Exchange interactions in Fe/Y multilayers
International Nuclear Information System (INIS)
Elkabil, R.; Elkaidi, I.; Annouar, F.; Lassri, H.; Hamdoun, A.; Bensassi, B.; Berrada, A.; Krishnan, R.
2005-01-01
The magnetization of Fe/Y multilayers has been measured as a function of temperature. A bulk-like T 3/2 temperature dependence of the magnetization is observed for all multilayers in the temperature range 5-300 K. The spin-wave constant B is found to decrease inversely with t Fe . A simple theoretical model with exchange interactions only, and with non-interacting magnons, has been used to explain the temperature dependence of the magnetization and the approximate values for the bulk exchange interaction J b , surface exchange interaction J s and the interlayer exchange interaction J I for various Fe layer thicknesses have been obtained
Thermal analysis of compositionally modulated Fe/Y films
International Nuclear Information System (INIS)
Kajiura, M.; Morishita, T.; Togami, Y.; Tsushima, K.
1987-01-01
Structures of compositionally modulated Fe/Y films were studied by thermal analysis. The exothermic peak found in the DSC curve of (Fe 12 A/Y 12 A) most probably corresponds to crystallization of an amorphous material. SEM analysis suggested that the composition of crystallized (Fe 12 A/Y 12 A) was YFe2. It is concluded that a compositionally modulated (Fe 12 A/Y 12 A) is amorphous in structure as well as in magnetic properties
Oxygen transport in La0.6Sr0.4Co1-yFeyO3-d
Bouwmeester, Henricus J.M.; den Otter, M.W.; Boukamp, Bernard A.
2004-01-01
The surface exchange coefficient and chemical diffusion coefficient of oxygen for the perovskites La0.6Sr0.4Co1–yFeyO3–delta (y=0.2, 0.5 and 0.8) were measured using the conductivity relaxation technique. Measurements were performed between 600 and 800 °C in an oxygen partial pressure range between
Dark matter at the SHiP experiment
International Nuclear Information System (INIS)
Timiryasov, Inar
2016-01-01
We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk
Civil Engineering for the SHiP facility
Osborne, John Andrew
2015-01-01
The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT
Radiation protection studies for the SHiP facility
Strabel, Claudia Christina; Vincke, Helmut
2015-01-01
The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.
Women stereotypes in Shi Zhecun's short stories.
Rosenmeier, Christopher
2010-01-01
This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.
Brothers or Rivals? Iran and the Shi'a of Iraq
National Research Council Canada - National Science Library
Hunter, Robert C
2006-01-01
This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...
Interaction and conflict between Sufism and Shi`ism during Safavid era
Directory of Open Access Journals (Sweden)
E Naghibi
2017-10-01
Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shiâite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.
Payne, Matthew A; Miller, James B; Gellman, Andrew J
2016-09-12
Composition spread alloy films (CSAFs) are commonly used as libraries for high-throughput screening of composition-property relationships in multicomponent materials science. Because lateral gradients afford two degrees of freedom, an n-component CSAF can, in principle, contain any composition range falling on a continuous two-dimensional surface through an (n - 1)-dimensional composition space. However, depending on the complexity of the CSAF gradients, characterizing and graphically representing this composition range may not be straightforward when n ≥ 4. The standard approach for combinatorial studies performed using quaternary or higher-order CSAFs has been to use fixed stoichiometric ratios of one or more components to force the composition range to fall on some well-defined plane in the composition space. In this work, we explore the synthesis of quaternary Al-Fe-Ni-Cr CSAFs with a rotatable shadow mask CSAF deposition tool, in which none of the component ratios are fixed. On the basis of the unique gradient geometry produced by the tool, we show that the continuous quaternary composition range of the CSAF can be rigorously represented using a set of two-dimensional "pseudoternary" composition diagrams. We then perform a case study of (AlxFeyNi1-x-y)∼0.8Cr∼0.2 oxidation in dry air at 427 °C to demonstrate how such CSAFs can be used to screen an alloy property across a continuous two-dimensional subspace of a quaternary composition space. We identify a continuous boundary through the (AlxFeyNi1-x-y)∼0.8Cr∼0.2 subspace at which the oxygen uptake into the CSAF between 1 and 16 h oxidation time increases abruptly with decreasing Al content. The results are compared to a previous study of the oxidation of AlxFeyNi1-x-y CSAFs in dry air at 427 °C.
2016-06-13
Electrochemical Performance of LixMn2-yFeyO4-zClz Synthesized Through In-Situ Glycine Nitrate Combustion Ashley L. Ruth, Paula C. Latorre, and...sites as well as the formation of Mn3+ ions via the Jahn- Teller effect. The use of the glycine nitrate combustion synthesis produces small particles at...advantage of submicron ceramic synthesis, namely the glycine nitrate combustion process (GNP), we propose the capability for in-situ B-site doping
R and D of tritium technology as SHI (Sumitomo Heavy Industries)
International Nuclear Information System (INIS)
Yokogawa, N.
1997-01-01
Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)
Dr. Shi Hanzhang's Experience in Treating Andropathy
Institute of Scientific and Technical Information of China (English)
无
2007-01-01
@@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.
Calibrating the SHiP muon-flux using NA61/SHINE
Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe
2016-01-01
A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.
$\\mu$-flux measurements for SHiP using NA61/SHINE
Dijkstra, H; Korzenev, A; Mermod, P
2016-01-01
A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.
Muon-flux measurements for SHiP at H4
van Herwijnen, E
2017-01-01
A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.
Antonella Del Rosso
2015-01-01
SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world. The SHiP experiment is designed to be installed next to the SPS North Area. Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...
Why I Am Not SHY: A Reply to Tononi and Cirelli
Directory of Open Access Journals (Sweden)
Marcos Gabriel Frank
2013-01-01
Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.
The computer-assisted interview In My Shoes can benefit shy preschool children's communication
Salari, Raziye; Eriksson, Maria; Sarkadi, Anna
2017-01-01
Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534
TianShuiShi space breeding current situation and developing trend
International Nuclear Information System (INIS)
Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang
2011-01-01
TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)
Thermoelectric properties of Ca1-xYxMnO3 and Ca0.9Y0.1-yFeyMnO3 perovskite compounds
DEFF Research Database (Denmark)
Thuy, Nguyen Thi; Minh, Dang Le; Van Nong, Ngo
2012-01-01
Polycrystalline Ca1-xYxMnO3 (x = 0.0; 0.1; 0.3; 0.5; 0.7) and Ca0.9Y0.1-yFeyMnO3 (y = 0.00; 0.01; 0.03; 0.05) compounds were prepared by solid-state reaction. X-ray diffraction (XRD) analysis revealed all XRD peaks of all the samples as identical to the orthorhombic structure. The thermoelectric ...
Search for New Physics in SHiP and at future colliders
AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara
2015-01-01
SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\
The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality
Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.
2013-01-01
The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175
[Doctor HUANG Shi-ping's acupuncture with golden needles].
Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang
2013-08-01
Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.
First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector
Solovev, Vladimir
2017-01-01
This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.
Structure and Properties of the Fe/Y2O3 Interface from First Principles Calculations
International Nuclear Information System (INIS)
Choudhury, Samrat; Stanek, Christopher R.; Uberuaga, Blas P.
2012-01-01
Fundamentals of radiation damage are: (1) Formation of Frenkel pair (interstitial-vacancy pair) defects in the lattice; (2) Concentration of Frenkel pair defects >>> thermal equilibrium thermodynamic concentration; and (3) The radiation damage response of a material is determined by the fate of these excess Frenkel pair defects in the lattice. The objective is to understand the electronic and atomic structure of Fe/Y 2 O 3 interface and segregation behavior of the alloying elements at the interface. The significance of the results of this report are: (1) Provides a science based approach to design new radiation resistant materials. Obtained two controlling parameters - Dislocation density (composition, orientation relationship) and Oxygen partial pressure; (2) Applicable to any other metal/oxide interfaces (both functional and structural properties at the interface) - (a) Nano Catalysts: Oxide-supported metal catalysts Ni/ZrO 2 , (b) Thermal barrier coatings (Ni/Al 2 O 3 ), (c) Corrosion of metals and alloys.
Study of nu-tau properties with the SHiP experiment
AUTHOR|(CDS)2209555
The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...
Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.
Leichtman, Mara A
2009-07-01
The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.
Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee
2011-01-01
Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106
Directory of Open Access Journals (Sweden)
Shiuan-Pey Lin
2011-01-01
Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.
[Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].
Liu, Jian; Fan, Xiao-Nong; Wang, Shu
2014-01-01
Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.
Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja
2017-12-01
Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse
Markovic, Andrea; Bowker, Julie C
2015-01-01
A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.
ν{sub τ}-physics with the SHiP experiment
Energy Technology Data Exchange (ETDEWEB)
Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)
2016-07-01
SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.
Design of a detector to study associated charm production in the SHiP beam dump facility
Iuliano, Antonio; Di Crescenzo, Antonia
A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.
The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility
Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel
2015-01-01
The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.
Lu, Yi; Xu, Yuan
2018-01-01
The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…
Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.
Directory of Open Access Journals (Sweden)
M Ashraful Islam
Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.
SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis
Directory of Open Access Journals (Sweden)
Leandro H. Estornell
2018-02-01
Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.
Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs
Lanfranchi, Gaia
2017-01-01
This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.
Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation
Energy Technology Data Exchange (ETDEWEB)
Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)
2016-03-15
The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.
Extraction and beam transfer for the SHiP facility
Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno
2015-01-01
This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.
A facility to search for hidden particles at the CERN SPS: the SHiP physics case.
Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M
2016-12-01
This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.
Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...
African Journals Online (AJOL)
Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.
A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case
Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC
2016-10-24
This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....
Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS
SHiP Collaboration
2015-01-01
With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.
Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui
2016-01-01
The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…
International Nuclear Information System (INIS)
Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti
2015-01-01
Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications
[A review for a traditional Chinese medical journal Shou Shi Yi Bao].
Xiao, Mei-Hua; Sun, Wen-Zhong
2009-06-01
Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.
THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST
Directory of Open Access Journals (Sweden)
Alexander A. Kuznetsov
2014-01-01
Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.
The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East
Directory of Open Access Journals (Sweden)
Alexander A. Kuznetsov
2014-01-01
Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.
SHI induced irradiation effect on Mo/Si interface
International Nuclear Information System (INIS)
Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh
2006-01-01
Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)
Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.
Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J
2017-08-01
Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.
Energy Technology Data Exchange (ETDEWEB)
Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)
2015-06-15
Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.
Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.
Directory of Open Access Journals (Sweden)
Tsung-Hsien Li
Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.
Theall-Honey, Laura A; Schmidt, Louis A
2006-04-01
We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.
SHiP: a new multipurpose beam-dump experiment at the SPS.
AUTHOR|(SzGeCERN)387671
2016-01-01
SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...
Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants
DEFF Research Database (Denmark)
Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel
2013-01-01
of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...
Etude linguistique chez les Baráshi/Banyaambo du Rwanda
African Journals Online (AJOL)
User
ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...
De Lellis, Giovanni
2018-05-01
The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.
Directory of Open Access Journals (Sweden)
Irena Dzwonkowska
2007-12-01
Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.
Neutrino physics with the SHiP experiment
AUTHOR|(SzGeCERN)759942
2015-01-01
Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.
Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing
2012-01-01
This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193
De Lellis, G.; SHiP Collaboration
2016-07-01
The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.
Bonivento, Walter M.
2017-07-01
The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.
See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响
Institute of Scientific and Technical Information of China (English)
Liu Lili; Li Feng
2008-01-01
Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.
Search for hidden particles with the SHiP experiment
Energy Technology Data Exchange (ETDEWEB)
Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)
2016-07-01
Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.
The SHiP experiment at CERN SPS
Di Crescenzoon, A
2016-01-01
SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.
Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong
2017-08-12
According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.
Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.
2012-01-01
This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…
Neutrino scattering physics with the SHiP Experiment
AUTHOR|(CDS)2083090
2015-01-01
SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.
Neutrino scattering physics with the SHiP Experiment
Di Crescenzo, Antonia
2016-01-01
SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.
SHiP: a new facility to search for heavy neutrinos and study $\
De Serio, Marilisa
2016-01-01
SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\
Why investors shy away from coal
International Nuclear Information System (INIS)
Roling, D.A.
1994-01-01
Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed
International Nuclear Information System (INIS)
Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.
2016-01-01
The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.
Energy Technology Data Exchange (ETDEWEB)
Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in
2016-07-15
The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.
Directory of Open Access Journals (Sweden)
Bambang Suharno
2010-10-01
Full Text Available Die soldering (die sticking is a defect of metal casting in which molten metal “welds” to the metallic die mold surface during casting process. Die soldering is the result of an interface reaction between the molten aluminum and the die material. Aluminum alloy with 7 and 11% silicon and SKD 61 die steel are the most common melt and die material used in aluminum die casting. This research is done to study the morphology and the characteristics of the formed AlxFeySiz intermetallic layer during interface reaction at dipping test. The samples of as-anneal SKD 61 tool steel was dipped into the molten of Al-7%Si held at temperature 680oC and into molten Al-11%Si held at temperature 710oC with the different contact time of 10 minutes; 30 minutes; and 50 minutes. The research results showed that the interface reaction can form a compact intermetallic layer with AlxFey phase and a broken intermetallic layer with AlxFeySiz phase on the surface of SKD 61 tool steel. The increasing of the contact time by the immersion of material SKD 61 tool steel in both of molten Al-7%Si and Al-11%Si will increase the thickness of the AlxFeySiz intermetallic layer until an optimum point and then decreasing. The micro hardness of the AlxFeySiz intermetallic layer depends on the content of the iron. Increasing of the iron content in intermetallic layer will increase the micro hardness of the AlxFeySiz. This condition happened because the increasing of Fe content will cause forming of intermetallic AlxFeySiz phase becomes quicker.
Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti
2015-06-01
Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.
Zakharia, Zeena
2017-01-01
This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…
[Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].
Liu, F W
2017-07-28
The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.
First reliability test of a surface micromachined microengine using SHiMMeR
Energy Technology Data Exchange (ETDEWEB)
Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others
1997-08-01
The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.
Selective Internal Oxidation and Severe Plastic Deformation of Multiphase Fe-Y Alloys
Kachur, Stephen J.
