88 mm long air gap. This electromagnet provides the requisite dipole magnetic field which when superimposed on the electrostatic quadrupoles ensures a stable trapping of ions. To conduct high precision spectroscopy studies, we need to ensure a high degree of magnetic field uniformity ( 3 volume (Trap zone). Various pole shoe profiles were studied and modelled, FEM simulation of the same were conducted to compute the magnetic field intensity and field uniformity. Owing to the large air gap and requirement of high field intensity in the GFR, the exciting coils need to handle high current densities, which require water cooled systems. Double Pan-Cake coil design is selected for powering the magnet. Electrical, thermal and hydraulic designs of the coils are completed and a prototype double pancake coil was fabricated and tested for verifying the electrical and thermal parameter. The spatial field homogeneity is achieved by shimming the pole tip. Temporal stability of magnet requires a highly stable power supply for exciting the coils and its stability class is derived from FEM simulations. This paper discusses the electromagnetic design and development of the penning trap magnet being developed at BARC. (author)
Development of hollow anode penning ion source for laboratory application
Energy Technology Data Exchange (ETDEWEB)
Das, B.K., E-mail: dasbabu31@gmail.com [Energetics and Electromagnetics Division, Bhabha Atomic Research Centre, Autonagar, Visakhapatnam (India); Shyam, A.; Das, R. [Energetics and Electromagnetics Division, Bhabha Atomic Research Centre, Autonagar, Visakhapatnam (India); Rao, A.D.P. [Department of Nuclear Physics, Andhra University, Visakhapatnam (India)
2012-03-21
The research work presented here focuses for the development of miniature penning type ion source. One hollow anode penning type ion source was developed in our laboratory. The size of the ion source is 38 mm diameter and 55 mm length. The ion source consists of two cathodes, a hollow anode and one piece of rare earth permanent magnet. The plasma was created in the plasma region between cathodes and the hollow anode. The J Multiplication-Sign B force in the region helps for efficient ionization of the gas even in the high vacuum region{approx}1 Multiplication-Sign 10{sup -5} Torr. The ions were extracted in the axial direction with help of the potential difference between the electrodes and the geometry of the extraction angle. The effect of the extraction electrode geometry for efficient extraction of the ions from the plasma region was examined. This ion source is a self extracted ion source. The self extracted phenomena reduce the cost and the size of the ion source. The extracted ion current was measured by a graphite probe. An ion current of more than 200 {mu}A was observed at the probe placed 70 mm apart from the extraction electrode. In this paper, the structure of the ion source, effect of operating pressure, potential difference and the magnetic field on the extracted ion current is reported.
Shanthi, S; Vaseeharan, B
2012-03-20
A new member of antimicrobial peptide genes of the penaeidin family, penaeidin 3, was cloned from the haemocytes of Indian white shrimp Fenneropeneaus indicus (F. indicus), by reverse transcription PCR (RT-PCR) and rapid amplification of cDNA end (RACE-PCR) methods. The complete nucleotide sequence of cDNA clone of Indian white shrimp F. indicus Penaeidin 3 (Fi-Pen3) was 243bp long and has an open reading frame which encodes 80 amino acid peptide. The homology analysis of Fi-Pen3 sequence with other Penaeidins 3 shows higher similarity with Penaeus monodon (92%). The theoretical 3D structure generated through ab initio modelling indicated the presence of two-disulphide bridges in the alpha-helix. The signal peptide sequence of Fi-Pen3 is almost entirely homologous to that of other Penaeidin 3 of crustaceans, while differing relatively in the N-terminal domain of the mature peptide. The mature peptide has a predicted molecular weight of 84.9kDa, and a theoretical pI of 9.38. Phylogenetic analysis of Fi-Pen3 shows high resemblance with other Pen-3 from P. monodon, Litopenaeus stylirostris, Litopenaeus vannamei and Litopenaeus setiferus. Fi-Pen3 found to be expressed in haemocytes, heart, hepatopancreas, muscles, gills, intestine, and eyestalk with higher expression in haemocytes. Microbial challenge resulted in mRNA up-regulation, up to 6h post injection of Vibrio parahemolyticus. The Fi-Pen3 mRNA expression of F. indicus in the premolt stage (D(01) and D(02)) was significantly up-regulated than the postmolt (A and B) and intermolt stages (C). The findings of the present paper underline the involvement of Fi-Pen3 in innate immune system of F. indicus. Copyright © 2011 Elsevier GmbH. All rights reserved.
Redshaw, M.; Barquest, B. R.; Bollen, G.; Bustabad, S. E.; Campbell, C. M.; Ferrer, R.; Gehring, A.; Kwiatkowski, A. A.; Lincoln, D. L.; Morrissey, D. J.; Pang, G. K.; Ringle, R.; Schwarz, S.
2011-07-01
The LEBIT (Low Energy Beam and Ion Trap) facility is the only Penning trap mass spectrometry (PTMS) facility to utilize rare isotopes produced via fast-beam fragmentation. This technique allows access to practically all elements lighter than uranium, and in particular enables the production of isotopes that are not available or that are difficult to obtain at isotope separation on-line facilities. The preparation of the high-energy rare-isotope beam produced by projectile fragmentation for low-energy PTMS experiments is achieved by gas stopping to slow down and thermalize the fast-beam ions, along with an rf quadrupole cooler and buncher and rf quadrupole ion guides to deliver the beam to the Penning trap. During its first phase of operation LEBIT has been very successful, and new developments are now underway to access rare isotopes even farther from stability, which requires dealing with extremely short lifetimes and low production rates. These developments aim at increasing delivery efficiency, minimizing delivery and measurement time, and maximizing use of available beam time. They include an upgrade to the gas-stopping station, active magnetic field monitoring and stabilization by employing a miniature Penning trap as a magnetometer, the use of stored waveform inverse Fourier transform (SWIFT) to most effectively remove unwanted ions, and charge breeding.
International Nuclear Information System (INIS)
Redshaw, M.; Barquest, B. R.; Bollen, G.; Bustabad, S. E.; Campbell, C. M.; Ferrer, R.; Gehring, A.; Kwiatkowski, A. A.; Lincoln, D. L.; Morrissey, D. J.; Pang, G. K.; Ringle, R.; Schwarz, S.
2011-01-01
The LEBIT (Low Energy Beam and Ion Trap) facility is the only Penning trap mass spectrometry (PTMS) facility to utilize rare isotopes produced via fast-beam fragmentation. This technique allows access to practically all elements lighter than uranium, and in particular enables the production of isotopes that are not available or that are difficult to obtain at isotope separation on-line facilities. The preparation of the high-energy rare-isotope beam produced by projectile fragmentation for low-energy PTMS experiments is achieved by gas stopping to slow down and thermalize the fast-beam ions, along with an rf quadrupole cooler and buncher and rf quadrupole ion guides to deliver the beam to the Penning trap. During its first phase of operation LEBIT has been very successful, and new developments are now underway to access rare isotopes even farther from stability, which requires dealing with extremely short lifetimes and low production rates. These developments aim at increasing delivery efficiency, minimizing delivery and measurement time, and maximizing use of available beam time. They include an upgrade to the gas-stopping station, active magnetic field monitoring and stabilization by employing a miniature Penning trap as a magnetometer, the use of stored waveform inverse Fourier transform (SWIFT) to most effectively remove unwanted ions, and charge breeding.
Sonia Socarrás Sánchez; Martha Díaz Flores; Antonio Sáez Palmero
2012-01-01
El Profesor Guía en la universidad cubana y en particular en la educación médica superior desempeña un rol fundamental en el proceso de formación integral del futuro profesional. Para lograr este propósito debe cumplir con sus direcciones de trabajo y funciones, las cuales se abordan en este artículo. Se incorporan nuevas categorías como es la definición de la labor educativa de los profesores guías de la carrera de Medicina, la redefinición de Profesor Guía y se proponen nuevas funciones que...
Bacillus Calmette-Guérin vaccination, thymic size, and thymic output in healthy newborns
DEFF Research Database (Denmark)
Birk, Nina Marie; Nissen, Thomas Nørrelykke; Zingmark, Vera
2017-01-01
Background: The Bacillus Calmette-Guérin vaccine (BCG) has been associated with beneficial nonspecific effects on infant health. We aimed to examine the effect of BCG at birth on thymic size and the associations between thymic output, circulating lymphocytes, risk of infection, and thymic size...... with a large thymic size at birth. Conclusion: We found no effect of BCG vaccination on thymic size. The positive association between thymic output, lymphocytes, reduced risk of infections, and TI/TWI suggests that assessment of TI/TWI by ultrasound may be a predictor of the immunological capacity...... in the newborn....