Oxide dispersion strengthened (ODS) alloys are known for their desirable mechanical properties and unique microstructures. These alloys are characterized by an even dispersion of oxide phase throughout a metallic matrix, and exhibit high strength and enhanced creep properties at elevated temperatures. This makes them ideal candidate materials for use in many structural applications, such as coal-fired power plants or in next generation nuclear reactors. Currently most often produced by mechanical alloying, a powder metallurgy based process that utilizes high energy ball milling, these alloys are difficult and costly to produce. One proposed method for forming ODS alloys without high-energy ball milling is to internally oxidize a bulk alloy before subjecting it to severe plastic deformation to induce an even oxide distribution. This work examines such a processing scheme with a focus on the internal oxidation behavior. Internal oxidation has been shown to occur orders of magnitude faster than expected in multi-phase alloys where a highly reactive oxidizable solute has negligible solubility and diffusivity in other, more-noble, phases. Commonly referred to as in situ oxidation, this accelerated oxidation process has potential for use in a processing scheme for ODS alloys. While in situ oxidation has been observed in many different alloy systems, a comprehensive study of alloy composition and microstructure has not been performed to describe the unusual oxidation rates. This work used Fe-Y binary alloys as model system to study effects of composition and microstructure. These alloys have been shown to exhibit in situ oxidation, and additionally, Y is typically introduced during mechanical alloying to form Y-rich oxides in Fe-based ODS alloys. Alloys with Y content between 1.5 and 15 wt% were prepared using a laboratory scale arc-melting furnace. These alloys were two phase mixtures of Fe and Fe17Y2. First, samples were oxidized between 600 and 800 °C for 2 to 72
Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J
2015-01-01
The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data
Directory of Open Access Journals (Sweden)
Robin B Thomson
Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as
Prevalence of consanguineous marriages among shi'a populations of Lebanon.
El-Kheshen, Ghadir; Saadat, Mostafa
2013-09-01
In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).
Directory of Open Access Journals (Sweden)
M. Carmen Hidalgo
2017-04-01
Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being
Directory of Open Access Journals (Sweden)
Shevchenko V.
2017-01-01
Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.
Holt, Maria
2013-03-01
In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.
Brouwer, Albert; Brown, David; Tomuta, Elena
2017-04-01
To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.
Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan
Directory of Open Access Journals (Sweden)
Stefania Travagnin
2006-01-01
Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.
Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome
International Nuclear Information System (INIS)
Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.
1984-01-01
A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)
arXiv Search for new physics with the SHiP experiment at CERN
Lantwin, Oliver
2017-12-01
SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...
Energy Technology Data Exchange (ETDEWEB)
Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)
2014-02-25
Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.
Energy Technology Data Exchange (ETDEWEB)
Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)
2016-07-15
Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.
Directory of Open Access Journals (Sweden)
R. A. Vargas
2008-09-01
Full Text Available Na síntese de materiais, muitos desafios estão relacionados com propriedades requeridas, levando pesquisadores a buscarem materiais alternativos que possuam características adequadas para funcionarem como componentes nas células a combustível de óxido sólido. Atualmente, os materiais mais estudados como catodos são os óxidos mistos La1-X SrX MnO3±δ e La1-X SrX Co1-Y FeY O3-δ. Neste trabalho utilizaram-se como precursores os nitratos dos respectivos elementos químicos. O objetivo é apresentar algumas características físicas, químicas e microestruturais desses materiais, obtidos pela técnica dos citratos. As principais análises utilizadas para caracterização foram: análise termogravimétrica, calorimetria diferencial de varredura, picnometria por gás hélio, fluorescência de raios X, cromatografia de absorção gasosa, distribuição granulométrica por espalhamento laser, adsorção gasosa, difração de raios X e microscopia eletrônica de varredura. Os resultados mostram que as composições estudadas contem partículas homogêneas com presença de carbono residual, áreas de superfícies específicas adequadas e tamanho médio de partículas inferiores a 1 mm. As propriedades estudadas estão compatíveis com dados da literatura. Conclui-se que os compostos sintetizados possibilitam o estudo e preparação de suspensões cerâmicas para fabricação de filmes finos.In the synthesis of ceramic materials, new challenges are related with the intrinsic properties. Consequently, researchers look for alternative materials with adjusted characteristics for components in solid oxide fuel cells. Currently, the most studied materials as cathode are oxides: La1-X SrX MnO3±δ and La1-X SrX Co1-Y FeY O3-δ. In this work, the nitrates of the respective chemical elements were used as raw materials. The objective of this work is to present the physical, chemical and microstructural characteristics of these materials, prepared by the
Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg
2016-01-01
The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.
Bonivento, Walter M.
2018-02-01
This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.
Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René
2016-07-01
The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.
2018-01-01
This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.
The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.
Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo
2014-01-01
Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.
Directory of Open Access Journals (Sweden)
Igino Andrighetto
2010-01-01
Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.
The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan
Directory of Open Access Journals (Sweden)
Chin-Ping Lin
2014-01-01
Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.
Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.
2012-01-01
When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient
Institute of Scientific and Technical Information of China (English)
李涛; 郭海玲; 杨光月; 商海滨; 赵咏芳
2017-01-01
目的:研究石氏针刺结合复方紫荆消伤膏外用治疗急性踝关节扭伤早期症状改善特点,评价石氏针刺结合外用膏药治疗急性踝关节扭伤、弹力绷带固定治疗和功能锻炼治疗的优效性.方法:对上海市浦东新区6家医院2014年1月至2016年10月收治的300例急性踝关节扭伤患者随机分为针药结合治疗组、弹力绷带固定组和功能锻炼组,三组受试者分别予石氏针刺结合膏药外用治疗,弹力绷带固定结合膏药治疗和功能锻炼处方结合膏药治疗.在入组时(入组)、第7天(第1周、访视一)、第28天(第4周、访视二)和第42天(第6周、访视三)采用美国足踝外科学会AOFAS踝后足评分量表、VAS疼痛评分进行优效性评价.结果:三种治疗方法对急性踝关节扭伤均有疗效(P<0.05).在第7天,针药结合组AOFAS评分与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组AOFAS评分高于绷带固定组和功能锻炼组评分.在第7天、第28天针药结合组VAS疼痛评分变化与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组VAS疼痛评分改善大于弹力绷带固定组和功能锻炼组.针药结合组AOFAS疗效评定痊愈率和VAS疼痛疗效评定痊愈率高于绷带固定组和功能锻炼组(P<0.05).结论:石氏针药结合治疗急性踝关节扭伤临床疗效明确,对损伤早期的疼痛改善和功能恢复疗效优于弹力绷带固定治疗和功能锻炼治疗.%Objective:To study the improvement characteristics of early symptoms of acute ankle sprain treated with the Shi's acupuncture therapy combined with compound Zijing plaster,and to evaluate the superiority of the Shi's therapy combined with topical plaster,elastic bandage fixation and functional exercise therapy in the treatment of acute ankle sprain.Methods:All 300 cases of acute ankle sprain patients were randomly assigned to groups of Shi's therapy
AUTHOR|(SzGeCERN)658186
2016-01-01
SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...
Directory of Open Access Journals (Sweden)
Lucas Alécio Gomes
2012-10-01
Full Text Available Hyperadrenocorticism can be defined as a chronic high circulating cortisol, and is a relatively common disease in dogs when compared to cats. Of dogs with naturally occurring HAC, 80 to 85% have pituitary-dependent hyperadrenocorticism (PDH, which is an excessive secretion of ACTH by the pituitary, causing bilateral adrenal hyperplasia and excessive secretion of glucocorticoids. More than 90% of dogs with PDH have a pituitary tumor. The aim of this article is to report a case of a dog, seven years old, female, Shi Tzu, that presented with panting, polyuria/polydipsia, polyphagia, pendulous abdomen and bilateral abdominal alopecia, and intermittent weakness in the pelvic limbs. Based on laboratorial and screening tests a pituitary-dependent hyperadrenocorticism was diagnosed and treated with twice-daily trilostane, orally. In the early monitoring period, ACTH test was performed with an unusual interval (to 30 days. In this case, the starting dose didn’t show improvement in the cutaneous alterations, requiring an increase on the dosage. Hiperadrenocorticismo (HAC é uma doença relativamente comum em cães quando comparado aos gatos e pode ser definido como aumento persistente do cortisol na circulação sanguínea. Quanto ao tipo de manifestação o HAC hipófise-dependente ocorre em 80 a 85% dos casos, causando secreção excessiva de ACTH pela hipófise levando ao aumento bilateral das glândulas adrenais. Mais de 90% dos casos de HAC hipófise-dependente (em cães ocorrem devido a tumores na glândula. O objetivo deste trabalho é relatar o caso de uma cadela da raça Shi Tzu, com sete anos de idade, que apresentou respiração ofegante, poliúria/polidipsia, polifagia, abdome pendular, alopecia bilateral simétrica e fraqueza intermitente em membros pélvicos. Os exames laboratoriais de rotina associados aos testes de triagem confirmaram a suspeita de hiperadrenocorticismo hipófise dependente. O tratamento desde o início tem sido com
Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动
Institute of Scientific and Technical Information of China (English)
李秋菊
2017-01-01
流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi
Directory of Open Access Journals (Sweden)
Mobo Gao
2007-01-01
Full Text Available With the rise of China's status on international stage as a result of its economic development there is an increasingly audible voice of Chinese cultural nationalism. More and more educators and intellectuals are calling for the revival of Chinese traditional culture values. However, the very issues of who are the Chinese and what are traditional Chinese cultural values present a huge dilemma. The debates on a recent a TV program "General Shi Lang" consist a good case to illustrate this dilemma. Shi Lang was a general of the last days of the Ming Dynasty, but had surrendered to the Manchu Qing dynasty invaders and fought for the Machus take over Taiwan from a Chinese ruler. The debates show that the dilemma has its cause in at least three issues. First, it is not at all obvious who should be categorized as Chinese. Secondly, it is not at all obvious what Chinese cultural values are. And finally it is the issue of evaluation of traditional values against the universal claim of the values of liberal democracy.
Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin
2015-06-01
The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.
Energy Technology Data Exchange (ETDEWEB)
Iida, Toshihiko; Kojina, Kyoji
1999-03-01
On the owned tenure, the average construction-started ratio spreaded from 1.15 houses in Amagasaki-shi to 6.30 houses in Hamamatsu-shi during 1983 {approx} 1987, the same values spreaded from 1.42 houses in Amagasaki-shi to 5083 houses in Akita-shi during 1988 {approx} 1992 and the same values spreaded from 1.44 houses in Osaka-shi to 6.67 houses in Aomori-shi during 1993 {approx} 1997. 2nd on the rental tenure, the average construction-started ratio spreaded from 1.88 house in Sakai-shi to 14.32 houses in Ichikawa-shi during 1983 {approx} 1987, the same values spreaded from 3.72 houses in Sakai-shi to 13.93 houses in Kawasaki-shi during 1988 {approx} 1992 and from 2.82 houses in Yokosuka-shi to 9.88 houses in Sendai-shi during 1993 {approx} 1997, espicialy 13.17 houses in Nishinomiya-shi. 3rd on the issued tenure, the average construction-started ratio spreaded from 0.05 houses in Maebashi-shi 0.45 houses in Mito-shi during 1983 {approx} 1992 and from 0.02 houses in Naha-shi to 0.74 houses in Omiya-shi during 1993 {approx} 1997, espicialy 1.00 houses in Nishinomiya-shi. 4th on the for-sale tenure, the average construction-started ratio spraeded from 0.36 houses in Kurashiki-shi 5.65 houses in Kobe-shi during 1983 {approx} 1987, the same values spreaded from 0.89 houses in Iwaki-shi and Fukui-shi to 6.14 houses in Fukuoka-shi during 1988 {approx} 1992 and from 0.63 houses in Kurashiki-shi to 7.51 houses in Urawa-shi during 1993 {approx} 1997, especially 8.66 houses in Nishinomiya-shi. The construction-started hoses of the rental tenure were leading during this fifteen years, but the construction-started houses of the for-sale tenure were increasing recently in Japan, though the same values of the owned tenure were continuing during this periods. At 80 cities the construction-started ratio of the rental tenure spreaded from 2.61 houses in Kitakyushu-shi to 12.01 houses in Hachioji-shi on 1993, the same values spreaded from 2.41 houses in Toyota-shi to 9.98 houses in
South African Journal of Geomatics, Vol. 4, No. 4, November 2015 ...
African Journals Online (AJOL)
user
deterioration of its quality (Amissah-Arthur and Miller, 2002; Sigwela et al; 2009). The effects felt ... calculation of each land cover class landscape metric. ..... Mills, A.J., Cowling, R.M., Fey, M.V., Kerley, G.I.H., Donaldson, J.S., Lechmere-Oertel,.
Yan, Xuemei; Zhang, Qianying; Feng, Fang
2016-04-01
Da-Huang-Xiao-Shi decoction, consisting of Rheum officinale Baill, Mirabilitum, Phellodendron amurense Rupr. and Gardenia jasminoides Ellis, is a traditional Chinese medicine used for the treatment of jaundice. As described in "Jin Kui Yao Lue", a traditional multistep decoction of Da-Huang-Xiao-Shi decoction was required while simplified one-step decoction was used in recent repsorts. To investigate the chemical difference between the decoctions obtained by the traditional and simplified preparations, a sensitive and reliable approach of high-performance liquid chromatography coupled with diode-array detection and electrospray ionization time-of-flight mass spectrometry was established. As a result, a total of 105 compounds were detected and identified. Analysis of the chromatogram profiles of the two decoctions showed that many compounds in the decoction of simplified preparation had changed obviously compared with those in traditional preparation. The changes of constituents would be bound to cause the differences in the therapeutic effects of the two decoctions. The present study demonstrated that certain preparation methods significantly affect the holistic quality of traditional Chinese medicines and the use of a suitable preparation method is crucial for these medicines to produce special clinical curative effect. This research results elucidated the scientific basis of traditional preparation methods in Chinese medicines. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
On the Computer Generation of Adaptive Numerical Libraries
2010-05-01
D.; Borowski, P.; Clark, T.; Clerc, D.; Dachsel, H.; Deegan , M.; Dyall, K.; Elwood, D.; Bibliography 123 Glendening, E.; Gutowski, M.; Hess, A...Science, pages 72–83. Springer, 2007. 84 Curry, Haskell B.; Feys, Robert; Craig , William. Combinatory Logic, volume 1. North-Holland Publishing
Xie, Man; Luo, Rui; Lu, Jun; Chen, Renjie; Wu, Feng; Wang, Xiaoming; Zhan, Chun; Wu, Huiming; Albishri, Hassan M; Al-Bogami, Abdullah S; El-Hady, Deia Abd; Amine, Khalil
2014-10-08
Research on sodium batteries has made a comeback because of concern regarding the limited resources and cost of lithium for Li-ion batteries. From the standpoint of electrochemistry and economics, Mn- or Fe-based layered transition metal oxides should be the most suitable cathode candidates for affordable sodium batteries. Herein, this paper reports a novel cathode material, layered Na1+x(Fey/2Niy/2Mn1-y)1-xO2 (x = 0.1-0.5), synthesized through a facile coprecipitation process combined with subsequent calcination. For such cathode material calcined at 800 °C for 20 h, the Na/Na1+x(Fey/2Niy/2Mn1-y)1-xO2 (x = 0.4) electrode exhibited a good capacity of 99.1 mAh g(-1) (cycled at 1.5-4.0 V) and capacity retention over 87% after 50 cycles. Optimization of this material would make layered transition metal oxides a strong candidate for the Na-ion battery cathode.
2012-08-21
..., Cando, North Dakota; Timothy Dodd and Bradley Fey, both of Bismarck, North Dakota; Jeffrey Topp, Grace City, North Dakota; Janet Topp, Grace City, North Dakota; and Roger Kenner, Leeds, North Dakota; as a... (Jacqueline G. King, Community Affairs Officer) 90 Hennepin Avenue, Minneapolis, Minnesota 55480-0291: 1. MVC...
Directory of Open Access Journals (Sweden)
Masayuki Takahashi
Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.
Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing
2014-02-12
The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction
Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi
Directory of Open Access Journals (Sweden)
Curie Virág
2014-10-01
Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.
International Nuclear Information System (INIS)
Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.
2013-01-01
Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail
Energy Technology Data Exchange (ETDEWEB)
Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)
2013-12-15
Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.
Fostering Persistence: 3D Printing and the Unforeseen Impact on Equity
FitzPatrick, Daniel L.; Dominguez, Victoria S.
2017-01-01
Teaching persistence and problem solving must begin with selecting a problem that can be solved mathematically, that allows for multiple methods of solving, and that generally captures the attention and curiosity of the student (Marcus and Fey 2003; NCTM 1991; Van de Walle 2003). This article shows how a STEM three-dimensional (3D) printing…
Energy Technology Data Exchange (ETDEWEB)
Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)
2017-03-01
Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.
Differentiating Social Phobia from Shyness
Heiser, Nancy A.; Turner, Samuel M.; Beidel, Deborah C.; Roberson-Nay, Roxann
2008-01-01
To clarify the relationship between social phobia and shyness, this study examined the characteristics of highly shy persons with social phobia, highly shy persons without social phobia, and non-shy persons. Those with social phobia reported more symptomatology, more functional impairment, and a lower quality of life than those without social phobia. About one-third of the highly shy without social phobia reported no social fears, highlighting heterogeneity of the shy. The social phobia group...
Phase equilibria and microstructure in Sr4Fe6-xCoxO13 0 <= x <= 4 mixed conductors
DEFF Research Database (Denmark)
Fossdal, A.; Sagdahl, L.T.; Einarsrud, M.A.
2001-01-01
CozO3-delta and Co1-yFeyO were observed with increasing sintering temperature and increasing Co-content due to the limited solubility of Co in Sr4Fe6-xCoxO13. The thermal expansion coefficient of the materials deviates from linear behavior due to the decreasing oxidation state of iron with increasing...
Tao, Yi; Huang, Surun; Gu, Xianghui; Li, Weidong; Cai, Baochang
2018-05-30
Alkaline phosphatase conjugated magnetic microspheres were synthesized via amide reaction, and employed as an effective adsorbent in affinity selection of binding ligands followed by UHPLC-Q-TOF/MS analysis. The analytical validity of the developed approach was evaluated under optimized conditions and the following figures of merit were obtained: linearity, 0.01-0.5 g L -1 with good determination coefficients (R 2 = 0.9992); limits of detection (LODs), 0.003 g L -1 ; and limits of quantitation (LOQ), 0.01 g L -1 . The precision (RSD%) of the proposed affinity selection approach was studied based on intra-day (0.8%) and inter-day (1.3%) precisions. Finally, the adsorbent was successfully applied to identification of binding ligands in Li-Dan-Hua-Shi pills and good recoveries were obtained in the range from 96.9 to 99.4% (RSDs 1.6-3.0%). Copyright © 2018 Elsevier B.V. All rights reserved.
Review of the genus Pentacentrus Saussure (Orthoptera: Gryllidae: Pentacentrinae) from China .
Liu, Hao-Yu; Mao, Shao-Li; Shi, Fu-Ming
2014-07-22
Four new species of Pentacentrus Gorochov from China are described and illustrated, P. acutiparamerus Liu & Shi sp. nov., P. biflexuous Liu & Shi sp. nov., P. emarginatus Liu & Shi sp. nov. and P. parvulus Liu & Shi sp. nov. A key and a distribution map of the Chinese species of this genus are provided.
Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei
2014-05-01
Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.
DEFF Research Database (Denmark)
Andersen, Merethe K; Pedersen, Line B; Dupont, Michael
2017-01-01
Background.: Supplemental health insurances (SHI) cover 38% of the Danish population. SHI can give faster access to, and additional treatment from, private health providers. However, this is contingent on a referral from the general practitioner (GP), further complicating clinical decision...... to 3321 GPs focusing on three issues: (i) Attitudes towards the public health care system. (ii) Perceptions of the impact of SHI. (iii) Experiences with patients holding SHIs. Results.: The response rate was 64%. Overall, GPs found that SHIs contribute to inequality (83%) and overtreatment (90%). However...... a majority of GPs associate SHI with overtreatment and inequality in health, many GPs feel under pressure to refer patients holding SHI for treatments or examinations that are not medically warranted. Some GPs even refer these patients without further examination or questioning. Insistent SHI patients may...
Differentiating social phobia from shyness.
Heiser, Nancy A; Turner, Samuel M; Beidel, Deborah C; Roberson-Nay, Roxann
2009-05-01
To clarify the relationship between social phobia and shyness, this study examined the characteristics of highly shy persons with social phobia, highly shy persons without social phobia, and non-shy persons. Those with social phobia reported more symptomatology, more functional impairment, and a lower quality of life than those without social phobia. About one-third of the highly shy without social phobia reported no social fears, highlighting heterogeneity of the shy. The social phobia group reported similar levels of anxiety as the shy without social phobia during analogue conversation tasks, but they reported more anxiety during a speech task. The social phobia group performed less effectively across tasks than those without social phobia. All groups' perceptions of anxiety and effectiveness during behavioral tasks were consistent with ratings of independent observers. None of the groups differed on psychophysiological measures. Results are discussed in the context of theoretical models of social phobia.
March, S; Powietzka, J; Stallmann, C; Swart, E
2015-02-01
Since 1970 the health insurance system in Germany has shrunk by more than 90% to 132 statutory health insurance funds (SHI) at present. For studies using data from different SHI, this development means a reduction of contacts and a higher workload when requesting data. The latter is due to the fact that fusions bind resources in the health insurance funds. In order to avoid selection in studies among the insured, all SHI must be contacted. Additionally, 15 controlling institutions on the state and national level have to agree as determined in § 75 of the German Social Code number 10. The lidA study - a German cohort study on work, age and health intends to link primary and secondary data from all SHI of those insured who have given their agreement for participation. Since the beginning of the study in 2009 the number of SHI has been reduced by 70. Of the 6 585 interviews in 2011 approximately half of the interviewees agreed in written form that their individual health insurance data can be linked. This portion of the insured is dispersed among 95 SHI. At this point, 11 contracts with SHI are realised (approximately 50% of the insured) and 8 data controlling authorities have been contacted. The problems involved in the fusion of SHI and its meaning for research are explained in this article. The fusion of SHI makes sense for the long term. It will lead to a reduction of contacts and contracts that researchers have to establish in order to analyse the data. Therefore, this article also discusses the alternative of creating a meta-data set of all the data from the different SHI combined. © Georg Thieme Verlag KG Stuttgart · New York.
Lee, Joo Yong; Kim, Jae Heon; Kang, Dong Hyuk; Chung, Doo Yong; Lee, Dae Hun; Do Jung, Hae; Kwon, Jong Kyou; Cho, Kang Su
2016-04-01
We investigated whether stone heterogeneity index (SHI), which a proxy of such variations, was defined as the standard deviation of a Hounsfield unit (HU) on non-contrast computed tomography (NCCT), can be a novel predictor for shock-wave lithotripsy (SWL) outcomes in patients with ureteral stones. Medical records were obtained from the consecutive database of 1,519 patients who underwent the first session of SWL for urinary stones between 2005 and 2013. Ultimately, 604 patients with radiopaque ureteral stones were eligible for this study. Stone related variables including stone size, mean stone density (MSD), skin-to-stone distance, and SHI were obtained on NCCT. Patients were classified into the low and high SHI groups using mean SHI and compared. One-session success rate in the high SHI group was better than in the low SHI group (74.3% vs. 63.9%, P = 0.008). Multivariate logistic regression analyses revealed that smaller stone size (OR 0.889, 95% CI: 0.841-0.937, P < 0.001), lower MSD (OR 0.995, 95% CI: 0.994-0.996, P < 0.001), and higher SHI (OR 1.011, 95% CI: 1.008-1.014, P < 0.001) were independent predictors of one-session success. The radiologic heterogeneity of urinary stones or SHI was an independent predictor for SWL success in patients with ureteral calculi and a useful clinical parameter for stone fragility.
Magnetic studies of Fe-Y compositionally modulated thin films
International Nuclear Information System (INIS)
Badia, F.; Ferrater, C.; Lousa, A.; Martinez, B.; Labarta, A.; Tejada, J.
1990-01-01
Compositionally modulated thin films of Y/Fe have been studied by using SQUID magnetometry. Samples were grown by electron-beam evaporation onto Kapton substrates. In the low applied field regime, the samples show irreversible behavior when they are submitted to ZFC-FC magnetization processes, increasing the irreversibility zone as the thickness of the Fe layers increases. In the high applied magnetic field regime (H≥10 000 Oe), samples show ferromagnetic behavior. The temperature dependence of the saturation magnetization has been studied, and it was found that both spin-wave excitations and Stoner excitations occur at temperatures higher than 40 K, and a marked deviation from the T 3/2 law was noted below 30 K
Ascaribay Andrade, Saúl Geovani
2013-01-01
El presente trabajo de grado trata sobre la implementación de un equipo de laboratorio para el análisis comparativo de la leche entre tres razas de vacas, (Holstein, Jersey y Criollas), este análisis se lo realizo en la Asociación de Productores Agropecuarios de la comuna indígena de Shiña perteneciente al cantón Nabón provincia del Azuay, los parámetros a ser analizados están basados dentro de las normas técnicas que dicta el INEN, las normas que fueron analizadas fueron: Leche Cruda Requisi...
75 FR 60761 - Government-Owned Inventions; Availability for Licensing
2010-10-01
... related to drug resistance. Inventors: Genbin Shi, Gary Shaw, Xinhua Ji (NCI). Patent Status: U.S... Publications: 1. Blaszczyk J, Shi G, Li Y, Yan H, Ji X. Reaction trajectory of pyrophosphoryl transfer...: 15016362]. 2. Blaszczyk J, Shi G, Yan H, Ji X. Catalytic center assembly of HPPK as revealed by the crystal...
Smart home in a box: usability study for a large scale self-installation of smart home technologies.
Hu, Yang; Tilke, Dominique; Adams, Taylor; Crandall, Aaron S; Cook, Diane J; Schmitter-Edgecombe, Maureen
2016-07-01
This study evaluates the ability of users to self-install a smart home in a box (SHiB) intended for use by a senior population. SHiB is a ubiquitous system, developed by the Washington State University Center for Advanced Studies in Adaptive Systems (CASAS). Participants involved in this study are from the greater Palouse region of Washington State, and there are 13 participants in the study with an average age of 69.23. The SHiB package, which included several different types of components to collect and transmit sensor data, was given to participants to self-install. After installation of the SHiB, the participants were visited by researchers for a check of the installation. The researchers evaluated how well the sensors were installed and asked the resident questions about the installation process to help improve the SHiB design. The results indicate strengths and weaknesses of the SHiB design. Indoor motion tracking sensors are installed with high success rate, low installation success rate was found for door sensors and setting up the Internet server.
Wang, Daojun; Gong, Jianhua; Ma, Ainai; Li, Wenhang; Wang, Xijun
2005-10-01
There are generally two kinds of approaches to studying geomorphic features in terms of the quantification level and difference of major considerations. One is the earlier qualitative characterization, and the other is the 2-dimension measurement that includes section pattern and projection pattern. With the development of geo-information technology, especially the 3-D geo-visualization and virtual geographic environments (VGE), 3-dimension measurement and dynamic interactive between users and geo-data/geo-graphics can be developed to understand geomorphic features deeply, and to benefit to the effective applications of such features for geographic projects like dam construction. Storage-elevation curve is very useful for site selection of projects and flood dispatching in water conservancy region, but it is just a tool querying one value from the other one. In fact, storage-elevation curve can represent comprehensively the geomorphic features including vertical section, cross section of the stream and the landform nearby. In this paper, we use quadratic regression equation shaped like y = ax2 + bx + c and the DEM data of Hong-Shi-Mao watershed, Zi Chang County, ShaanXi Province, China to find out the relationship between the coefficients of the equation and the geomorphic features based on VGE platform. It's exciting that the coefficient "a" appear to be correlative strongly with the stream scale, and the coefficient "b" may give an index to the valley shape. In the end, we use a sub-basin named Hao-Jia-Gou of the watershed as an application. The result of correlative research about quadratic regression equation and geomorphic features can save computing and improve the efficiency in silt dam systems planning.
[Use of routine data from statutory health insurances for federal health monitoring purposes].
Ohlmeier, C; Frick, J; Prütz, F; Lampert, T; Ziese, T; Mikolajczyk, R; Garbe, E
2014-04-01
Federal health monitoring deals with the state of health and the health-related behavior of populations and is used to inform politics. To date, the routine data from statutory health insurances (SHI) have rarely been used for federal health monitoring purposes. SHI routine data enable analyses of disease frequency, risk factors, the course of the disease, the utilization of medical services, and mortality rates. The advantages offered by SHI routine data regarding federal health monitoring are the intersectoral perspective and the nearly complete absence of recall and selection bias in the respective population. Further, the large sample sizes and the continuous collection of the data allow reliable descriptions of the state of health of the insurants, even in cases of multiple stratification. These advantages have to be weighed against disadvantages linked to the claims nature of the data and the high administrative hurdles when requesting the use of SHI routine data. Particularly in view of the improved availability of data from all SHI insurants for research institutions in the context of the "health-care structure law", SHI routine data are an interesting data source for federal health monitoring purposes.