Vincent, Leah R; Kerr, Samuel R; Tan, Yang; Tomberg, Joshua; Raterman, Erica L; Dunning Hotopp, Julie C; Unemo, Magnus; Nicholas, Robert A; Jerse, Ann E
2018-04-03
Resistance to ceftriaxone in Neisseria gonorrhoeae is mainly conferred by mosaic penA alleles that encode penicillin-binding protein 2 (PBP2) variants with markedly lower rates of acylation by ceftriaxone. To assess the impact of these mosaic penA alleles on gonococcal fitness, we introduced the mosaic penA alleles from two ceftriaxone-resistant (Cro r ) clinical isolates (H041 and F89) into a Cro s strain (FA19) by allelic exchange and showed that the resultant Cro r mutants were significantly outcompeted by the Cro s parent strain in vitro and in a murine infection model. Four Cro r compensatory mutants of FA19 penA41 were isolated independently from mice that outcompeted the parent strain both in vitro and in vivo One of these compensatory mutants (LV41C) displayed a unique growth profile, with rapid log growth followed by a sharp plateau/gradual decline at stationary phase. Genome sequencing of LV41C revealed a mutation (G348D) in the acnB gene encoding the bifunctional aconitate hydratase 2/2 methylisocitrate dehydratase. Introduction of the acnB G348D allele into FA19 penA41 conferred both a growth profile that phenocopied that of LV41C and a fitness advantage, although not as strongly as that exhibited by the original compensatory mutant, suggesting the existence of additional compensatory mutations. The mutant aconitase appears to be a functional knockout with lower activity and expression than wild-type aconitase. Transcriptome sequencing (RNA-seq) analysis of FA19 penA41 acnB G348D revealed a large set of upregulated genes involved in carbon and energy metabolism. We conclude that compensatory mutations can be selected in Cro r gonococcal strains that increase metabolism to ameliorate their fitness deficit. IMPORTANCE The emergence of ceftriaxone-resistant (Cro r ) Neisseria gonorrhoeae has led to the looming threat of untreatable gonorrhea. Whether Cro resistance is likely to spread can be predicted from studies that compare the relative fitnesses of
El área transdisciplinar en las guías docentes
Directory of Open Access Journals (Sweden)
Carmen Moral Ruíz
2016-11-01
Full Text Available La educación artística sufre una fuerte devaluación, patente en los numerosos cambios legislativos cuya importancia es poco relevante. Se podrían recoger numerosos ejemplos que, a lo largo de la historia, han tomado como base el arte en correlación con la ciencia para el desarrollo del ser humano, comprobándose su importancia y su fuerte relación con el resto de disciplinas que ahora se muestran como principales. Comprender las consecuencias de esta devaluación y proponer una mayor transdisciplinariedad a través de las guías docentes, sería el fin de esta investigación para promover una menor separación de los contenidos en las materias, dando lugar al incremento del aprendizaje significativo, relacionado en mayor medida con la sociedad en la que vivimos, preparando al alumnado para vivir en sociedad y desarrollando todo su potencial creativo.
The mechanical design and simulation of a scaled H⁻ Penning ion source.
Rutter, T; Faircloth, D; Turner, D; Lawrie, S
2016-02-01
The existing ISIS Penning H(-) source is unable to produce the beam parameters required for the front end test stand and so a new, high duty factor, high brightness scaled source is being developed. This paper details first the development of an electrically biased aperture plate for the existing ISIS source and second, the design, simulation, and development of a prototype scaled source.
The mechanical design and simulation of a scaled H- Penning ion source
Rutter, T.; Faircloth, D.; Turner, D.; Lawrie, S.
2016-02-01
The existing ISIS Penning H- source is unable to produce the beam parameters required for the front end test stand and so a new, high duty factor, high brightness scaled source is being developed. This paper details first the development of an electrically biased aperture plate for the existing ISIS source and second, the design, simulation, and development of a prototype scaled source.
Directory of Open Access Journals (Sweden)
Sonia Socarrás Sánchez
2011-08-01
Full Text Available Existe una insuficiente preparación teórico-metodológica de los profesores guías para el desempeño de su trabajo educativo, por lo que se requiere perfeccionar su labor. En este artículo se aborda la sistematización de los aspectos teóricos relacionados con el trabajo educativo en la universidad cubana, específicamente la médica. Se incorporan nuevas categorías: concepto de profesor guía y tarjetero metodológico. Se redefinen los conceptos de trabajo educativo y proyecto educativo del colectivo estudiantil. Se establecen, además, las exigencias metodológicas para la dirección por parte de los profesores guías de la labor educativa.There is an inadequate theoretical-methodological preparation of tutoring professors to carry out educational work. This paper deals with the systematization of theoretical aspects related to educational work at the Cuban university, specifically medical universities. New categories are incorporated: concept of tutoring professor and methodological card index. Other concepts are re-defined: educational work and class´s educational project. In addition, the methodological requirements to direct tutoring professors´ educational work are established.
Experiments with Highly-Ionized Atoms in Unitary Penning Traps
Directory of Open Access Journals (Sweden)
Shannon Fogwell Hoogerheide
2015-08-01
Full Text Available Highly-ionized atoms with special properties have been proposed for interesting applications, including potential candidates for a new generation of optical atomic clocks at the one part in 1019 level of precision, quantum information processing and tests of fundamental theory. The proposed atomic systems are largely unexplored. Recent developments at NIST are described, including the isolation of highly-ionized atoms at low energy in unitary Penning traps and the use of these traps for the precise measurement of radiative decay lifetimes (demonstrated with a forbidden transition in Kr17+, as well as for studying electron capture processes.
Commissioning of the double Penning trap system MLLTRAP
Energy Technology Data Exchange (ETDEWEB)
Kolhinen, V.S. [Fakultaet fuer Physik, LMU Muenchen and Maier-Leibnitz Laboratory, Am Coulombwall 1, 85748 Garching (Germany)], E-mail: veli.kolhinen@physik.uni-muenchen.de; Bussmann, M. [Fakultaet fuer Physik, LMU Muenchen and Maier-Leibnitz Laboratory, Am Coulombwall 1, 85748 Garching (Germany); Forschungszentrum Dresden-Rossendorf, 01314 Dresden (Germany); Gartzke, E.; Habs, D.; Neumayr, J.B.; Schuermann, C.; Szerypo, J.; Thirolf, P.G. [Fakultaet fuer Physik, LMU Muenchen and Maier-Leibnitz Laboratory, Am Coulombwall 1, 85748 Garching (Germany)
2009-03-01
A cylindrical double Penning trap system has been installed and commissioned at the Maier-Leibnitz-Laboratory (MLL) in Garching. This trap system has been designed to isobarically purify low-energy ion beams and perform highly accurate mass measurements. Technical details of the device and the first results of the commissioning measurements will be presented. The mass resolving power achieved in the first trap for {sup 85}Rb ions is R=139(2)x10{sup 3}, while a relative mass uncertainty of {delta}m/m=2.9x10{sup -8} was reached with the second trap (no analysis of systematic uncertainties included) when using {sup 87}Rb as a reference ion for {sup 85}Rb.
Directory of Open Access Journals (Sweden)
Poonam Zham
2017-09-01
Full Text Available The speed and pen-pressure while sketching a spiral are lower among Parkinson’s disease (PD patients with higher severity of the disease. However, the correlation between these features and the severity level (SL of PD has been reported to be 0.4. There is a need for identifying parameters with a stronger correlation for considering this for accurate diagnosis of the disease. This study has proposed the use of the Composite Index of Speed and Pen-pressure (CISP of sketching as a feature for analyzing the severity of PD. A total of 28 control group (CG and 27 PD patients (total 55 participants were recruited and assessed for Unified Parkinson’s Disease Rating Scale (UPDRS. They drew guided Archimedean spiral on an A3 sheet. Speed, pen-pressure, and CISP were computed and analyzed to obtain their correlation with severity of the disease. The correlation of speed, pen-pressure, and CISP with the severity of PD was −0.415, −0.584, and −0.641, respectively. Mann–Whitney U test confirmed that CISP was suitable to distinguish between PD and CG, while non-parametric k-sample Kruskal–Wallis test confirmed that it was significantly different for PD SL-1 and PD SL-3. This shows that CISP during spiral sketching may be used to differentiate between CG and PD and between PD SL-1 and PD SL-3 but not SL-2.
Propuesta para el diseño de una guía didáctica en la disciplina Bioquímica
Directory of Open Access Journals (Sweden)
Pedro Luis Bravo Hernández
2017-01-01
Conclusiones: Se obtuvo una guía didáctica con un enfoque sistemático donde el profesor va dosificando actividades docentes teniendo en cuenta los estilos de aprendizaje del grupo y dejando claro las condiciones de estudio y la ruta crítica para la revisión bibliográfica.