1983-01-01
laftatog Do" 4蔖 Persea Astbag (3)10Priaray Uttl (1) W".L M5 I’Visoxy I -est sub"~ W"o 210 oom~fey Aspot lumberZ40 COtnc Number b ago 22C...I L..i.~. AMERICAN 31?1031J. S11331303 X35111311 AIIICAS 3..fl01L, SPIUDIID 22CXNICAL U&POIT dJIIb2M J-0-l) .~ ~ TAB STAR IS CONPOSIO OP TH336 PA13S3
Hizbollah–Syrian Intelligence Affairs: A Marriage of Convenience
Directory of Open Access Journals (Sweden)
Carl Anthony Wege
2011-01-01
Full Text Available Since the 1980s, Hizbollah has emerged as the guardian of Lebanon's Shi'a and a stalking horse for Iran. Syria, though allied with Tehran, seeks to manage Hizbollah's freedom of action in Lebanon and is eyed cautiously in Damascus. Hizbollah has managed to maintain independence from these Syrian efforts because of both Lebanese Shi'a religious élan and the protection given Hizbollah by its Shi'a allies in Iran.
Schwierz, Christoph; Wübker, Achim; Wübker, Ansgar; Kuchinke, Björn A
2011-10-01
This paper shows that patients with private health insurance (PHI) are being offered significantly shorter waiting times than patients with statutory health insurance (SHI) in German acute hospital care. This behavior may be driven by the higher expected profitability of PHI relative to SHI holders. Further, we find that hospitals offering private insurees shorter waiting times when compared with SHI holders have a significantly better financial performance than those abstaining from or with less discrimination.
Directory of Open Access Journals (Sweden)
D. Herckenrath
2013-10-01
Full Text Available Increasingly, ground-based and airborne geophysical data sets are used to inform groundwater models. Recent research focuses on establishing coupling relationships between geophysical and groundwater parameters. To fully exploit such information, this paper presents and compares different hydrogeophysical inversion approaches to inform a field-scale groundwater model with time domain electromagnetic (TDEM and electrical resistivity tomography (ERT data. In a sequential hydrogeophysical inversion (SHI a groundwater model is calibrated with geophysical data by coupling groundwater model parameters with the inverted geophysical models. We subsequently compare the SHI with a joint hydrogeophysical inversion (JHI. In the JHI, a geophysical model is simultaneously inverted with a groundwater model by coupling the groundwater and geophysical parameters to explicitly account for an established petrophysical relationship and its accuracy. Simulations for a synthetic groundwater model and TDEM data showed improved estimates for groundwater model parameters that were coupled to relatively well-resolved geophysical parameters when employing a high-quality petrophysical relationship. Compared to a SHI these improvements were insignificant and geophysical parameter estimates became slightly worse. When employing a low-quality petrophysical relationship, groundwater model parameters improved less for both the SHI and JHI, where the SHI performed relatively better. When comparing a SHI and JHI for a real-world groundwater model and ERT data, differences in parameter estimates were small. For both cases investigated in this paper, the SHI seems favorable, taking into account parameter error, data fit and the complexity of implementing a JHI in combination with its larger computational burden.
Aleksić, M.; Koprivanac, N.; Lončarić Božić, A.; Kušić, H.
2010-01-01
The study aimed to investigate the potential of Fe-exchanged zeolites of Y-type as a catalyst in heterogeneous Fenton-type processes for the degradation of model organic pollutant, reactive azo dye C.I. Reactive Blue 137, in water. The research work was directed to investigate the influence of process variables, such as FeY catalyst dosage, Fenton reagent ratio, and initial operating pH on the efficiency of the treatment process. The performance of the studied heterogeneous process was compar...
Wilson, Mike; Double, Oliver
2003-01-01
Valentin Ludwig Fey was born on 4 June 1882 in the Munich suburb of Au, effectively the only child of an artisan-class family – his sister and two brothers all died in early childhood before Valentin Ludwig was even six months old. Valentin himself only narrowly survived a childhood encounter with diptheria (all of which, perhaps unsurprisingly, contributed to his ever-increasing hypochondria1), but he went on to become Karl Valentin, arguably the most famous German comedian and cabaret perfo...
Extension of NHWAVE to Couple LAMMPS for Modeling Wave Interactions with Arctic Ice Floes
2015-09-30
Modelling, in press. Orzech, M., Shi, F., Veeramony, J., Bateman , S., Calantoni, J., and Kirby, J. T., 2015, “Incorporating floating surface...objects into a fully dispersive surface wave model”, Ocean Modelling, submitted. Bateman , S. Shi, F., Orzech, M., Veeramony, J., and Calantoni, J., 2014...Orzech, M., Shi, F., Calantoni, J., Bateman , S., and Veeramony, J., “Small-scale modeling of waves and floes in the Marginal Ice Zone”, 2014 Fall Meeting of the American Geophysical Union.
Complete genome sequence of Shigella flexneri 5b and comparison with Shigella flexneri 2a
Directory of Open Access Journals (Sweden)
Xue Ying
2006-07-01
Full Text Available Abstract Background Shigella bacteria cause dysentery, which remains a significant threat to public health. Shigella flexneri is the most common species in both developing and developed countries. Five Shigella genomes have been sequenced, revealing dynamic and diverse features. To investigate the intra-species diversity of S. flexneri genomes further, we have sequenced the complete genome of S. flexneri 5b strain 8401 (abbreviated Sf8401 and compared it with S. flexneri 2a (Sf301. Results The Sf8401 chromosome is 4.5-Mb in size, a little smaller than that of Sf301, mainly because the former lacks the SHI-1 pathogenicity island (PAI. Compared with Sf301, there are 6 inversions and one translocation in Sf8401, which are probably mediated by insertion sequences (IS. There are clear differences in the known PAIs between these two genomes. The bacteriophage SfV segment remaining in SHI-O of Sf8401 is clearly larger than the remnants of bacteriophage SfII in Sf301. SHI-1 is absent from Sf8401 but a specific related protein is found next to the pheV locus. SHI-2 is involved in one intra-replichore inversion near the origin of replication, which may change the expression of iut/iuc genes. Moreover, genes related to the glycine-betaine biosynthesis pathway are present only in Sf8401 among the known Shigella genomes. Conclusion Our data show that the two S. flexneri genomes are very similar, which suggests a high level of structural and functional conservation between the two serotypes. The differences reflect different selection pressures during evolution. The ancestor of S. flexneri probably acquired SHI-1 and SHI-2 before SHI-O was integrated and the serotypes diverged. SHI-1 was subsequently deleted from the S. flexneri 5b genome by recombination, but stabilized in the S. flexneri 2a genome. These events may have contributed to the differences in pathogenicity and epidemicity between the two serotypes of S. flexneri.
Hu, Yue-Houng; Rottmann, Joerg; Fueglistaller, Rony; Myronakis, Marios; Wang, Adam; Huber, Pascal; Shedlock, Daniel; Morf, Daniel; Baturin, Paul; Star-Lack, Josh; Berbeco, Ross
2018-02-01
While megavoltage cone-beam computed tomography (CBCT) using an electronic portal imaging device (EPID) provides many advantages over kilovoltage (kV) CBCT, clinical adoption is limited by its high doses. Multi-layer imager (MLI) EPIDs increase DQE(0) while maintaining high resolution. However, even well-designed, high-performance MLIs suffer from increased electronic noise from each readout, degrading low-dose image quality. To improve low-dose performance, shift-and-bin addition (ShiBA) imaging is proposed, leveraging the unique architecture of the MLI. ShiBA combines hardware readout-binning and super-resolution concepts, reducing electronic noise while maintaining native image sampling. The imaging performance of full-resolution (FR); standard, aligned binned (BIN); and ShiBA images in terms of noise power spectrum (NPS), electronic NPS, modulation transfer function (MTF), and the ideal observer signal-to-noise ratio (SNR)—the detectability index (d‧)—are compared. The FR 4-layer readout of the prototype MLI exhibits an electronic NPS magnitude 6-times higher than a state-of-the-art single layer (SLI) EPID. Although the MLI is built on the same readout platform as the SLI, with each layer exhibiting equivalent electronic noise, the multi-stage readout of the MLI results in electronic noise 50% higher than simple summation. Electronic noise is mitigated in both BIN and ShiBA imaging, reducing its total by ~12 times. ShiBA further reduces the NPS, effectively upsampling the image, resulting in a multiplication by a sinc2 function. Normalized NPS show that neither ShiBA nor BIN otherwise affects image noise. The LSF shows that ShiBA removes the pixilation artifact of BIN images and mitigates the effect of detector shift, but does not quantifiably improve the MTF. ShiBA provides a pre-sampled representation of the images, mitigating phase dependence. Hardware binning strategies lower the quantum noise floor, with 2 × 2 implementation reducing the
Sellbom, Martin; Sansone, Randy A; Songer, Douglas A
2017-09-01
The current study evaluated the utility of the self-harm inventory (SHI) as a proxy for and screening measure of borderline personality disorder (BPD) using several diagnostic and statistical manual of mental disorders (DSM)-based BPD measures as criteria. We used a sample of 145 psychiatric inpatients, who completed the SHI and a series of well-validated, DSM-based self-report measures of BPD. Using a series of latent trait and latent class analyses, we found that the SHI was substantially associated with a latent construct representing BPD, as well as differentiated latent classes of 'high' vs. 'low' BPD, with good accuracy. The SHI can serve as proxy for and a good screening measure for BPD, but future research needs to replicate these findings using structured interview-based measurement of BPD.
User Centered System Design. Part 2. Collected Papers from the UCSD HMI Project.
1984-03-01
31 David Owen >CONSTRUCTIVE INTERACTION: A METHOD FOR STUDYING USER-COMPUTER-USER INTERACTION,~4 Claire O’MWaiey. Stephrn W. Drape, &mW4(fey S. Riley...improving intelligibility. __________ Display of a 1mg. musher Allows user to see a Slow to read, slow to of MCM Item: law percestage of the display, ua...Display of a saw musher Essy to red, quick to If number of alterna- of Ase im ms: display, only a small tiwes is large, multiple percentage of the sads
The Shi’a Crescent: A Misconception of Shi’a Alliance
2014-12-01
Iranian origin to Iran.33 After the Iraq-Iran War started, Saddam’s regime encouraged Iraqi men who were married to Iranian women to divorce their...region, indicating that “The Shi’a point to a pattern of negligence and poverty resulting from discriminatory practices of governments from Ottoman...decreased the authority of the sayyids, who were tribal counselors on marriages, divorces , and inheritances,26 and marked the success of the Sunni
Synthesis, Transfer, and Characterization of Nanoscale 2-Dimensional Materials
2015-09-01
Shi Y, Hamsen C, Jia X, Kim KK, Reina A, Hofmann M, Kong J. Synthesis of few-layer hexagonal boron nitride thin film by chemical vapor deposition...hexagonal boron nitride layers. Nano Letters. 2010;10(8):3209–3215. 12. Kim KK, Hsu A, Jia X, Kim SM, Shi Y, Hofmann M, Kong J. Synthesis of...microscopy. Physical Review B. 2009;80(15):155425. 33. Kim KK, Hsu A, Jia X, Kim SM, Shi Y, Hofmann M, Kong J. Synthesis of monolayer hexagonal boron
Institute of Scientific and Technical Information of China (English)
王爱丽; 卢琦; 梅现红; 官莉
2015-01-01
Objective:To investigate the semiconductor laser combined fresh aloe shi fu and nursing treatment the curative effect of needle phlebitis in patients with cerebral apoplexy. Methods: 66 cases of patients with cerebral stroke with phlebitis, randomly divided into experimental group and the control group, 33 cases each. The control group was treated with fresh aloe shi fu; On the basis of the experimental group in the control group treatment using semiconduc﹣tor laser irradiation in vitro and nursing intervention in the treatment of phlebitis. On two groups before and after the treatment of phlebitis treatment efficient and subjective pain level. Results: The patients with phlebitis treatment effec﹣tive rate of 93. 94% , compared with control group effective rate was 81. 82% (P < 0. 05), the difference was statisti﹣cally significant. The experimental group patients with venous pain level compared with control group (P < 0. 05), the difference was statistically significant. Conclusion: The application of semiconductor laser with fresh aloe shi fu and nursing therapy in patients with cerebral apoplexy phlebitis, can alleviate the pain of the patients with cerebral apo﹣plexy.%探讨半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效。方法:将脑卒中并发静脉炎患者66例,随机分为实验组和对照组,各33例。对照组采用鲜芦荟湿敷方法治疗;实验组在对照组治疗的基础上采用半导体激光体外照射及护理干预治疗静脉炎。对两组治疗前后静脉炎治疗有效率及主观疼痛级别进行比较。结果:实验组患者静脉炎治疗有效率为93.94%,和对照组有效率81.82%相比(P<0.05),差别有统计学意义;实验组患者静脉疼痛级别和对照组相比(P<0.05),差别有统计学意义。结论:应用半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者静脉炎,能减轻脑卒中患者的痛苦。
Yang, D.; Wang, W.; Wu, Z.
2017-12-01
Plate subduction can transport the water to the Earth's interior by forming hydrous phases and water can exert important effects on global dynamics and many processes within the deep Earth. Superhydrous phase B (ShyB), as an important candidate for transporting water into the mantle transition zone and lower mantle, is stable up to 31 GPa and will decompose into bridgmanite, periclase and water at a depth of 800 km [Komabayashi and Omori, 2006]. The decomposition of ShyB may be related to the seismic discontinuity at the depth of 800 km in Western-Pacific Subduction Zones [Liu et al., 2016; Porritt and Yoshioka, 2016]. The detail discussions on this topic require the elasticity of ShyB at the P-T conditions of the transition zone and lower mantle. In this contribution, we obtained the thermal elasticity of ShyB using first-principles calculations. ShyB shows a very low velocity and density compared to the bridgmanite and periclase, the major minerals in the lower mantle. The accumulation of ShyB will generate the low-velocity anomaly in the uppermost lower mantle. The dehydration of ShyB will cause the Vp, Vs, and density increase by 7.5%, 15.0% and 12%, respectively. It means that a slab with 10% ShyB could cause an impedance contrast of 2.7% at a depth of 800 km for shear wave. Furthermore, the released waters by the dehydration of ShyB probably migrate upward and promote the partial melt to reduce the sound velocity at shallower depth, which can further explain the low-velocity zones just above 800-km discontinuity in Western-Pacific Subduction Zones [Liu et al., 2016]. Komabayashi, T., and S. Omori (2006), Internally consistent thermodynamic data set for dense hydrous magnesium silicates up to 35GPa, 1600°C: Implications for water circulation in the Earth's deep mantle, Physics of the Earth and Planetary Interiors, 156(1-2), 89-107. Liu, Z., J. Park, and S. I. Karato (2016), Seismological detection of low-velocity anomalies surrounding the mantle transition
Is universal coverage via social health insurance financially feasible in Swaziland?