Wülbers-Mindermann, M; Berg, C; Illmann, G; Baulain, U; Algers, B
2015-04-01
Outdoor farrowing huts facilitate a less restricted maternal behaviour in sows compared with sows kept indoors in farrowing pens. The aim of our study was to investigate whether there are behavioural differences between primiparous sows kept outdoors in farrowing huts and indoors in pens, and whether the maternal behaviour during the second parity, when all sows were kept outdoors in farrowing huts, would differ between sows that have experienced the indoor or the outdoor environment, respectively, during their first parturition. A total of 26 Yorkshire×Swedish Landrace sows were studied. Of these, 11 sows were housed outdoors in farrowing huts during both parturitions (group=OUTOUT). The other 15 sows were kept indoors in a barn with single farrowing pens during their first parturition. During their second parturition, sows were kept outdoors in farrowing huts (group=INOUT). The behaviour was video recorded from 2 h prepartum to 48 h postpartum. The sows' responsiveness to playbacks of a piglet's screams was tested on days 2 to 3 postpartum. Parity 1: during the last 2 h prepartum, OUTOUT sows had a higher proportion of observations in the sternal lying position (Pbehavioural differences between INOUT and OUTOUT sows. In conclusion, it is not problematic for a second parity sow with initial maternal experience from an indoor farrowing pen to be kept outdoors in farrowing huts during its following farrowing.
Gesture language use in natural UI: pen-based sketching in conceptual design
Ma, Cuixia; Dai, Guozhong
2003-04-01
Natural User Interface is one of the important next generation interactions. Computers are not just the tools of many special people or areas but for most people. Ubiquitous computing makes the world magic and more comfortable. In the design domain, current systems, which need the detail information, cannot conveniently support the conceptual design of the early phrase. Pen and paper are the natural and simple tools to use in our daily life, especially in design domain. Gestures are the useful and natural mode in the interaction of pen-based. In natural UI, gestures can be introduced and used through the similar mode to the existing resources in interaction. But the gestures always are defined beforehand without the users' intention and recognized to represent something in certain applications without being transplanted to others. We provide the gesture description language (GDL) to try to cite the useful gestures to the applications conveniently. It can be used in terms of the independent control resource such as menus or icons in applications. So we give the idea from two perspectives: one from the application-dependent point of view and the other from the application-independent point of view.
Directory of Open Access Journals (Sweden)
Tzu-Wen Liang
2015-07-01
Full Text Available The aim of this work was to produce chitosanase by fermenting from squid pen, and recover the fermented squid pen for dye removal by adsorption. One chitosanase induced from squid pen powder (SPP-containing medium by Bacillus cereus TKU034 was purified in high purification fold (441 and high yield of activity recovery (51% by ammonium sulfate precipitation and combined column chromatography. The SDS-PAGE results showed its molecular mass to be around 43 kDa. The TKU034 chitosanase used for the chitooligomers preparation was studied. The enzyme products revealed that the chitosanase could degrade chitosan with various degrees of polymerization, ranging from 3 to 9, as well as the chitosanase in an endolytic manner. Besides, the fermented SPP was recovered and displayed a better adsorption rate (up to 99.5% for the disperse dyes (red, yellow, blue, and black than the water-soluble food colorants, Allura Red AC (R40 and Tartrazine (Y4. The adsorbed R40 on the unfermented SPP and the fermented SPP was eluted by distilled water and 1 M NaOH to confirm the dye adsorption mechanism. The fermented SPP had a slightly higher adsorption capacity than the unfermented, and elution of the dye from the fermented SPP was easier than from the unfermented. The main dye adsorption mechanism of fermented SPP was physical adsorption, while the adsorption mechanism of unfermented SPP was chemical adsorption.
Liang, Tzu-Wen; Lo, Bo-Chang; Wang, San-Lang
2015-07-23
The aim of this work was to produce chitosanase by fermenting from squid pen, and recover the fermented squid pen for dye removal by adsorption. One chitosanase induced from squid pen powder (SPP)-containing medium by Bacillus cereus TKU034 was purified in high purification fold (441) and high yield of activity recovery (51%) by ammonium sulfate precipitation and combined column chromatography. The SDS-PAGE results showed its molecular mass to be around 43 kDa. The TKU034 chitosanase used for the chitooligomers preparation was studied. The enzyme products revealed that the chitosanase could degrade chitosan with various degrees of polymerization, ranging from 3 to 9, as well as the chitosanase in an endolytic manner. Besides, the fermented SPP was recovered and displayed a better adsorption rate (up to 99.5%) for the disperse dyes (red, yellow, blue, and black) than the water-soluble food colorants, Allura Red AC (R40) and Tartrazine (Y4). The adsorbed R40 on the unfermented SPP and the fermented SPP was eluted by distilled water and 1 M NaOH to confirm the dye adsorption mechanism. The fermented SPP had a slightly higher adsorption capacity than the unfermented, and elution of the dye from the fermented SPP was easier than from the unfermented. The main dye adsorption mechanism of fermented SPP was physical adsorption, while the adsorption mechanism of unfermented SPP was chemical adsorption.
Liang, Tzu-Wen; Lo, Bo-Chang; Wang, San-Lang
2015-01-01
The aim of this work was to produce chitosanase by fermenting from squid pen, and recover the fermented squid pen for dye removal by adsorption. One chitosanase induced from squid pen powder (SPP)-containing medium by Bacillus cereus TKU034 was purified in high purification fold (441) and high yield of activity recovery (51%) by ammonium sulfate precipitation and combined column chromatography. The SDS-PAGE results showed its molecular mass to be around 43 kDa. The TKU034 chitosanase used for the chitooligomers preparation was studied. The enzyme products revealed that the chitosanase could degrade chitosan with various degrees of polymerization, ranging from 3 to 9, as well as the chitosanase in an endolytic manner. Besides, the fermented SPP was recovered and displayed a better adsorption rate (up to 99.5%) for the disperse dyes (red, yellow, blue, and black) than the water-soluble food colorants, Allura Red AC (R40) and Tartrazine (Y4). The adsorbed R40 on the unfermented SPP and the fermented SPP was eluted by distilled water and 1 M NaOH to confirm the dye adsorption mechanism. The fermented SPP had a slightly higher adsorption capacity than the unfermented, and elution of the dye from the fermented SPP was easier than from the unfermented. The main dye adsorption mechanism of fermented SPP was physical adsorption, while the adsorption mechanism of unfermented SPP was chemical adsorption. PMID:26213948
Ramírez-Ramírez, Fiorella; Campos-Rodríguez, Rooel; Jiménez-Morales, María Fernanda; Brenes-Peralta, Laura
2016-01-01
Tecnológico de Costa Rica has developed collaborative actions with the Guácimo local Government (Limón province, Costa Rica) through research and a doctoral thesis. As a follow-up, another research and extension project was proposed, called Establishment of vegetables home gardens using solid waste in a pilot group in the Santa María de Guácimo community. This project carried out activities like the analysis of prior sudies regarding solid waste generation and composition in the community, as...
Energy Technology Data Exchange (ETDEWEB)
Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)
2016-07-15
Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.
DEFF Research Database (Denmark)
Præstmark, Kezia Ann; Stallknecht, Bente Merete; Bo Jensen, Casper
2014-01-01
skin blood perfusion response around needle insertion sites. Three common sized pen needles of 28G, 30G, and 32G as well as hooked 32G needles, were inserted into the neck skin of pigs and then removed. Laser Speckle Contrast Analysis was used to measure skin blood perfusion for 20 minutes after...... blood perfusion recording and grouped according to needle type, skin blood perfusion response relates to needle diameter. The response was significantly higher after insertions with 28G and hooked 32G needles than with 30G (P ..., but there was a trend of an increased response with increasing needle diameter. Skin blood perfusion response to pen needle insertions rank according to needle diameter, and the tissue response caused by hooked 32G needles corresponds to that of 28G needles. The relation between needle diameter and trauma when...
[A comparison of rebound tonometry (ICare) with TonoPenXL and Goldmann applanation tonometry].
Schreiber, W; Vorwerk, C K; Langenbucher, A; Behrens-Baumann, W; Viestenz, A
2007-04-01
Goldmann applanation tonometry and dynamic contour tonometry (PASCAL) are two well established slit lamp mounted tonometric methods. Intraocular pressure measurement in bedridden patients and children is often only possible using hand held tonometers (TonoPenXL, Perkins tonometer, Draeger tonometer). This study was performed to evaluate the hand held ICare tonometer, which is based on the rebound method. A total of 102 eyes were examined by two highly experienced ophthalmologists for: 1) ophthalmological status, 2) central corneal power (Zeiss IOL-Master), 3) central corneal thickness (Tomey ultrasound pachymetry, five successive measurements, SDr=0.592-0.642; p<0.001). There was a great intra-individual variability of up to 17 mmHg between the GAT, TonoPenXL and ICare methods. The ICare tonometer is easy to handle and high reliability. The data are comparable with those from the Goldmann tonometer. A tonography effect of 0.6 mmHg in the successive measurement series was found.