Mathauer, Inke; Musango, Laurent; Sibandze, Sibusiso; Mthethwa, Khosi; Carrin, Guy
2011-03-01
The Government of Swaziland decided to explore the feasibility of social health insurance (SHI) in order to enhance universal access to health services. We assess the financial feasibility of a possible SHI scheme in Swaziland. The SHI scenario presented is one that mobilises resources additional to the maintained Ministry of Health and Social Welfare (MOHSW) budget. It is designed to increase prepayment, enhance overall health financing equity, finance quality improvements in health care, and eventually cover the entire population. The financial feasibility assessment consists of calculating and projecting revenues and expenditures of the SHI scheme from 2008 to 2018. SimIns, a health insurance simulation software, was used. Quantitative data from government and other sources and qualitative data from discussions with health financing stakeholders were gathered. Policy assumptions were jointly developed with and agreed upon by a MOHSW team. SHI would take up an increasing proportion of total health expenditure over the simulation period and become the dominant health financing mechanism. In principle, and on the basis of the assumed policy variables, universal coverage could be reached within 6 years through the implementation of an SHI scheme based on a mix of contributory and tax financing. Contribution rates for formal sector employees would amount to 7% of salaries and the Ministry of Health and Social Welfare budget would need to be maintained. Government health expenditure including social health insurance would increase from 6% in 2008 to 11% in 2018.
Energy Technology Data Exchange (ETDEWEB)
Banerjee, Somik [Materials Research Laboratory, Department of Physics, Tezpur University, Tezpur 784028, Assam (India); Kumar, A., E-mail: ask@tezu.ernet.i [Materials Research Laboratory, Department of Physics, Tezpur University, Tezpur 784028, Assam (India)
2010-09-15
Polyaniline (PAni) nanofibers doped with camphor sulfonic acid have been irradiated with 90 MeV O{sup 7+} ions at different fluences (3 x 10{sup 10}-1 x 10{sup 12} ions/cm{sup 2}) using a 15UD Pelletron accelerator under ultra-high vacuum. XRD studies reveal a decrease in the domain length and an increase in the strain upon SHI irradiation. The increase in d-spacing corresponding to the (1 0 0) reflection of PAni nanofibers with increasing irradiation fluence has been attributed to the increase in the tilt angle of the chains with respect to the (a, b) basal plane of PAni. Decrease in the integral intensity upon SHI irradiation indicates amorphization of the material. Micro-Raman ({mu}R) studies confirm amorphization of the PAni nanofibers and also show that the PAni nanofibers get de-doped upon SHI irradiation. {mu}R spectroscopy also reveals a benzenoid to quinoid transition in the PAni chain upon SHI irradiation. TEM results show that the size of PAni nanofibers decreases with the increase in irradiation fluence, which has been attributed to the fragmentation of PAni nanofibers in the core of amorphized tracks caused by SHI irradiation.
Spontaneous haemoperitoneum in pregnancy and endometriosis: a case series
Lier, M. van; Malik, R.F.; Waesberghe, J. van; Maas, J.W.; Rumpt-van de Geest, D.A. van; Coppus, S.F.P.J.; Berger, J.P.; Rijn, B.B. van; Janssen, P.F.; Boer, M.A. de; Vries, J.I.P. de; Jansen, F.W.; Brosens, I.A.; Lambalk, C.B.; Mijatovic, V.
2017-01-01
OBJECTIVE: To report pregnancy outcomes of SHiP (spontaneous haemoperitoneum in pregnancy) and the association with endometriosis. DESIGN: Retrospective case note review. SETTING: Dutch referral hospitals for endometriosis. SAMPLE: Eleven women presenting with 15 events of SHiP. METHODS: In
Spontaneous haemoperitoneum in pregnancy and endometriosis : a case series
Lier, McI; Malik, R F; van Waesberghe, Jhtm; Maas, J W; van Rumpt-van de Geest, D A; Coppus, S F; Berger, J P; van Rijn, B B; Janssen, P F; de Boer, M. A; de Vries, Jip; Jansen, F. W.; Brosens, I A; Lambalk, C B; Mijatovic, V
OBJECTIVE: To report pregnancy outcomes of SHiP (spontaneous haemoperitoneum in pregnancy) and the association with endometriosis. DESIGN: Retrospective case note review. SETTING: Dutch referral hospitals for endometriosis. SAMPLE: Eleven women presenting with 15 events of SHiP. METHODS: In
Dual-pulse frequency compounded superharmonic imaging
Neer, P.L.M.J. van; Danilouchkine, M.G.; Matte, G.M.; Steen, A.F.W. van der; Jong, N. de
2011-01-01
Tissue second-harmonic imaging is currently the default mode in commercial diagnostic ultrasound systems. A new modality, superharmonic imaging (SHI), combines the third through fifth harmonics originating from nonlinear wave propagation through tissue. SHI could further improve the resolution and
Latulippe, Karine; Hamel, Christine; Giroux, Dominique
2017-04-27
eHealth is developing rapidly and brings with it a promise to reduce social health inequalities (SHIs). Yet, it appears that it also has the potential to increase them. The general objective of this review was to set out how to ensure that eHealth contributes to reducing SHIs rather than exacerbating them. This review has three objectives: (1) identifying characteristics of people at risk of experiencing social inequality in health; (2) determining the possibilities of developing eHealth tools that avoid increasing SHI; and (3) modeling the process of using an eHealth tool by people vulnerable to SHI. Following the EPPI approach (Evidence for Policy and Practice of Information of the Institute of Education at the University of London), two databases were searched for the terms SHIs and eHealth and their derivatives in titles and abstracts. Qualitative, quantitative, and mixed articles were included and evaluated. The software NVivo (QSR International) was employed to extract the data and allow for a metasynthesis of the data. Of the 73 articles retained, 10 were theoretical, 7 were from reviews, and 56 were based on empirical studies. Of the latter, 40 used a quantitative approach, 8 used a qualitative approach, 4 used mixed methods approach, and only 4 were based on participatory research-action approach. The digital divide in eHealth is a serious barrier and contributes greatly to SHI. Ethnicity and low income are the most commonly used characteristics to identify people at risk of SHI. The most promising actions for reducing SHI via eHealth are to aim for universal access to the tool of eHealth, become aware of users' literacy level, create eHealth tools that respect the cultural attributes of future users, and encourage the participation of people at risk of SHI. eHealth has the potential to widen the gulf between those at risk of SHI and the rest of the population. The widespread expansion of eHealth technologies calls for rigorous consideration of
Kutzin, Joseph; Jakab, Melitta; Shishkin, Sergey
2009-01-01
The aim of the paper is to bring evidence and lessons from two low- and middle-income countries (LMIs) of the former USSR into the global debate on health financing in poor countries. In particular, we analyze the introduction of social health insurance (SHI) in Kyrgyzstan and Moldova. To some extent, the intent of SHI introduction in these countries was similar to that in LMIs elsewhere: increase prepaid revenues for health and incorporate the entire population into the new system. But the approach taken to universality was different. In particular, the SHI fund in each country was used as the key instrument in a comprehensive reform of the health financing system, with the new revenues from payroll taxation used in an explicitly complementary manner to general budget revenues. From a functional perspective, the reforms in these countries involved not only the introduction of a new source of funds, but also the centralization of pooling, a shift from input- to output-based provider payment methods, specification of a benefit package, and greater autonomy for public sector health care providers. Hence, their reforms were not simply the introduction of an SHI scheme, but rather the use of an SHI fund as an instrument to transform the entire system of health financing. The study uses administrative and household data to demonstrate the impact of the reforms on regional inequality and household financial burden. The approach used in these two countries led to improved equity in the geographic distribution of government health spending, improved financial protection, and reduced informal payments. The comprehensive approach taken to reform in these two countries, and particularly the redirection of general budget revenues to the new SHI funds, explain much of the success that was achieved. This experience offers potentially useful lessons for LMIs elsewhere in the world, and for shifting the global debate away from what we see as a false dichotomy between SHI and
Liu, Jun-Qiang
2011-08-01
Social health insurance (SHI) is gaining popularity in many developing countries, but there are few systematic empirical studies on the dynamics of SHI development. This study investigates the determinants of coverage of the Basic Healthcare Insurance for Urban Employees (BHI) in China. Using a panel database ranging from 1999 to 2007, the study finds that: (1) economic development plays a valuable role in BHI development; (2) strong financial capacity and administrative capacity in the government contributes to BHI progress; (3) higher trade union density is closely related to more rapid BHI expansion; and (4) taxation agencies are better at collecting SHI premiums. These findings provide evidence-based lessons for new and ongoing SHI programs. In addition, this article aims to make a more general contribution to the study of social policy development by expanding the scope of current theories on social policy development. Copyright © 2011 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper
We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...
DEFF Research Database (Denmark)
Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper
We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....
The influence of shyness on children's test performance.
Crozier, W Ray; Hostettler, Kirsten
2003-09-01
Research has shown that shy children differ from their peers not only in their use of language in routine social encounters but also in formal assessments of their language development, including psychometric tests of vocabulary. There has been little examination of factors contributing to these individual differences. To investigate cognitive-competence and social anxiety interpretations of differences in children's performance on tests of vocabulary. To examine the performance of shy and less shy children under different conditions of test administration, individually with an examiner or among their peers within the familiar classroom setting. The sample consisted of 240 Year 5 pupils (122 male, 118 female) from 24 primary schools. Shy and less shy children, identified by teacher nomination and checklist ratings, completed vocabulary and mental arithmetic tests in one of three conditions, in a between-subjects design. The conditions varied individual and group administration, and oral and written responses. The conditions of test administration influenced the vocabulary test performance of shy children. They performed significantly more poorly than their peers in the two face-to-face conditions but not in the group test condition. A comparable trend for the arithmetic test was not statistically significant. Across the sample as a whole, shyness correlated significantly with test scores. Shyness does influence children's cognitive test performance and its impact is larger when children are tested face-to-face rather than in a more anonymous group setting. The results are of significance for theories of shyness and have implications for the assessment of schoolchildren.
Effect of Heat Treatment on the Lycopene Content of Tomato Puree.
African Journals Online (AJOL)
MBI
2013-04-03
Apr 3, 2013 ... foods is mainly due to lycopene (Shi et al, 2002). Lycopene is a naturally .... containing the 5 g sample to solubilized the lycopene (Shi and Maguer, .... Nigeria, 33(1): 178-. 180. Perkins-Veazie P, Collins J K, Pair S D, Robert S.
Study on Electrochemical Performance of Carbonnanotubes/Fey 04 Composite Electrode Material
Directory of Open Access Journals (Sweden)
WANG Fang--yong
2017-02-01
Full Text Available For single super capacitor materials,each material has its own unique advantages and defects. In this paper, the synthesis of complex multi walled carbon nanotubes with Fe304 nanoparticles by simple hydrothermal method. Composite performance for Fe3 OQ nanoparticles adsorbed on carbon nano tube wall composed of reticular structure morphology. Synergy of two component,provides the binary nanometer compound larger specific capacity, excellent properties and good cycle stability. The experimental results proved that the improvement effects of CNT carbon materials on the electrochemical properties of pseudocapacitive electrode material,and CNT/Fe3 OQ nano- composites applied to supercapacitor electrode material.
The effect of shyness on children's formation and retention of novel word-object mappings.
Hilton, Matt; Westermann, Gert
2017-11-01
This study set out to examine whether shyness, an aversion to novelty and unfamiliar social situations, can affect the processes that underlie early word learning. Twenty-four-month-old children (n =32) were presented with sets of one novel and two familiar objects, and it was found that shyer children were less likely to select a novel object as the referent of a novel label. Furthermore, not-shy children then showed evidence of retaining these novel mappings, but shy children did not. These findings suggest that shy children's aversion to novelty and to the unfamiliar context can impact on their word learning.
Constraints on Excuse Making: The Deterring Effects of Shyness and Anticipated Retest.
Shepperd, James A.; And Others
1995-01-01
Examined whether the apparent absence of an egocentric bias among shy individuals is reflected in their excuse making following poor performance and whether anticipating a challenge to one's excuses would dissuade even nonshy individuals from making excuses. Shy individuals refrained form making consistency-lowering excuses regardless of…
Feasibility study of superharmonic imaging using chirps
Van Neer, P.; Danilouchkine, M.G.; Matte, G.; Voormolen, M.M.; Verweij, M.D.; De Jong, N.
2010-01-01
Superharmonic imaging (SHI) targets a combination of the 3rd to 5th harmonics. It was proven to have certain advantages in comparison with the established imaging standards in medical utrasound. SHI enhances the spatial resolution and improves the quality of echographic images, mainly by eliminating
Subclinical hyperthyroidism and cardiovascular risk: recommendations for treatment.
Palmeiro, Christopher; Davila, Maria I; Bhat, Mallika; Frishman, William H; Weiss, Irene A
2013-01-01
Subclinical hyperthyroidism (SHy), the mildest form of hyperthyroidism, is diagnosed in patients having a persistently low or undetectable serum concentration of thyroid-stimulating hormone (TSH) with normal free T4 and T3 concentrations. Although overt hyperthyroidism is associated with an increased risk of adverse cardiovascular outcomes, the cardiovascular risk of SHy is controversial. Multiple studies have demonstrated an increased risk of atrial fibrillation, especially in older individuals with TSH levels effects of SHy on all-cause and cardiovascular mortality are not clear, but recent meta-analyses suggest a modest increase in mortality, with the risk increasing with age and associated with the lowest TSH levels. The long-term consequences of SHy in young- and middle-aged adults, and in those with TSH levels are mildly low, are uncertain. For these reasons, guidelines for treatment are based on patient age, the degree of TSH suppression, symptoms consistent with hyperthyroidism, and overall cardiovascular and osteoporotic fracture risks.
Out of pocket payments and social health insurance for private hospital care: Evidence from Greece.