Status and outlook of CHIP-TRAP: The Central Michigan University high precision Penning trap
Redshaw, M.; Bryce, R. A.; Hawks, P.; Gamage, N. D.; Hunt, C.; Kandegedara, R. M. E. B.; Ratnayake, I. S.; Sharp, L.
2016-06-01
At Central Michigan University we are developing a high-precision Penning trap mass spectrometer (CHIP-TRAP) that will focus on measurements with long-lived radioactive isotopes. CHIP-TRAP will consist of a pair of hyperbolic precision-measurement Penning traps, and a cylindrical capture/filter trap in a 12 T magnetic field. Ions will be produced by external ion sources, including a laser ablation source, and transported to the capture trap at low energies enabling ions of a given m / q ratio to be selected via their time-of-flight. In the capture trap, contaminant ions will be removed with a mass-selective rf dipole excitation and the ion of interest will be transported to the measurement traps. A phase-sensitive image charge detection technique will be used for simultaneous cyclotron frequency measurements on single ions in the two precision traps, resulting in a reduction in statistical uncertainty due to magnetic field fluctuations.
Saini, V K; Kumar, P; Dixit, S K; Nakhe, S V
2015-02-01
Laser-assisted Penning ionization (LAPI) is detected in a Ne/Eu hollow cathode (HC) discharge lamp using the pulsed optogalvanic (OG) method. In the Ne/Eu discharge, doubly ionized europium excited energy levels Eu[4f(7)(P(7/2,5/2)6)] lie within the thermal limit (∼kT) from the laser-excited neon's energy level [2p(5)(P3/202)3p or 2p(8) (in Paschen notation)] lying at 149,848 cm(-1). Therefore, Penning ionization (PI) of europium atoms likely to occur into its highly excited ionic states is investigated. To probe the PI of europium, the temporal profiles of its counterpart neon OG signal are studied as a function of discharge current for the transitions (1s(4)→2p(8)) and (1s(2)→2p(2)), corresponding to 650.65 and 659.89 nm wavelengths, respectively. It is observed that PI of europium alters the overall discharge characteristics significantly and, hence, modifies the temporal profile of the OG signals accordingly. The quasi-resonant ionizing energy transfer collisions between laser-excited Ne 2p(8) atoms and electronically excited europium P(9/2)10 atoms are used to explain the LAPI mechanism. Such LAPI studies carried out in HC discharge could be useful for the discharge of a metal-vapor laser with appropriate Penning mixtures.
International Nuclear Information System (INIS)
Ordonez, C.A.; Dolliver, D.D.; Chang Yongbin; Correa, J. R.
2002-01-01
A theoretical study is presented regarding some possibilities for achieving antihydrogen recombination and trapping using a nested Penning trap and a magnetic well. The work reported consists of a review, an extension, and applications of the relevant knowledge base. A nested Penning trap produces a magnetic field, which provides plasma confinement perpendicular to the magnetic field, and an electric field associated with a nested-well potential profile. The nested-well potential profile provides plasma confinement parallel to the magnetic field for oppositely signed plasma species that can have overlapping confinement regions. A configuration is considered in which the electric field is applied in two regions of uniform magnetic field that reside on opposite sides of a magnetic well region. The electric field confines overlapping positron and antiproton plasmas, which thread the magnetic well region. The magnetic well region would serve to trap a fraction of any antihydrogen atoms that are formed. Two different methods are considered for achieving overlap of positron and antiproton plasmas. For each, a set of conditions is predicted for achieving antihydrogen recombination and trapping. Although the study reported specifically considers simultaneous confinement of positron and antiproton plasmas in nested Penning traps, much of the information presented is also relevant to the prospect of merging other pairs of oppositely signed plasmas (e.g., electron and positron plasmas)
Directory of Open Access Journals (Sweden)
Gerda de Villiers
2013-08-01
Full Text Available ‘The pen is mightier than the sword’: Literacy and scribes in Israel during the Second Temple period. This article is divided in two parts. Part one examines scribal education and scribes in the ancient Near East and Israel. Although no real evidence exists for scribal schools and education in Israel, it is argued that some form of institutionalised training must have taken place in order to produce literary texts of such a high quality as are found in the Hebrew Bible. Comparative material from Mesopotamia serves to trace the education of scribes in general. Part two focuses on the Second Temple period in ancient Israel. Ezra the scribe emerges as a typical scribe from that era. Post-exilic Israel was grappling with its identity, and sought guidance from ַ[as was written in the Torah]. However, it appears that there were different interpretations of the written Law during this period. Scribes of the Ezra circle advocated a radical policy of exclusivity on the basis of what was written in the Law; others who wrote the texts of Trito-Isaiah and Ruth pleaded for a more inclusive attitude towards foreigners. The conclusion is that the battle was fought not with the sword, but with the pen, therefore: ‘The pen is mightier than the sword.’
Directory of Open Access Journals (Sweden)
Gerda de Villiers
2013-08-01
Full Text Available ‘The pen is mightier than the sword’: Literacy and scribes in Israel during the Second Temple period. This article is divided in two parts. Part one examines scribal education and scribes in the ancient Near East and Israel. Although no real evidence exists for scribal schools and education in Israel, it is argued that some form of institutionalised training must have taken place in order to produce literary texts of such a high quality as are found in the Hebrew Bible. Comparative material from Mesopotamia serves to trace the education of scribes in general. Part two focuses on the Second Temple period in ancient Israel. Ezra the scribe emerges as a typical scribe from that era. Post-exilic Israel was grappling with its identity, and sought guidance from ַ [as was written in the Torah]. However, it appears that there were different interpretations of the written Law during this period. Scribes of the Ezra circle advocated a radical policy of exclusivity on the basis of what was written in the Law; others who wrote the texts of Trito-Isaiah and Ruth pleaded for a more inclusive attitude towards foreigners. The conclusion is that the battle was fought not with the sword, but with the pen, therefore: ‘The pen is mightier than the sword.’
Coblentz, W K; Akins, M S; Esser, N M; Ogden, R K; Gelsinger, S L
2018-02-01
Our objectives were to evaluate the effects of pen-stocking density and straw processing on the growth performance, feed-bunk sorting behaviors, and hygiene of Holstein dairy heifers. Two corn silage-alfalfa haylage diets diluted with wheat straw were offered; diet composition was identical, except that one diet contained short (well-processed) straw (SS; 46.0% neutral detergent fiber, 12.9% crude protein, 60.7% total digestible nutrients, TDN), and the other long (poorly processed) straw (LS; 46.5% neutral detergent fiber, 12.6% crude protein, 60.0% TDN; % of dry matter basis). A 2 × 3 factorial arrangement of straw-processing (SS or LS) and pen-stocking-density [100, 125, or 150% of capacity] treatments was evaluated with 240 Holstein dairy heifers (410 ± 56.3 kg) that were blocked by weight, and then assigned to 24 pens with 4 pens/interactive treatment. For 91 d, diets were dispersed at 1100 h daily, and bunks were sampled subsequently at 1300, 1600, 1900, 2200, 0100, and 0600 h during 3 evaluation periods throughout the trial. Diets were offered for ad libitum intake, but with minimal orts (19 mm) particles increased linearly from 1.26 to 2.82 across sampling times, differing from the SS diet at 2200, 0100, 0600, and 0900 h (orts). Similar factors calculated for the SS diet also increased linearly across sampling times, but these responses were less severe (1.27 to 1.97). Overall, particle-size concentration factors for physically effective fiber exhibited responses similar to those observed for large particles, except they were limited to narrower ranges for both the SS (1.04 to 1.14) and LS (1.03 to 1.26) diets. Despite these differences, daily dry matter intake was not affected by treatment (mean = 9.65 kg of dry matter/d), nor was daily intake of TDN (mean = 5.92 kg of TDN/d). For SS, heifers housed within overstocked pens exhibited reduced average daily gain (ADG) compared with the 100% stocking rate (0.93 vs. 0.99 kg/d). With LS processing, ADG
Guía para la tutorización de una actividad académicamente dirigida a través de Google Drive
Iglesias Onofrio, Marcela; Martín Carballo, Margarita
2016-01-01
Guía para la tutorización de una actividad académicamente dirigida utilizando la herramienta Google Drive. En el documento se describen las indicaciones para que los alumnos y el docente compartan y editen de forma colaborativa un documento en Google Drive.
Policies to protect coastal resources may lead to greater social, economic, and ecological returns when they consider potential co-benefits and trade-offs on land. In Guánica Bay watershed, Puerto Rico, a watershed management plan is being implemented to restore declining quality...
Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg
2016-01-01
The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.
Bonivento, Walter M.
2018-02-01
This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.
Guía clínica de la enfermedad de Pompe de inicio tardío
Barba-Romero, Miguel A.; Barrot, Emilia; Bautista-Lorite, Juan; Gutiérrez-Rivas, Eduardo; Illa, Isabel; Jiménez, Luis M.; Ley-Martos, Myriam; López de Munain, Adolfo; Pardo, Julio; Pascual-Pascual, Samuel I.; Pérez-López, Jordi; Solera, Jesús; Vílchez-Padilla, Juan J.