Grigorakis, Nikolaos; Floros, Christos; Tsangari, Haritini; Tsoukatos, Evangelos
2016-08-01
The Greek state has reduced their funding on health as part of broader efforts to limit the large fiscal deficits and rising debt ratios to GDP. Benefits cuts and limitations of Social Health Insurance (SHI) reimbursements result in substantial Out of Pocket (OOP) payments in the Greek population. In this paper, we examine social health insurance's risk pooling mechanisms and the catastrophic impact that OOP payments may have on insured's income and well-being. Using data collected from a cross sectional survey in Greece, we find that the OOP payments for inpatient care in private hospitals have a positive relationship with SHI funding. Moreover, we show that the SHI funding is inadequate to total inpatient financing. We argue that the Greek health policy makers have to give serious consideration to the perspective of a SHI system which should be supplemented by the Private Health Insurance (PHI) sector. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Patient-reported symptom questionnaires in laryngeal cancer: voice, speech and swallowing.
Rinkel, R N P M; Verdonck-de Leeuw, I M; van den Brakel, N; de Bree, R; Eerenstein, S E J; Aaronson, N; Leemans, C R
2014-08-01
To validate questionnaires on voice, speech, and swallowing among laryngeal cancer patients, to assess the need for and use of rehabilitation services, and to determine the association between voice, speech, and swallowing problems, and quality of life and distress. Laryngeal cancer patients at least three months post-treatment completed the VHI (voice), SHI (speech), SWAL-QOL (swallowing), EORTC QLQ-C30, QLQ-HN35, HADS, and study-specific questions on rehabilitation. Eighty-eight patients and 110 healthy controls participated. Cut off scores of 15, 6, and 14 were defined for the VHI, SHI, and SWAL-QOL (sensitivity > 90%; specificity > 80%). Based on these scores, 56% of the patients reported voice, 63% speech, and 54% swallowing problems. VHI, SHI, and SWAL-QOL scores were associated significantly with quality of life (EORTC QLQ-C30 global quality of life scale) (r = .43 (VHI and SHI) and r = .46 (SWAL-QOL)) and distress (r = .50 (VHI and SHI) and r = .58 (SWAL-QOL)). In retrospect, 32% of the patients indicated the need for rehabilitation at time of treatment, and 81% of these patients availed themselves of such services. Post-treatment, 8% of the patients expressed a need for rehabilitation, and 20% of these patients actually made use of such services. Psychometric characteristics of the VHI, SHI, and SWAL-QOL in laryngeal cancer patients are good. The prevalence of voice, speech, and swallowing problems is high, and clearly related to quality of life and distress. Although higher during than after treatment, the perceived need for and use of rehabilitation services is limited. Copyright © 2014 Elsevier Ltd. All rights reserved.
Rinkel, R N P M; Verdonck-de Leeuw, I M; de Bree, R; Aaronson, N K; Leemans, C R
2015-04-01
The objective of this study was to test the construct validity of the patient-reported outcomes Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI) in relation to objectively measured oral function among patients treated for oral or oropharyngeal cancer. The study sample consisted of patients treated for oral or oropharyngeal cancer. Outcome measures were the SWAL-QOL and the SHI, and the Functional Rehabilitation Outcomes Grade (FROG), a test to measure oral and shoulder function. Spearman's rank correlation coefficient was used to test associations between the SHI and SWAL-QOL scales, and the FROG scales. During a study period of 3 months, 38 patients (21 males, 17 females; mean age 54 years) were included who visited the outpatient clinic for follow-up care 6-155 months after surgical treatment (n = 14) or combined surgery and radiotherapy (n = 24) for oral (n = 21) or oropharyngeal cancer (n = 17). Most SWAL-QOL and SHI scales (except the SWAL-QOL Fatigue scale) correlated significantly with one or more FROG oral function scales. None of the SWAL-QOL and SHI scales correlated significantly with the FROG shoulder function scale. These results support the construct validity of the SWAL-QOL and SHI questionnaires for assessing speech and swallowing problems in daily life that are moderately but significantly related to oral function. A multidimensional assessment protocol is recommended for use in clinical practice and for research purposes for measuring oral function and swallowing- and speech-related problems in daily life among head and neck cancer patients.
Risky health seeking practice among pregnant women in rural Congo
DEFF Research Database (Denmark)
Hørby, Laila
2007-01-01
the clinics at M’shi., and to analyze the practice and logic of the untrained helpers, in the villages and the professional staff at M’shi. To do that I have done a fieldwork study in the area around M’shi., using qualitative methods such as Interviews, Focus Group Discussions and observations. I have used...... they are part of the tradition and the culture. The women make a perfectly normal choice when they choose the TBAs for care as they are part of the folk sector. The TBA’s are there, culturally sensitive, trusted and respected. They have certain knowledge and skills. The professional, medical system may as well...
Is universal coverage via social health insurance financially feasible ...
African Journals Online (AJOL)
SHI would take up an increasing proportion of total health expenditure over the simulation period and become the dominant health financing mechanism. In principle, and on the basis of the assumed policy variables, universal coverage could be reached within 6 years through the implementation of an SHI scheme based ...
Seok, Hung Youl; Park, Jinseok; Kim, Yoo Hwan; Oh, Ki-Wook; Kim, Seung Hyun; Kim, Byung-Jo
2018-04-17
The objective of this study was to investigate the usefulness of muscle ultrasound in evaluating dissociated small hand muscle atrophy, termed 'split hand', and its feasibility in the diagnosis of amyotrophic lateral sclerosis (ALS). Forty-four patients with ALS, 18 normal subjects and 9 patients with other neuromuscular disorders were included in this study. The hand muscles were divided into three regions, the median-innervated lateral hand muscle group (ML), the ulnar-innervated lateral hand muscle (UL) and the ulnar-innervated medial hand muscle (UM), and the muscle echo intensity (EI) and compound muscle action potential (CMAP) were measured. We calculated the split hand index (SHI) using muscle EI (SHI mEI ) and CMAP (SHI CMAP ) for comparison among groups. The SHI was derived by dividing muscle EI (or CMAP) measured at the ML and UL by that measured at the UM. The SHI mEI was significantly higher in patients with ALS (51.7±28.3) than in normal controls (29.7±9.9) and disease controls with other neuromuscular disorders (36.5±7.3; Pdifferentiating ALS from other neuromuscular disorders and healthy controls. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Parliamentary Majorities and National Minorities: Moldova’s Accommodation of the Gagauz
2007-01-01
Al R.S.S. Moldova Pentru Problemele i and Mihai Cotorobai, 26 . Nationale Shi Autoadminstrararea Locala Shi Economia Locala, signed by A. Arsen...No ———. Avizul Comissiilor Permanente Ale Soveitului Suprem al R.S.S. Moldova p şi Autoadminstrararea Localâ şi Economia Localâ. Signed by A. Arseni
Bayram Özdemir, Sevgi; Cheah, Charissa S L; Coplan, Robert J
2017-06-01
This study examined the underlying processes and conditions that contribute to the school adjustment of shy children in Turkey, where children's interpersonal relationships in social settings and academic achievement are highly emphasized. First, we examined the unique mediating roles of children's feelings of social anxiety, depressive symptoms, and loneliness in the associations between shyness and indices of school outcomes (academic achievement and school liking/avoidance). Second, we explored the moderating role of children's peer acceptance in these associations. Fourth- and fifth-grade children (N = 599; M age = 10.11 years, SD = 0.65; 48% girls) provided information on shyness, social anxiety, depressive symptoms, loneliness, and school liking/avoidance. Head teachers in each classroom reported on students' academic performance. The peer nomination method was used to assess children's peer relationships. Results revealed that when children displayed shy behaviours, they reported more depressive symptoms that were, in turn, associated with poorer academic performance, less school liking, and higher school avoidance. Moreover, shyness negatively predicted school liking at low levels of peer acceptance, suggesting that difficulties in peer relationships increased shy children's risk of school dissatisfaction. Overall, our findings support the importance of the interpersonal relationship context for children's adjustment within the Turkish cultural context. Statement of contribution What is already known on this subject? Shy children have difficulties initiating and maintaining social interactions, which put them at risk for a wide range of socio-emotional difficulties. Shy children have poor academic performance and experience school adjustment difficulties in North America. What does this study add? Shyness is an important risk factor for poorer academic performance and adjustment among children in Turkey. The association between shyness and
Payments and quality of care in private for-profit and public hospitals in Greece.
Kondilis, Elias; Gavana, Magda; Giannakopoulos, Stathis; Smyrnakis, Emmanouil; Dombros, Nikolaos; Benos, Alexis
2011-09-23
Empirical evidence on how ownership type affects the quality and cost of medical care is growing, and debate on these topics is ongoing. Despite the fact that the private sector is a major provider of hospital services in Greece, little comparative information on private versus public sector hospitals is available. The aim of the present study was to describe and compare the operation and performance of private for-profit (PFP) and public hospitals in Greece, focusing on differences in nurse staffing rates, average lengths of stay (ALoS), and Social Health Insurance (SHI) payments for hospital care per patient discharged. Five different datasets were prepared and analyzed, two of which were derived from information provided by the National Statistical Service (NSS) of Greece and the other three from data held by the three largest SHI schemes in the country. All data referred to the 3-year period from 2001 to 2003. PFP hospitals in Greece are smaller than public hospitals, with lower patient occupancy, and have lower staffing rates of all types of nurses and highly qualified nurses compared with public hospitals. Calculation of ALoS using NSS data yielded mixed results, whereas calculations of ALoS and SHI payments using SHI data gave results clearly favoring the public hospital sector in terms of cost-efficiency; in all years examined, over all specialties and all SHI schemes included in our study, unweighted ALoS and SHI payments for hospital care per discharge were higher for PFP facilities. In a mixed healthcare system, such as that in Greece, significant performance differences were observed between PFP and public hospitals. Close monitoring of healthcare provision by hospital ownership type will be essential to permit evidence-based decisions on the future of the public/private mix in terms of healthcare provision.
Relationships among Constitution, Stress, and Discomfort in the First Trimester
Directory of Open Access Journals (Sweden)
Hsiao-Ling Wang
2012-01-01
trimester of pregnancy. We adopted a descriptive and correlational research design and collected data from 261 pregnant women during their first trimester in southern Taiwan using structured questionnaires. Results showed that (1 stress was significantly and positively correlated with Yang-Xu, Yin-Xu, and Tan-Shi-Yu-Zhi constitutions, respectively; (2 Yin-Xu and Tan-Shi-Yu-Zhi constitutions had significant correlations with all symptoms of discomfort, while Yang-Xu had significant correlations with all symptoms of discomfort except for “running nose”; (3 Tan-Shi-Yu-Zhi constitution and stress were two indicators for “fatigue”; Tan-Shi-Yu-Zhi was the indicator for “nausea”; Yang-Xu and Yin-Xu were indicators for “frequent urination.” Our findings also indicate that stress level affects constitutional changes and that stress and constitutional change affect the incidence of discomfort. This research can help healthcare professionals observe these discomforts and provide individualized care for pregnant women, to nurture pregnant women into neutral-type constitution, minimize their levels of discomfort, and promote the health of the fetus and the mother.
Sima Qian and His Historical Records
Institute of Scientific and Technical Information of China (English)
2003-01-01
<正> Sima Qian (145-86 BC), a native of Xiayang (now Hancheng, Shaanxi Province), is regarded as China’s greatest historiographer. He is best known for his history book, Historical Records (Shi Ji).Son of Sima Tan, who held the post of the Grand Historian (Tai Shi Ling ) of the Han Dynasty (206 BC-AD 25), Sima
Eiko Ishioka on Aesthetic Performativity, Creativity, and Mimesis
DEFF Research Database (Denmark)
Sato, Toyoko
by Eiko which shows her directorial spirit in full, the Japanese title reads Ishioka Eiko, Fūshi Kaden. Fūshi Kaden is the title of a book of the 14th century, which concerns the attainment of the flowering of art in Noh play and is a philosophical treatise on mimesis. What does it signify to appropriate...
Shi, Yixun
2009-01-01
Based on a sequence of points and a particular linear transformation generalized from this sequence, two recent papers (E. Mauch and Y. Shi, "Using a sequence of number pairs as an example in teaching mathematics". Math. Comput. Educ., 39 (2005), pp. 198-205; Y. Shi, "Case study projects for college mathematics courses based on a particular…
Lee, Sang-Ahm; Paek, Joon-Hyun; Han, Su-Hyun
2015-12-15
To investigate the direct and indirect associations of sleep hygiene with daytime sleepiness, depressive symptoms, and quality of life (QoL), in newly diagnosed, untreated patients with mild obstructive sleep apnea (OSA). Data were collected from adults with mild OSA. The Sleep Hygiene Index (SHI), Sleep Problems Index-1 (SPI-1) of the Medical Outcomes Study-Sleep Scale, Epworth Sleepiness Scale (ESS), Beck Depression Inventory (BDI), and Medical Outcomes Study Short-Form Health survey (SF-36) were used to evaluate patients. To determine the indirect and direct associations between SHI and disease outcomes, the Sobel test and multiple linear regression analyses were used, respectively. When we evaluated the direct associations, we excluded 3 items of the original SHI which were more reflective of general health rather than sleep-specific habits and environments. In total, 260 patients with mild OSA participated in this study. The average age, AHI, and SHI scores were 49.1 years (SD 12.5), 9.3/h (SD 2.9), and 24.7 (SD 6.0), respectively. Here, ≥ 10% of participants indicated poor sleep hygiene behaviors on 7 of 13 items. Young age and men were associated with higher SHI scores (both phygiene is indirectly related to daytime sleepiness, depressive symptoms, QoL via sleep quality and also related to daytime sleepiness and QoL independent of sleep quality in mild OSA patients. Copyright © 2015 Elsevier B.V. All rights reserved.