2012-01-01
English version available at www.neurologia.com Hasta 2006, la enfermedad de Pompe o glucogenosis tipo II era una enfermedad incurable y con tratamiento meramente paliativo. El desarrollo de la terapia de sustitución con la enzima α-glucosidasa recombinante humana ha constituido el primer tratamiento específico para esta enfermedad. El objetivo de esta guía es servir de referencia en el manejo de la variedad de inicio tardío de la enfermedad de Pompe, es decir, la que aparece d...
Diàleg sobre el llenguatge del Llibre de la Naturalesa
Rényi, Alfréd
2009-01-01
Aquesta traducció al català del tercer diàleg de Rényi completa la dels dos anteriors, publicats en el Butlletí [25]. Tracta, com el títol indica, del «llenguatge del Llibre de la Naturalesa». Els protagonistes són Galileu Galilei, Caterina Niccolini i Evangelista Torricelli. Els temes que s'hi tracten són diversos. El diàleg que inicia el text entre Galileu i Torricelli tracta de les raons que han dut Galileu a enfrontar-se a la Inquisició la defensa de la llibertat de pens...
Touch the Page and Mimic Me: Evaluation of a Talking-Pen Learning Tool
Odakura, Abigail
2013-01-01
The purpose of this paper is to evaluate the talking-pen device called the Mimic Me, an educational technology product of a large English conversation school in Japan, as an educational learning tool. The product will be reviewed in terms of its developmental appropriateness for the target audience based on current research. Although the Mimic Me…
Diagnostics of magnetized low temperature plasma by ball-pen probe
Czech Academy of Sciences Publication Activity Database
Adámek, Jiří; Peterka, M.; Gyergyek, T.; Kudrna, P.; Tichý, M.
2012-01-01
Roč. 57, č. 2 (2012), s. 297-300 ISSN 0029-5922. [International Conference on Research and Applications of Plasmas (PLASMA). Warsaw, 12.09.2011-16.09.2011] R&D Projects: GA ČR GA202/07/0044; GA AV ČR KJB100430901 Institutional research plan: CEZ:AV0Z20430508 Keywords : ball- pen probe * magnetron Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.507, year: 2012 http://www.nukleonika.pl/www/back/full/vol57_2012/v57n2p297f.pdf
Guérir de la folie. La dispute sur la transfusion sanguine (1667-1668)
Andrault , Raphaële
2014-01-01
International audience; La transfusion sanguine guérirait de la folie. Ainsi, en 1668, "la transfusion du sang d'un veau avait tellement tempéré les fougues et les bouillons du sang d'un fou, qui depuis quatre mois courait jour et nuit tout nu dans les rues de Paris", qu'il en avait retrouvé la raison (J.-B. Denis). La réalité et les implications d'un tel succès thérapeutique se trouvent au cœur de violents échanges polémiques opposant transfuseurs et anti-transfuseurs pendant plus de deux a...
2009-01-01
Background Penicillium chrysogenum converts isopenicillin N (IPN) into hydrophobic penicillins by means of the peroxisomal IPN acyltransferase (IAT), which is encoded by the penDE gene. In silico analysis of the P. chrysogenum genome revealed the presence of a gene, Pc13g09140, initially described as paralogue of the IAT-encoding penDE gene. We have termed this gene ial because it encodes a protein with high similarity to IAT (IAL for IAT-Like). We have conducted an investigation to characterize the ial gene and to determine the role of the IAL protein in the penicillin biosynthetic pathway. Results The IAL contains motifs characteristic of the IAT such as the processing site, but lacks the peroxisomal targeting sequence ARL. Null ial mutants and overexpressing strains indicated that IAL lacks acyltransferase (penicillin biosynthetic) and amidohydrolase (6-APA forming) activities in vivo. When the canonical ARL motif (leading to peroxisomal targeting) was added to the C-terminus of the IAL protein (IALARL) by site-directed mutagenesis, no penicillin biosynthetic activity was detected. Since the IAT is only active after an accurate self-processing of the preprotein into α and β subunits, self-processing of the IAL was tested in Escherichia coli. Overexpression experiments and SDS-PAGE analysis revealed that IAL is also self-processed in two subunits, but despite the correct processing, the enzyme remained inactive in vitro. Conclusion No activity related to the penicillin biosynthesis was detected for the IAL. Sequence comparison among the P. chrysogenum IAL, the A. nidulans IAL homologue and the IAT, revealed that the lack of enzyme activity seems to be due to an alteration of the essential Ser309 in the thioesterase active site. Homologues of the ial gene have been found in many other ascomycetes, including non-penicillin producers. Our data suggest that like in A. nidulans, the ial and penDE genes might have been formed from a single ancestral gene that became
Directory of Open Access Journals (Sweden)
Enrique Pérez de la Sota
2013-01-01
El objeto del presente trabajo es analizar el capítulo dedicado al soporte mecánico circulatorio en estas nuevas guías y comentar de forma crítica las novedades aportadas, así como su posible aplicabilidad en España dadas las especiales características de la asistencia en nuestro país.
Principales características de una guía para la planeación de salidas pedagógicas
Directory of Open Access Journals (Sweden)
Liliana Camargo Montoya
2009-10-01
Full Text Available En el presente artículo se identifican las principales características que debe tener la organización de una guía para salidas pedagógicas, teniendo en cuenta que estas deben constituir una estrategia de formación en el marco educativo, para fortalecer el desarrollo de competencias ciudadanas y científicas, orientadas al ejercicio permanente de la convivencia y la participación crítica responsable, como elemento fundamental en la relación con el ambiente. Se contrasta la Planeación y estructuración de guías desarrolladas por estudiantes de Licenciatura en Química de la Universidad Pedagógica Nacional, en donde la mitad de los estudiantes asistieron a una salida de campo, realizada a Cali con el objetivo de tratar la temática de Carbohidratos referente al espacio académico de Sistemas Orgánicos II, frente a la otra mitad de los estudiantes que no asistieron a dicha salida, el articulo esta orientado desde el enfoque pedagógico de enseñanzaAprendizaje Constructivista.
Eby, Elizabeth L; Smolen, Lee J; Pitts, Amber C; Krueger, Linda A; Andrews, Jeffrey Scott
2014-12-01
Estimate budgetary impact for skilled nursing facility converting from individual patient supply (IPS) delivery of rapid-acting insulin analog (RAIA) 10-mL vials or 3-mL prefilled pens to 3-mL vials. A budget-impact model used insulin volume purchased and assumptions of length of stay (LOS), daily RAIA dose, and delivery protocol to estimate the cost impact of using 3-mL vials. Skilled nursing facility. Medicare Part A patients. Simulations conducted using 12-month current and future scenarios. Comparisons of RAIA use for 13- and 28-day LOS. RAIA costs and savings, waste reduction. For patients with 13-day LOS using 20 units/day of IPS insulin, the model estimated a 70% reduction in RAIA costs and units purchased and a 95% waste reduction for the 3-mL vial compared with the 10-mL vial. The estimated costs for prefilled pen use were 58% lower than for use of 10-mL vials. The incremental savings associated with 3-mL vial use instead of prefilled pens was 28%, attributable to differences in per-unit cost of insulin in vials versus prefilled pens. Using a more conservative scenario of 28-day LOS at 20 units/day, the model estimated a 40% reduction in RAIA costs and units purchased, resulting in a 91% reduction in RAIA waste for the 3-mL vial, compared with 10-mL vial. Budget-impact analysis of conversion from RAIA 10-mL vials or 3-mL prefilled pens to 3-mL vials estimated reductions in both insulin costs and waste across multiple scenarios of varying LOS and patient daily doses for skilled nursing facility stays.
Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René
2016-07-01
The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.
Paper-pen peer-correction versus wiki-based peer-correction
Directory of Open Access Journals (Sweden)
Froldova Vladimira
2016-01-01
Full Text Available This study reports on the comparison of the students’ achievement and their attitudes towards the use of paper-pen peer-correction and wiki-based peer-correction within English language lessons and CLIL Social Science lessons at the higher secondary school in Prague. Questionnaires and semi-structured interviews were utilized to gather information. The data suggests that students made considerable use of wikis and showed higher degrees of motivation in wiki-based peer-correction during English language lessons than in CLIL Social Science lessons. In both cases wikis not only contributed to developing students’ writing skills, but also helped students recognize the importance of collaboration.
International Nuclear Information System (INIS)
Lee, L.C.; Mohamed Rozali Othman; Pua, H.; Lee, L.C.