Dual-pulse frequency compounded superharmonic imaging.
van Neer, Paul L M J; Danilouchkine, Mikhail G; Matte, Guillaume M; van der Steen, Anton F W; de Jong, Nico
2011-11-01
Tissue second-harmonic imaging is currently the default mode in commercial diagnostic ultrasound systems. A new modality, superharmonic imaging (SHI), combines the third through fifth harmonics originating from nonlinear wave propagation through tissue. SHI could further improve the resolution and quality of echographic images. The superharmonics have gaps between the harmonics because the transducer has a limited bandwidth of about 70% to 80%. This causes ghost reflection artifacts in the superharmonic echo image. In this work, a new dual-pulse frequency compounding (DPFC) method to eliminate these artifacts is introduced. In the DPFC SHI method, each trace is constructed by summing two firings with slightly different center frequencies. The feasibility of the method was established using a single-element transducer. Its acoustic field was modeled in KZK simulations and compared with the corresponding measurements obtained with a hydrophone apparatus. Subsequently, the method was implemented on and optimized for a setup consisting of an interleaved phased-array transducer (44 elements at 1 MHz and 44 elements at 3.7 MHz, optimized for echocardiography) and a programmable ultrasound system. DPFC SHI effectively suppresses the ghost reflection artifacts associated with imaging using multiple harmonics. Moreover, compared with the single-pulse third harmonic, DPFC SHI improved the axial resolution by 3.1 and 1.6 times at the -6-dB and -20-dB levels, respectively. Hence, DPFC offers the possibility of generating harmonic images of a higher quality at a cost of a moderate frame rate reduction.
Energy Technology Data Exchange (ETDEWEB)
Kaur, Manpreet, E-mail: manpreet.kaur@abesit.in [ABES Institute of Technology,Ghaziabad, Uttar Pradesh (India); Singh, Surinder [Department of Physics, Guru Nanak Dev University, Amritsar (India); Mehta, Rajeev [Department of Chemical Engineering, Thapar University, Patiala (India)
2016-05-23
Radiation has been used as a processing technique to modify structural, chemical, physical and morphological properties of polymers and its nanocomposite and can thus be used as a method to control the rate of degradation. The swift heavy ions (SHI) irradiation effects on the structural properties of poly(lactide-co-glycolide) nanocomposites containing 5 wt% organo-montmorillonite (OMMT) clay by irradiating with 50 MeV Li{sup 3+} and 180 MeV Ag{sup 8+} ions has been studied at different fluences. The structural responses of PLGA nanocomposite under the influence of SHI were studied using Fourier transform infrared (FTIR) spectroscopy. The presence of clay and irradiation by swift heavy ions (SHI) brings out interesting changes in structural properties of nanocomposite.
International Nuclear Information System (INIS)
Evans, T.C.
1988-01-01
To identify functions that regulate Ca 2+ -induced ciliary reversal in Paramecium, mutants defective in terminating depolarization-induced backward swimming were selected. Six independent recessive mutations (k-shy) comprising two complementation groups, k-shyA and k-shyB, were identified. All mutants exhibited prolonged backward swimming in depolarizing solutions. Voltage clamp studies revealed that mutant Ca 2+ current amplitudes were reduced, but could be restored to wild type levels by EGTA injection. The recovery of the mutant Ca 2+ current from Ca 2+ -dependent inactivation, and the decay of the Ca 2+ -dependent K + and Ca 2+ -dependent Na + currents after depolarization were slow in k-shy compared to wild type. To identify protein targets of Ca 2+ action, ciliary proteins that interact with calmodulin (CaM) were characterized. With a 125 I-CaM blot assay, several CaM-binding proteins were identified including axonemal, soluble, and membrane-bound polypeptides. Competitive displacement studies with unlabeled Paramecium CaM, bovine CaM, and troponinC suggested that both protein types bind CaM with high affinity and specificity. To examine the presence of CaM-binding sites in intact axonemes, a filtration binding assay was developed
A model of chemical etching of olivine in the vicinity of the trajectory of a swift heavy ion
Energy Technology Data Exchange (ETDEWEB)
Gorbunov, S.A., E-mail: s.a.gorbunov@mail.ru [Lebedev Physical Institute of the Russian Academy of Sciences, Leninskij pr. 53, 119991 Moscow (Russian Federation); Rymzhanov, R.A. [Joint Institute for Nuclear Research, Joliot-Curie 6, 141980 Dubna, Moscow Region (Russian Federation); Starkov, N.I. [Lebedev Physical Institute of the Russian Academy of Sciences, Leninskij pr. 53, 119991 Moscow (Russian Federation); Volkov, A.E. [Lebedev Physical Institute of the Russian Academy of Sciences, Leninskij pr. 53, 119991 Moscow (Russian Federation); Joint Institute for Nuclear Research, Joliot-Curie 6, 141980 Dubna, Moscow Region (Russian Federation); National Research Centre ‘Kurchatov Institute’, Kurchatov Sq. 1, 123182 Moscow (Russian Federation); Malakhov, A.I. [Joint Institute for Nuclear Research, Joliot-Curie 6, 141980 Dubna, Moscow Region (Russian Federation)
2015-12-15
Searching of superheavy elements, the charge spectra of heavy nuclei in Galactic Cosmic Rays was investigated within the OLYMPIA experiment using the database of etched ion tracks in meteorite olivine. Etching results in the formation of hollow syringe-like channels with diameters of 1–10 μm along the trajectories of these swift heavy ions (SHI). According to the activated complex theory, the local chemical activity is determined by an increase of the specific Gibbs energy of the lattice stimulated by structure transformations, long-range elastic fields, and interatomic bonds breaking generated in the vicinity of the ion trajectory. To determine the dependencies of the Gibbs free energy increase in SHI tracks in olivine on the mass, energy and charge of a projectile, we apply a multiscale model of excitation and relaxation of materials in the vicinity of the SHI trajectory (SHI tracks). Effect of spreading of fast electrons from the ion trajectory causing neutralization of metallic atoms resulting in an increase of the chemical activity of olivine at long distances from the ion trajectory (up to 5 μm) is estimated and discussed.
Winter cloudiness variability over Northern Eurasia related to the Siberian High during 1966–2010
International Nuclear Information System (INIS)
Chernokulsky, Alexander; Mokhov, Igor I; Nikitina, Natalia
2013-01-01
This letter presents an assessment of winter cloudiness variability over Northern Eurasia regions related to the Siberian High intensity (SHI) variations during 1966–2010. An analysis of cloud fraction and the occurrence of different cloud types was carried out based on visual observations from almost 500 Russian meteorological stations. The moonlight criterion was implemented to reduce the uncertainty of night observations. The SHI was defined based on sea-level pressure fields from different reanalyses. We found a statistically significant negative correlation of cloud cover with the SHI over central and southern Siberia and the southern Urals with regression coefficients around 3% hPa −1 for total cloud fraction (TCF) for particular stations near the Siberian High center. Cross-wavelet analysis of TCF and SHI revealed a long-term relationship between cloudiness and the Siberian High. Generally, the Siberian High intensification by 1 hPa leads to a replacement of one overcast day with one day without clouds, which is associated mainly with a decrease in precipitating and stratiform clouds. These changes point to a positive feedback between cloudiness and the Siberian High. (letter)
Redistribution through social health insurance: evidence on citizen preferences.
Pfarr, Christian; Schmid, Andreas
2016-06-01
The extent of social health insurance (SHI) and supplementary private insurance is frequently analyzed in public choice. Most of these analyses build on the model developed by Gouveia (1997), who defines the extent of SHI as consequence of a choice by self-interested voters. In this model, an indicator reflecting individuals' relative income position and relative risk of falling ill determines the voting decision. Up to now, no empirical evidence for this key assumption has been available. We test the effect of this indicator on individuals' preferences for the extent of SHI in a setting with mandatory SHI that can be supplemented by private insurance. The data is based on a DCE conducted in the field with a representative sample of 1538 German citizens in 2012. Conditional logit and latent class models are used to analyze preference heterogeneity. Our findings strongly support the assumptions of the models. Individuals likely to benefit from public coverage show a positive marginal willingness to pay (MWTP) for both a shift away from other beneficiary groups toward the sick and an expansion of publicly financed resources, and the expected net payers have a negative MWTP and prefer lower levels of public coverage.
Social health insurance in Nepal: A health system departure toward the universal health coverage.
Pokharel, Rajani; Silwal, Pushkar Raj
2018-04-10
The World Health Organization has identified universal health coverage (UHC) as a key approach in reducing equity gaps in a country, and the social health insurance (SHI) has been recommended as an important strategy toward it. This article aims to analyze the design, expected benefits and challenges of realizing the goals of UHC through the recently launched SHI in Nepal. On top of the earlier free health-care policy and several other vertical schemes, the SHI scheme was implemented in 2016 and has reached population coverage of 5% in the implemented districts in just within a year of implementation. However, to achieve UHC in Nepal, in addition to operationalizing the scheme, several other requirements must be dealt simultaneously such as efficient health-care delivery system, adequate human resources for health, a strong information system, improved transparency and accountability, and a balanced mix of the preventive, health promotion, curative, and rehabilitative services including actions to address the social determinants of health. The article notes that strong political commitment and persistent efforts are the key lessons learnt from countries achieving progressive UHC through SHI. Copyright © 2018 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Pozhitkov Alexander E
2010-07-01
Full Text Available Abstract Background Calibration of a microarray scanner is critical for accurate interpretation of microarray results. Shi et al. (BMC Bioinformatics, 2005, 6, Art. No. S11 Suppl. 2. reported usage of a Full Moon BioSystems slide for calibration. Inspired by the Shi et al. work, we have calibrated microarray scanners in our previous research. We were puzzled however, that most of the signal intensities from a biological sample fell below the sensitivity threshold level determined by the calibration slide. This conundrum led us to re-investigate the quality of calibration provided by the Full Moon BioSystems slide as well as the accuracy of the analysis performed by Shi et al. Methods Signal intensities were recorded on three different microarray scanners at various photomultiplier gain levels using the same calibration slide from Full Moon BioSystems. Data analysis was conducted on raw signal intensities without normalization or transformation of any kind. Weighted least-squares method was used to fit the data. Results We found that initial analysis performed by Shi et al. did not take into account autofluorescence of the Full Moon BioSystems slide, which led to a grossly distorted microarray scanner response. Our analysis revealed that a power-law function, which is explicitly accounting for the slide autofluorescence, perfectly described a relationship between signal intensities and fluorophore quantities. Conclusions Microarray scanners respond in a much less distorted fashion than was reported by Shi et al. Full Moon BioSystems calibration slides are inadequate for performing calibration. We recommend against using these slides.
Role of the irradiation temperature on the modifications of swift-heavy-ion irradiated polyethylene
International Nuclear Information System (INIS)
Melot, M.; Ngono-Ravache, Y.; Balanzat, E.
2003-01-01
The damage processes triggered by swift heavy ions, SHI, can be very different to those induced by classical low ionising particles. This is due to the very high electronic stopping power, (dE/dx) e , of SHI. This paper concerns the effects of SHI on polyethylene, PE. In PE, low (dE/dx) e irradiations induce crosslinking and in-chain double bond formation. At high (dE/dx) e , the creation yield of vinyl groups becomes significant. Above a (dE/dx) e threshold, alkyne and allene groups appear. We present results on low temperature irradiations that bring new enlightenment on the damage process by preventing the migration of radiation-induced radicals and molecules. Two SHI specific modifications are studied: vinyl groups and alkyne end groups. We have irradiated PE films with oxygen and sulphur beams at 13.6 and 11.2 MeV/amu, respectively. The modifications were followed by in situ infrared spectroscopy (FTIR). We have performed irradiations at 8 and 290 K. The samples irradiated at 8 K have been annealed up to 290 K for investigating the effect of radical migration. Lowering the irradiation temperature to 8 K increases the creation yield of vinyl groups and alkyne end groups. The enhancement factor between 290 and 8 K is around three. Consequently the formation of defects specific to SHI irradiations is sensitive to radical migration and hence requires some time. During annealing, the alkyne concentration remains stable indicating that the creation of this group cannot be induced by radical recombination. The annealing spectra of vinyl groups are more complex
Thermodynamic Evaluation of LSCF Cathode Stability and Tolerance towards Gas Impurities
DEFF Research Database (Denmark)
Zhang, Weiwei; Chen, Ming; Hendriksen, Peter Vang
2014-01-01
for intermediate-temperature solid oxide fuel cells. Despite its technological importance, the phase stability of the LSCF perovskite has not yet been fully mapped out and may be critical for the use of the materials during long-term operation. For cells with LSCF or LSCF/CGO (CGO: gadolinia doped ceria) cathodes......Strontium and iron co-doped lanthanum cobaltites (La1-xSrxCo1-yFeyO3-δ, LSCF) show good oxygen ion and electronic conductivity and fast oxygen surface exchange kinetics at temperatures between 600 and 800 °C, and is considered today one of the most promising class of cathode materials...
Are Hydrostatic Models Still Capable of Simulating Oceanic Fronts
2016-11-10
Hydrostatic Models Still Capable of Simulating Oceanic Fronts Yalin Fan Zhitao Yu Ocean Dynamics and Prediction Branch Oceanography Division FengYan Shi...OF PAGES 17. LIMITATION OF ABSTRACT Are Hydrostatic Models Still Capable of Simulating Oceanic Fronts? Yalin Fan, Zhitao Yu, and, Fengyan Shi1 Naval...mixed layer and thermocline simulations as well as large scale circulations. Numerical experiments are conducted using hydrostatic (HY) and
Prevalence and Correlates of Self-Harm in the German General Population.
Directory of Open Access Journals (Sweden)
Astrid Müller
Full Text Available The study aimed at evaluating the psychometric properties of the German version of the Self- Harm Inventory (SHI and examining the lifetime prevalence and correlates of self-harm in a representative German population sample (N = 2,507; age mean = 48.79, SD = 18.11; range 14 to 94 years; 55.5% women using the SHI. All participants answered the German SHI, the short form of the Barratt Impulsiveness Scale (BIS-15, the ultra-brief Patient Health Questionnaire for Depression and Anxiety (PHQ-4, and provided sociodemographic information. The one-factorial structure of the SHI was replicated using a confirmatory factor analysis. Internal consistency coefficients were sufficient and in line with previous studies. Almost half of the sample (49% acknowledged at least one self-harming behavior over the life-span, most frequently indirect forms of self-harm. The rate of participants who engaged in at least one SHI behavior was higher among men than women (51.6% vs. 46.9%, respectively, χ2 = 5.38, p = 0.020. Higher SHI scores were related to younger age, male gender, living alone, more symptoms of anxiety and depression (PHQ-4, higher impulsivity scores (BIS-15, and suffering from obesity grade 2. Women engaged more often in discreet forms of self-harm than men, e.g., preventing wounds from healing, exercising an injury, starving, and abusing laxatives. In terms of other indirect self-harming behaviors, men admitted more often driving recklessly, being promiscuous and losing a job on purpose, while women reported more frequently engaging in emotionally abusive relationships. With respect to direct self-harm, women were more likely to endorse suicide attempts and cutting, while men admitted more often head-banging. The findings suggest that self-harm constitutes a common problem. Future longitudinal studies are required to examine the natural course, sociodemographic and psychopathological risk factors, as well as possible time-trends of self
Augmentation of thermoelectric performance of VO2 thin films irradiated by 200 MeV Ag9+-ions
International Nuclear Information System (INIS)
Khan, G.R.; Kandasami, A.; Bhat, B.A.