2012-01-01
This manuscript aims to provide a new and non-destructive method for systematic analysis of inks on a questioned document. Ink samples were analyzed in situ on the paper substrate by micro-ATR-FTIR spectroscopy and the data obtained was processed and evaluated by a series of multivariate chemometrics. Absorbance value from wavenumbers of 2000-675 cm -1 were first processed by cluster analysis (CA), followed by principal component analysis (PCA) to form a set of new variables. Subsequently, the variables set was used for classification, differentiation and identification of 155 sample pens that comprise nine different brands. Results show that nine black ball-point pen brands could be classified into three main groups via discriminant analysis (DA). Differentiation analyses of nine different pen brands performed using one-way ANOVA indicated only two pairs of brands cannot be differentiated at 95 % confidence interval. Finally an identification flow chart was proposed to determine the brand of unknown pen inks. As a conclusion, the proposed method for extracting and creating a new variable set from infrared spectrum was evaluated to be satisfactory for systematic analysis of inks based on their infrared spectrum. (author)
DEFF Research Database (Denmark)
Hald, Tine
or slaughter (production holdings) were sampled. In each selected holding, pooled fresh faecal samples were collected from 10 randomly chosen pens of breeding pigs over six months of age, representing the different stages of the breeding herd, and examined for the presence of Salmonella. Analyses at country......, multivariable regression analysis showed that the odds of Salmonella-positive pens with pigs increased with the number of breeding pigs in the holding and with the following pen-level factors: flooring systems other than slatted floors or solid floors with straw, presence of maiden gilts, number of pigs per pen...
Los animales representados en el arte rupestre de la Península Ibérica. Frecuencias de los mismos
Directory of Open Access Journals (Sweden)
Jesús Altuna
2002-01-01
Full Text Available Se trata de recuentos de los animales figurados en el arte parietal paleolítico de la Península Ibérica, considerados tanto en su conjunto y comparados con el de Perigord y el Pirineos Francés, como en las diversas regiones de la misma Península, incluidos los sitios protugueses. Tanto la primera comparación como la consideración por separado de los animales representados en las diversas regiones peninsulares, muestra diferencias notables. Por fin se recuentan las figuras animales de todos los sitios del País Vasco, tanto peninsular como continental.
PENTATRAP. A novel Penning-trap system for high-precision mass measurements
Energy Technology Data Exchange (ETDEWEB)
Doerr, Andreas
2015-01-21
The novel Penning-trap mass spectrometer PENTATRAP aims at mass-ratio determinations of medium-heavy to heavy ions with relative uncertainties below 10{sup -11}. From the mass ratios of certain ion species, the corresponding mass differences will be determined with sub-eV/c{sup 2} uncertainties. These mass differences are relevant for neutrino-mass experiments, a test of special relativity and tests of bound-state QED. Means to obtain the required precision are very stable trapping fields, the use of highly-charged ions produced by EBITs, a non-destructive cyclotron-frequency determination scheme employing detectors with single-ion sensitivity and a five-trap tower, that allows for measurement schemes being insensitive to magnetic field drifts. Within this thesis, part of the detection electronics was set up and tested under experimental conditions. A single-trap setup was realized. A Faraday cup in the trap tower enabled the proper adjustment of the settings of the beamline connecting the EBIT and the Penning-trap system, resulting in the first trapping of ions at PENTATRAP. A stabilization of switched voltages in the beamline and detailed studies of ion bunch characteristics allowed for reproducible loading of only a few ions. Detection of the axial oscillation of the trapped ions gave hints that in some cases, even single ions had been trapped. Furthermore, valuable conclusions about necessary modifications of the setup could be drawn.
Marker Pen Lithography for Flexible and Curvilinear On-Chip Energy Storage
Jiang, Qiu
2015-07-14
On-chip energy storage using microsupercapacitors can serve the dual role of supplementing batteries for pulse power delivery, and replacement of bulky electrolytic capacitors in ac-line filtering applications. Despite complexity and processing costs, microfabrication techniques are being employed in fabricating a great variety of microsupercapacitor devices. Here, a simple, cost-effective, and versatile strategy is proposed to fabricate flexible and curvilinear microsupercapacitors (MSCs). The protocol involves writing sacrificial ink patterns using commercial marker pens on rigid, flexible, and curvilinear substrates. It is shown that this process can be used in both lift-off and etching modes, and the possibility of multistack design of active materials using simple pen lithography is demonstrated. As a prototype, this method is used to produce conducting polymer MSCs involving both poly(3,4-ethylenedioxythiophene), polyaniline, and metal oxide (MnO2) electrode materials. Typical values of energy density in the range of 5-11 mWh cm-3 at power densities of 1-6 W cm-3 are achieved, which is comparable to thin film batteries and superior to the carbon and metal oxide based microsupercapacitors reported in the literature. The simplicity and broad scope of this innovative strategy can open up new avenues for easy and scalable fabrication of a wide variety of on-chip energy storage devices. © 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim.
Marker Pen Lithography for Flexible and Curvilinear On-Chip Energy Storage
Jiang, Qiu; Kurra, Narendra; Alshareef, Husam N.
2015-01-01
On-chip energy storage using microsupercapacitors can serve the dual role of supplementing batteries for pulse power delivery, and replacement of bulky electrolytic capacitors in ac-line filtering applications. Despite complexity and processing costs, microfabrication techniques are being employed in fabricating a great variety of microsupercapacitor devices. Here, a simple, cost-effective, and versatile strategy is proposed to fabricate flexible and curvilinear microsupercapacitors (MSCs). The protocol involves writing sacrificial ink patterns using commercial marker pens on rigid, flexible, and curvilinear substrates. It is shown that this process can be used in both lift-off and etching modes, and the possibility of multistack design of active materials using simple pen lithography is demonstrated. As a prototype, this method is used to produce conducting polymer MSCs involving both poly(3,4-ethylenedioxythiophene), polyaniline, and metal oxide (MnO2) electrode materials. Typical values of energy density in the range of 5-11 mWh cm-3 at power densities of 1-6 W cm-3 are achieved, which is comparable to thin film batteries and superior to the carbon and metal oxide based microsupercapacitors reported in the literature. The simplicity and broad scope of this innovative strategy can open up new avenues for easy and scalable fabrication of a wide variety of on-chip energy storage devices. © 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim.
Guía para la práctica clínica de las enfermedades diarreicas agudas
Freijoso Santiesteban, Elsie; Cires Pujol, María Miriam; Silva Herrera, Lázaro; Delgado Martínez, Ibis; Riverón Corteguera, Raúl; Ramírez, Margarita
2003-01-01
Se presenta una guía para la práctica clínica de las enfermedades diarreicas agudas (EDA), cuyo objetivo principal es el de establecer recomendaciones para el manejo terapéutico de pacientes con EDA. En la misma se abordan las definiciones y causas de las EDA, los objetivos del tratamiento, la evaluación del paciente con diarreas y las características clínico epidemiológicas, así como las consideraciones terapéuticas y tratamientos para las diarreas causadas por diferentes microorganismos.A c...
Guía de actividades manuales y grafoplásticas para maestros/as hospitalarias Activ Arte.
Villavicencio Alzamora, Ana Lucía
2011-01-01
El presente producto llamado Guía de Actividades Manuales y Grafoplásticas para Maestros/as Hospitalarias “ActivArte”, radica en la importancia de ofrecer una educación y ayuda los niños/as que se encuentran hospitalizados, con la adaptación de una pedagogía adecuada para ellos, definida como Pedagogía Hospitalaria. La Pedagogía Hospitalaria, debe proporcionar bienestar emocional al niño y a la familia, disminuyendo la ansiedad, mejorando su adaptación y ajuste a la hospitaliza...
Grafiskais redaktors „TUX PAINT” kā līdzeklis 3 –gadīgu bērnu saskarsmes veicināšanā
Bērziņa, Gita
2008-01-01
Gitas Eglītes pētījumā tiek analizēta 3 gadīgu bērnu saskarsmes prasmju veicināšana ar grafiskā redaktora „Tux Paint” palīdzību. Pētījuma teorētiskajā daļā, pamatojoties uz J.Kupča, D.Lieģenieces, R.Andersones, S.Omārovas, G.Cukermanes un citu teorētiķu atziņām, autore analizē saskarsmes un saskarsmes prasmju jēdzienu, tās veidošanos ar grafiskā redaktora „Tux Paint” palīdzību. Pētījuma empīriskajā daļā autore analizē 3 gadīgu bērnu saskarsmes prasmju veicinošos faktorus konkrētā kultūr...
Effects of different flooring options in outside pens of hutches on dairy calf growth
Growth rates of dairy calves may vary due to many different factors, including housing. The objective of this study was to determine if calf growth was affected by different flooring options in the outside penned area of a calf hutch. For this study, 33 hutches were blocked in groups of 3 by locatio...
À Parte - Os Fundos de Pensão no Contexto da Financeirização Capitalista
Directory of Open Access Journals (Sweden)
Stefania Becattini Vaccaro
2010-05-01
Full Text Available
Directory of Open Access Journals (Sweden)
Jonatan Castaño-Muñoz
2010-06-01
Full Text Available Diversos autores abogan por la necesidad de una guía formal en el aprendizaje de una materia, al menos en los primeros pasos de éste. Pero, con la aparición de recursos educativos de calidad en Internet ¿es posible que los alumnos adquieran el bagaje necesario para poder aprender autónomamente a través de la red sin pasar por las aulas? A partir del análisis de los datos de un cuestionario a 14.936 estudiantes del sistema universitario catalán este artículo muestra como, en las carreras universitarias, la consulta autónoma de los recursos de internet no sustituye a la guía inicial de la institución educativa. Pese a ello, los datos muestran como en etapas posteriores estos recursos pueden ser muy beneficiosos para adquirir un conocimiento más experto, siguiendo una dinámica de aprendizaje autónomo y en red a lo largo de toda la vida.
2010-03-04
... W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W-3cPR, W-3PR, and W-3SS AGENCY: Internal Revenue Service....C. 3506(c)(2)(A)). Currently, the IRS is soliciting comments concerning Forms W-2, W-2c, W-2AS, W-2GU, W-2VI, W-3, W-3c, W- 3cPR, W-3PR, and W-3SS. DATES: Written comments should be received on or...
DEFF Research Database (Denmark)
Weber, Nicolai Rosager; Nielsen, Jens Peter; Jorsal, Sven Erik Lind
2017-01-01
Introduction. The prudent use of antibiotics in veterinary medicine necessitates the selection of antibiotic compounds with narrow-spectrums targeted against the specific pathogens involved. The same pathotype of enterotoxigenic E. coli (ETEC) was recently found both in diarrhoeic pigs...... was observed in the sampled ETEC isolates. In addition, there was generally good or excellent agreement when comparing resistance profiles from isolates from the same pen (pen floor and pig samples), and perfect agreement (Kappa = 1.000, SE = 0.316) was observed for ampicillin, apramycin, gentamycin...
Estructuras de fondo rehundido altomedievales en la Península Ibérica
Directory of Open Access Journals (Sweden)
TEJERIZO GARCÍA, C.
2014-01-01
Full Text Available La presencia de estructuras de fondo rehundido en contextos arqueológicos altomedievales está ampliamente documentada en toda Europa y cuenta con una dilatada historiografía. En la Península Ibérica, asociado a la expansión urbanística, se ha podido detectar un conjunto muy significativo de estas estructuras. Sin embargo, la falta de sistematización y análisis ha llevado a algunos problemas en su detección y documentación, así como a excesos conceptuales y de interpretación. En este trabajo se realiza una recopilación analítica de las evidencias de estructuras de fondo rehundido de época altomedieval presentes en la Península Ibérica mostrando su alta complejidad y diversidad. Basado en un análisis de la evidencia disponible, y frente a las tesis etnicistas que las vinculan a la llegada de grupos alóctonos, se propone una interpretación relacionada con el desarrollo de un modo de producción campesino tras la desarticulación de la economía imperial romana.
Quantum simulation of the integer factorization problem: Bell states in a Penning trap
Rosales, Jose Luis; Martin, Vicente
2018-03-01
The arithmetic problem of factoring an integer N can be translated into the physics of a quantum device, a result that supports Pólya's and Hilbert's conjecture to demonstrate Riemann's hypothesis. The energies of this system, being univocally related to the factors of N , are the eigenvalues of a bounded Hamiltonian. Here we solve the quantum conditions and show that the histogram of the discrete energies, provided by the spectrum of the system, should be interpreted in number theory as the relative probability for a prime to be a factor candidate of N . This is equivalent to a quantum sieve that is shown to require only o (ln√{N}) 3 energy measurements to solve the problem, recovering Shor's complexity result. Hence the outcome can be seen as a probability map that a pair of primes solve the given factorization problem. Furthermore, we show that a possible embodiment of this quantum simulator corresponds to two entangled particles in a Penning trap. The possibility to build the simulator experimentally is studied in detail. The results show that factoring numbers, many orders of magnitude larger than those computed with experimentally available quantum computers, is achievable using typical parameters in Penning traps.
2018-01-01
This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.
Guía Clínica para la Adaptación de Lentes de Contacto Multifocales Tóricas Hidrofílicas
García Valencia, Lidia
2015-01-01
Elaboración de una guía clínica para la adaptación de lentes de contacto multifocales tóricas, basada en la bibliografía existente sobre ese tipo de lentes de contacto y un caso clínico utilizado para faciltar su comprensión. Grado en Óptica y Optometría
Ion bunch stacking in a Penning trap after purification in an electrostatic mirror trap
Rosenbusch, M; Blaum, K; Borgmann, Ch; Kreim, S; Lunney, D; Manea, V; Schweikhard, L; Wienholtz, F; Wolf, R N
2014-01-01
The success of many measurements in analytical mass spectrometry as well as in precision mass determinations for atomic and nuclear physics is handicapped when the ion sources deliver ``contaminations'', i.e., unwanted ions of masses similar to those of the ions of interest. In particular, in ion-trapping devices, large amounts of contaminant ions result in significant systematic errors-if the measurements are possible at all. We present a solution for such cases: The ions from a quasi-continuous source are bunched in a linear radio-frequency-quadrupole ion trap, separated by a multi-reflection time-of-flight section followed by a Bradbury-Nielsen gate, and then captured in a Penning trap. Buffer-gas cooling is used to damp the ion motion in the latter, which allows a repeated opening of the Penning trap for a stacking of mass-selected ion bunches. Proof-of-principle demonstrations have been performed with the ISOLTRAP setup at ISOLDE/CERN, both with Cs-133(+) ions from an off-line ion source and by applicati...
Behavior of many ions in a Penning trap and results of the WITCH experiment
Porobic, Tomica
Precision measurements of the beta−neutrino angular correlation in nuclear beta-decay provide a unique window into the physics beyond the Standard model. The WITCH (Weak Interaction Trap for CHarged particles) experiment aims to measure this correlation, a(beta-nu), in order to impose a more stringent constraint on the exotic scalar current admixture in the beta-decay Hamiltonian. The apparatus is situated at CERN/ISOLDE laboratory and consists of a unique combination of a retardation spectrometer and two Penning traps, with one of them serving as a scattering-free source. This configuration is suited for a precise measurement of the energy spectrum of 35Ar recoiled daughter ions. The shape of the spectrum then allows a determination of a(beta-nu) and consequently of the presence or absence of a scalar current. Radioactive 35Ar ions are created at ISOLDE by impinging 1.2 GeV protons on the target material. After being separated by a magnetic separator and bunched by REXTRAP, a high-capacity Penning trap, th...
Retroperitoneal migration of a self-inflicted ballpoint pen via the urethra
Directory of Open Access Journals (Sweden)
Jose Cury
2006-04-01
Full Text Available Numerous accounts documenting the introduction of foreign bodies into the urinary bladder have been reported. These foreign bodies are typically self-inserted via urethral but migration from adjacent organs by an ulcerative process and penetrating injuries are also reported. However, "contrary" migration of a self-inflicted vesical foreign body to the retroperitoneum was not previously reported in literature. We report here a case of a ballpoint pen self-inserted via urethral by a female patient, which was identified in retroperitoneal position years later.
Torre de Oficinas en la Península de Zorrotzaure, Bilbao.
Hevia Sánchez, Raúl de
2015-01-01
El proyecto se encuadra dentro de la península de Zorrotzaure, una zona industrial degradada en la que apenas hay hoy actividad. El alcance de este estudio es plantear diversas soluciones estructurales para el edificio que se planea construir y elegir la más adecuada atendiendo a conceptos tales como económicos, de plazo, funcionales y ambientales. El área no ocupada por la torre se destinará a aparcamientos, accesos y zonas verdes. Se planea construir una zona de aparcamiento para los trabaj...
Hagenmaier, J A; Reinhardt, C D; Bartle, S J; Thomson, D U
2016-12-01
Feedlot cattle ( = 1,395; BW = 568 ± 43 kg) were used to evaluate the effects of shade on animal welfare, growth performance, and carcass quality during the summer of 2013 in a Kansas commercial feedlot. Seven lots of predominately black steers and heifers (4 and 3, respectively) visually determined to be approaching the final mo on feed were identified, randomly gate-sorted, and allocated to pens located across the feed alley from each other to receive 1 of 2 treatments: 1) Shade (mean shade area = 1.5 m/ animal) or 2) No shade. Shade was provided using a 13-ounce polyethylene fabric and pens were oriented northwest to southeast. The mean starting date was June 13 and the mean days on feed for lots while on the study was 38 d. Cattle were fed a 77.67% DM steam-flaked corn-based diet and had ad libitum access to water throughout the duration of the trial. Zilpaterol hydrochloride (ZIL) was included in the finishing ration at an inclusion rate of 8.3 mg/kg of DM for the last 20 d on feed with a 3 d withdrawal period. Pen floor temperatures (PFT) were measured using an infrared thermometer and prevalence of cattle open-mouth breathing (OMB) was recorded on a pen basis. In addition to shade treatment, the effect of temperature humidity index (THI) on PFT and OMB was analyzed by classifying days as either "Alert" (THI 79). On the day of slaughter, pens within a replicate were kept separate through all stages of the marketing channel from loading at the feedlot until stunning at the plant. Pen served as the experimental unit for all measurements. There was a THI × shade treatment interaction for PFT and OMB ( 0.05). Heat stress, a significant animal welfare concern and cause of reduced performance in feedlot cattle during the final phase of the feeding period, was alleviated in shaded cattle and illustrates the importance of shade provision as 1 tool to protect the welfare and increase feed consumption in large pens of feedlot cattle during hot summer months.
Recent results from the Penning trap mass spectrometer JYFLTRAP
Energy Technology Data Exchange (ETDEWEB)
Weber, Christine; Elomaa, Viki-Veikko; Eronen, Tommi; Hakala, Jani; Jokinen, Ari; Kankainen, Anu; Rahaman, Saidur; Rissanen, Juho; Aeystoe, Juha [Department of Physics, (YFL), University of Jyvaeskylae (Finland)
2009-07-01
Accurate mass determination employing Penning ion traps has gained increasing importance after the installation of several new on-line facilities at accelerator labs. These setups combine unique production possibilities for rare isotopes with elaborate ion-capture and manipulation techniques. Since the final commissioning of the JYFLTRAP setup at the IGISOL facility in Jyvaeskylae, the masses of more than 200 short-lived nuclides have been measured. Their knowledge applies to studies on nuclear structure, the modeling of nucleosynthesis processes, tests of the conserved vector current (CVC) hypothesis and the unitarity of the CKM matrix, and furthermore, can help to assist in ongoing searches of neutrinoless double-beta decays. This presentation focuses on recent highlights studied at JYFLTRAP.
Saviello, Daniela; Trabace, Maddalena; Alyami, Abeer; Mirabile, Antonio; Giorgi, Rodorico; Baglioni, Piero; Iacopino, Daniela
2018-05-01
The development of protocols for the protection of the large patrimony of works of art created by felt tip pen media since the 1950's requires detailed knowledge of the main dyes constituting commercial ink mixtures. In this work Surface Enhanced Raman Scattering (SERS) and UV-vis spectroscopy were used for the first time for the systematic identification of dye composition in commercial felt tip pens. A large selection of pens comprising six colors of five different brands was analyzed. Intense SERS spectra were obtained for all colors, allowing identification of main dye constituents. Poinceau 4R and Eosin dyes were found to be the main constituents of red and pink colors; Rhodamine and Tartrazine were found in orange and yellow colors; Erioglaucine was found in green and blue colors. UV-vis analysis of the same inks was used to support SERS findings but also to unequivocally assign some uncertain dye identifications, especially for yellow and orange colors. The spectral data of all felt tip pens collected through this work were assembled in a database format. The data obtained through this systematic investigation constitute the basis for the assembly of larger reference databases that ultimately will support the development of conservation protocols for the long term preservation of modern art collections. Copyright © 2018 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Kluge, H.-Jürgen; Block, Michael; Herfurth, Frank
2011-01-01
A collimated-hole structure consists of a very large number of parallel channels which have each a very small diameter and are closely packed together. Such devices, installed in vacuum systems allow one to separate regions of very different gas pressures. A collimated-hole structure has high transmission for a directed ion beam with low emittance but a very low conductance for rest gas atoms or molecules exhibiting random walk. Therefore it is proposed to use such a structure as one-way valve and/or efficient differential pumping barrier in set-ups using Penning traps. Furthermore, these devices might be very useful to align the axis of a Penning trap with the direction of the magnetic field lines which is essential to avoid systematic uncertainties in high-accuracy mass spectroscopy.
Aportaciones a la flora vascular del norte de la Península Ibérica
Directory of Open Access Journals (Sweden)
Fidalgo, E., Llorente, A., Cadiñanos, J.A., Tarruella, J.
2012-01-01
Full Text Available Se citan varios taxones nuevos o interesantes de la flora vascular del norte de la Península Ibérica, concretamente de las provincias vascas de Álava, Vizcaya y Guipúzcoa y de las comunidades de Cantabria, Asturias, Castilla-León y Navarra.
Pen Rearing and Imprinting of Fall Chinook Salmon, 1986 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Novotny, Jerry F.; Macy, Thomas L.; Gardenier, James T.; Beeman, John W.
1986-12-01
Pen rearing studies during 1986 completed the second of three years intended for rearing and releasing upriver bright fall chinook salmon (Oncorhynchus tshawytscha) from two study sites, a backwater and a pond, adjacent to the Columbia River; both areas are located in the Jonn Day Reservoir. Results of this study in 1984 and 1985 showed that fish could be successfully reared in net pens and that growth and physiological development of the off-station reared fish proceeded at a faster rate than in fish reared at a hatchery. Transfer of fish from the hatchery to off-station sites at Social Security Pond (pond) and Rock Creek (backwater) during early March increased the period of rearing in 1986 by about four weeks. The increased period of rearing allowed all treatments of fed fish to reach a minimum weight of YU fish/lb by release. Differences in growth of fed fish between regular density treatments and additional, high density treatments (double and triple the regular densities) were not significantly different (P > 0.05), but growth of all fed fish reared off-station was again significantly better than that of hatchery reared fish (P < 0.05), Mortalities in all groups of fed fish were low. Physiological development of fed fish was similar in all treatments. At release, development of fish at Social Security Pond appeared to be somewhat ahead of fish at Rock Creek on the same dates however, none of the groups of fed fish achieved a high state of smoltification by release. Unfed fish grew poorly over the redring period, and at release were significantly smaller than either fed groups at the off-station sites, or the control groups reared at the hatchery (P < 0.05). Development of unfed fish toward smoltification was much slower than of fed fish. Mortality of all groups of unfed fish, including the barrier net, was relatively low. Health of all fish reared off-station remained good over the rearing period, and no outbreaks of disease were noted. On-site marking and
The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.
Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo
2014-01-01
Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.
Causas de la falta de adherencia a las guías terapéuticas para la neumonía grave
Directory of Open Access Journals (Sweden)
Simone Gattarello
2015-03-01
Full Text Available Objetivo: Valorar tasa de adherencia y causas de no adherencia a las guías terapéuticas internacionales para la prescripción antibiótica empírica en la neumonía grave en Latinoamérica. Métodos: Encuesta clínica realizada a 36 médicos de Latinoamérica donde se pedía indicar el tratamiento empírico en 2 casos clínicos ficticios de pacientes con infección respiratoria grave: neumonía adquirida en la comunidad y neumonía nosocomial. Resultados: En el caso de la neumonía comunitaria el tratamiento fue adecuado en el 30,6% de las prescripciones. Las causas de no adherencia fueron monoterapia (16,0%, cobertura no indicada para multirresistentes (4,0% y empleo de antibióticos con espectro inadecuado (44,0%. En el caso de la neumonía nosocomial el cumplimiento de las guías terapéuticas Infectious Disease Society of America/American Thoracic Society fue del 2,8%. Las causas de falta de adherencia fueron monoterapia (14,3% y la falta de doble tratamiento antibiótico frente a Pseudomonas aeruginosa (85,7%. En caso de considerar correcta la monoterapia con actividad frente a P. aeruginosa, el tratamiento sería adecuado en el 100% de los casos. Conclusión: En la neumonía comunitaria la adherencia a las guías terapéuticas Infectious Disease Society of America/American Thoracic Society fue del 30,6%; la causa más frecuente de incumplimiento fue el uso de monoterapia. La adherencia en el caso de la neumonía nosocomial fue del 2,8% y la causa más importante de incumplimiento fue la falta de doble tratamiento frente a P. aeruginosa, considerando adecuada monoterapia con actividad frente a P. aeruginosa la adherencia sería del 100%.
The effects of pen partitions and thermal pig simulators on airflow in a livestock test room
DEFF Research Database (Denmark)
Bjerg, B.; Svidt, Kjeld; Zhang, G.
2000-01-01
measurements and CFD simulations showed that the introduction of pen partitions and thermal pig simulators reduced the air velocities in the occupied zone of the test room. Detailed geometric modelling of the animals might often be unnecessary for simulation of airflow in livestock rooms. This will especially......The aim of this work was to investigate the influence of pen partitions and heated simulated pigs on airflow in a slot ventilated test room and to evaluate computer fluid dynamics (CFD) as a tool to predict airflow in livestock rooms. To obtain two-dimensional flow in the occupied zone, four...... guiding plates were mounted beneath the ceiling in the test room. Experiments were carried out in three arrangements: (a) the room with guiding plates; (b) the room with guiding plates and eight heated pig simulators; and (c) the room with guiding plates, eight heated pig simulators and 0.8 m high...