2016-01-01
Swift Heavy Ion (SHI) irradiation with 200 MeV Ag 9+ -ion beam at ion fluences of 1E11, 5E11, 1E12, and 5E12 for tuning of electrical transport properties of VO 2 thin films fabricated by so–gel technique on alumina substrates has been demonstrated in the present paper. The point defects created by SHI irradiation modulate metal to insulator phase transition temperature, carrier concentration, carrier mobility, electrical conductivity, and Seebeck coefficient of VO 2 thin films. The structural properties of the films were characterized by XRD and Raman spectroscopy and crystallite size was found to decrease upon irradiation. The atomic force microscopy revealed that the surface roughness of specimens first decreased and then increased with increasing fluence. Both resistance as well as Seebeck coefficient measurements demonstrated that all the samples exhibit metal–insulator phase transition and the transition temperatures decreases with increasing fluence. Hall effect measurements exhibited that carrier concentration increased continuously with increasing fluence which resulted in an increase of electrical conductivity by several orders of magnitude in the insulating phase. Seebeck coefficient in insulating phase remained almost constant in spite of an increase in the electrical conductivity by several orders of magnitude making SHI irradiation an alternative stratagem for augmentation of thermoelectric performance of the materials. The carrier mobility at room temperature decreased up to the beam fluence of 5E11 and then started increasing whereas Seebeck coefficient in metallic state first increased with increasing ion beam fluence up to 5E11 and thereafter decreased. Variation of these electrical transport parameters has been explained in detail. - Highlights: • Thermoelectric properties of VO 2 thin films enhance upon SHI irradiation. • Structural properties show that crystallite size decrease upon SHI irradiation. • Metal–insulator phase
Prevalence and Correlates of Self-Harm in the German General Population.
Müller, Astrid; Claes, Laurence; Smits, Dirk; Brähler, Elmar; de Zwaan, Martina
2016-01-01
The study aimed at evaluating the psychometric properties of the German version of the Self- Harm Inventory (SHI) and examining the lifetime prevalence and correlates of self-harm in a representative German population sample (N = 2,507; age mean = 48.79, SD = 18.11; range 14 to 94 years; 55.5% women) using the SHI. All participants answered the German SHI, the short form of the Barratt Impulsiveness Scale (BIS-15), the ultra-brief Patient Health Questionnaire for Depression and Anxiety (PHQ-4), and provided sociodemographic information. The one-factorial structure of the SHI was replicated using a confirmatory factor analysis. Internal consistency coefficients were sufficient and in line with previous studies. Almost half of the sample (49%) acknowledged at least one self-harming behavior over the life-span, most frequently indirect forms of self-harm. The rate of participants who engaged in at least one SHI behavior was higher among men than women (51.6% vs. 46.9%, respectively, χ2 = 5.38, p = 0.020). Higher SHI scores were related to younger age, male gender, living alone, more symptoms of anxiety and depression (PHQ-4), higher impulsivity scores (BIS-15), and suffering from obesity grade 2. Women engaged more often in discreet forms of self-harm than men, e.g., preventing wounds from healing, exercising an injury, starving, and abusing laxatives. In terms of other indirect self-harming behaviors, men admitted more often driving recklessly, being promiscuous and losing a job on purpose, while women reported more frequently engaging in emotionally abusive relationships. With respect to direct self-harm, women were more likely to endorse suicide attempts and cutting, while men admitted more often head-banging. The findings suggest that self-harm constitutes a common problem. Future longitudinal studies are required to examine the natural course, sociodemographic and psychopathological risk factors, as well as possible time-trends of self-harming behaviors in more
ONR Far East Scientific Information Bulletin. Volume 14, Number 1. HEISEI, Achieving Universal Peace
1989-03-01
shapes with the concomitant formation of an amorphous phase. Kobayashi et al. The poster papers covered a range (P3-12) studied the etching... Nobuaki Shohata and Kazutaka Fujii Fundamental Research Laboratories Shigeki Hoshino Resource and Environment Research Laboratories Hirotaka Yamaguchi, Yuji...University 255 Ookubo, Urawa-shi, Saitama 336, Japan A. Kobayashi Ibaraki Polytechnic College 864-4 Suifu-cho, Mito-shi, Ibaraki 310, Japan P3-05 AN
Directory of Open Access Journals (Sweden)
Stephen D. Gaimari
2017-10-01
Full Text Available The family Celyphidae (Diptera, Lauxanioidea is verified as part of the New World fauna, with a second specimen discovered of a species described from French Guiana in 1844 by P.J.M. Macquart. As this species possesses characteristics that clearly suggest a separate lineage from the Old World celyphids, a new genus is proposed, Atopocelyphus gen. n., with the type species, Celyphus ruficollis Macquart, in the new combination Atopocelyphus ruficollis (Macquart, comb. n. A key to world genera of Celyphidae is presented, along with discussion of generic concepts. Chamaecelyphus Frey is synonymized under Spaniocelyphus Hendel, syn. n., resulting in the following 10 new combinations: Spaniocelyphus africanus (Walker, comb. n.; S. dichrous (Bezzi, comb. n.; S. gutta (Speiser, comb. n.; S. halticinus (Frey, comb. n.; S. kalongensis (Vanschuytbroek, comb. n.; S. ruwenzoriensis (Vanschuytbroek, comb. n.; S. straeleni (Vanschuytbroek, comb. n.; S. upembaensis (Vanschuytbroek, comb. n.; S. violaceus (Vanschuytbroek, comb. n.; S. vrydaghi (Vanschuytbroek, comb. n. The subgenera of Celyphus Dalman are elevated to genus rank, as Paracelyphus Bigot, stat. rev., and Hemiglobus Frey, stat. rev., resulting in the following 17 new and revised combinations: Hemiglobus cheni (Shi, comb. n.; H. eos (Frey, comb. n.; H. lacunosus Frey, comb. rev.; H. pellucidus Frey, comb. rev.; H. planitarsalis (Shi, comb. n.; H. porosus (Tenorio, comb. n.; H. pulchmaculatus (Liu & Yang, comb. n.; H. quadrimaculatus (Tenorio, comb. n.; H. resplendens Frey, comb. rev.; H. rugosus (Tenorio, comb. n.; H. testaceus (Malloch, comb. n.; H. trichoporis (Shi, comb. n.; H. unicolor Frey, comb. rev.; H. violaceus Chen, comb. rev.; Paracelyphus hyacinthus Bigot, comb. rev.; P. medogis (Shi, comb. n.; P. vittalis (Shi, comb. n.
Severe hearing impairment among military veterans--United States, 2010.
2011-07-22
A substantial proportion of hearing loss in the United States is attributable to employment-related exposure to noise. Among military veterans, the most common service-connected disabilities are hearing impairments, suggesting that occupational noise exposure during military service might cause more veterans to have hearing loss than nonveterans. However, a recent analysis of data from the 1993-1995 Epidemiology of Hearing Loss Study did not find significant differences between the two groups. To further investigate hearing loss among veterans, specifically the prevalence of severe hearing impairment (SHI), data from the 2010 Annual Social and Economic Supplement (ASEC) to the Current Population Survey (CPS) were analyzed. This report describes the results of those analyses, which indicated that the prevalence of SHI among veterans was significantly greater than among nonveterans. Veterans were 30% more likely to have SHI than nonveterans after adjusting for age and current occupation, and veterans who served in the United States or overseas during September 2001-March 2010, the era of overseas contingency operations (including Operations Enduring Freedom and Iraqi Freedom), were four times more likely than nonveterans to have SHI. These findings suggest a need for increased emphasis on improving military hearing conservation programs (HCPs) and on hearing loss surveillance in military and veterans' health systems.
Health instruction in Nigerian schools: what are the missing links?
Olatunya, Oladele Simeon; Oseni, Saheed Babajide; Oyelami, Oyeku Akibu; Adegbenro, Caleb; Akani, Nwadiuto
2014-01-01
School health instruction (SHI) is the instructional aspects of school health programme. It provides information on key health issues to school children who are in their formative years. A cross sectional descriptive study of all the primary schools in a focal Local Government Area in Nigeria was carried out to ascertain the implementation of SHI with regards to the contents, methods of delivery and teachers preparation for health teaching using an evaluation checklist for SHI. There were more female pupils enrolled in the study area compared to their male counterparts with a male to female ratio of 0.9:1.0 and only 3.0% of the teachers had In-service training on health related issues in the previous five years preceding the study. 79.4% of the teachers had the recommended qualification to work in the schools. Teachings on emotional health, communicable diseases and safety education were sparingly given by 1.6%, 4.7% and 56% schools respectively. Only three (4.7%) schools (all private) had health instruction given by designated health education staff. No school gave health instruction at least thrice a week as recommended. Compliance with the implementation of SHI was very poor in the study area.
He, Alex Jingwei; Wu, Shaolong
2017-12-01
China's remarkable progress in building a comprehensive social health insurance (SHI) system was swift and impressive. Yet the country's decentralized and incremental approach towards universal coverage has created a fragmented SHI system under which a series of structural deficiencies have emerged with negative impacts. First, contingent on local conditions and financing capacity, benefit packages vary considerably across schemes, leading to systematic inequity. Second, the existence of multiple schemes, complicated by massive migration, has resulted in weak portability of SHI, creating further barriers to access. Third, many individuals are enrolled on multiple schemes, which causes inefficient use of government subsidies. Moral hazard and adverse selection are not effectively managed. The Chinese government announced its blueprint for integrating the urban and rural resident schemes in early 2016, paving the way for the ultimate consolidation of all SHI schemes and equal benefits for all. This article proposes three policy alternatives to inform the consolidation: (1) a single-pool system at the prefectural level with significant government subsidies, (2) a dual-pool system at the prefectural level with risk-equalization mechanisms, and (3) a household approach without merging existing pools. Vertical integration to the provincial level is unlikely to happen in the near future. Two caveats are raised to inform this transition towards universal health coverage.
Grigorakis, Nikolaos; Floros, Christos; Tsangari, Haritini; Tsoukatos, Evangelos
2017-01-03
The high level of out of pocket (OOP) payments constitutes a major concern for Greece and several other European and OECD countries as a result of the significant down turning of their public health finances due to the 2008 financial crisis. The basic objective of this study is to provide empirical evidence on the effect of combining social health insurance (SHI) and private health insurance (PHI) on OOP payments. Further, this study examines the catastrophic impact of OOP payments on insured's welfare using the incidence and intensity methodological approach of measuring catastrophic health care expenditures. Conducting a cross-sectional survey in Greece in 2013, we find that the combination of SHI-PHI has a strong negative influence on insured OOP payments for inpatient health care in private hospitals. Furthermore, our results indicate that SHI coverage is not sufficient by itself to manage with this issue. Moreover, we find that poor people present a greater tendency to incur catastrophic OOP expenditures for hospital health care in private providers. Drawing evidence from Greece, a country with huge fiscal problems that has suffered the consequences of the economic crisis more than any other, could be a starting point for policymakers to consider the perspective of SHI-PHI co-operation against OOP payments more seriously.
Directory of Open Access Journals (Sweden)
Fa-liang LIN
2015-12-01
Full Text Available Abstract Objective: To explore the key points of the translational research in enteral and pareenteral nutrition support for patients with severe head injury (SHI, and to analyze the influence of different nutritional support routes on the prognosis of SHI patients. Methods: Totally 141 patients with severe craniocerebral injury were selected as study subjects, 47 cases for each group, and were given early enteral nutrition (EEN, delayed enteral nutrition (DEN, and parenteral nutrition (PN, respectively. The effect of different nutritional support routes on SHI patients was observed. Results: After 14 d of treatment, Glasgow coma scale (GCS scores of 3 groups were higher than treatment before (P<0.01, and with statistical differences among groups (P<0.05, or P<0.01. The levels of serum albumin, total serum protein and hemoglobin were higher in EEN group than the other groups (P<0.01. The level of serum albumin was lower in PN group than in DEN group (P<0.05. There were statistical differences in the incidence of complications among three groups (χ2=9.2487, P=0.0098. Conclusion: EEN support is more conductive to the improvement of the nutrition status, reduction of the incidence of complications, and promotion of the prognosis of SHI patients than DEN and PN.
Energy Technology Data Exchange (ETDEWEB)
El-Said, A.S., E-mail: elsaid@kfupm.edu.sa [Physics Department, King Fahd University of Petroleum and Minerals, Dhahran 31261 (Saudi Arabia); Wilhelm, R.A.; Heller, R.; Akhmadaliev, Sh.; Schumann, E. [Institute of Ion Beam Physics and Materials Research, Helmholtz-Zentrum Dresden-Rossendorf, 01328 Dresden (Germany); Sorokin, M. [National Research Centre ’Kurchatov Institute’, Kurchatov Square 1, 123182 Moscow (Russian Federation); Facsko, S. [Institute of Ion Beam Physics and Materials Research, Helmholtz-Zentrum Dresden-Rossendorf, 01328 Dresden (Germany); Trautmann, C. [GSI Helmholtz Centre for Heavy Ion Research, 64291 Darmstadt (Germany); Technische Universität Darmstadt, 64289 Darmstadt (Germany)
2016-09-01
GaP single crystals were irradiated with slow highly charged ions (HCI) using 114 keV {sup 129}Xe{sup (33–40)+} and with various swift heavy ions (SHI) of 30 MeV I{sup 9+} and 374 MeV–2.2 GeV {sup 197}Au{sup 25+}. The irradiated surfaces were investigated by scanning force microscopy (SFM). The irradiations with SHI lead to nanohillocks protruding from the GaP surfaces, whereas no changes of the surface topography were observed after the irradiation with HCI. This result indicates that a potential energy above 38.5 keV is required for surface nanostructuring of GaP. In addition, strong coloration of the GaP crystals was observed after irradiation with SHI. The effect was stronger for higher energies. This was confirmed by measuring an increased extinction coefficient in the visible light region.
Martyrs in Revolution: Can the Symbol Sustain the Struggle?
1994-03-01
of Burj al -Shimali, which was constructed at a cost of half a million Lebanese pounds (c. $165,000 U.S.) with monies provided by Shi’a benefactors...Shi’a world in Iran and Iraq and Lebanon gave Musa al Sadr his legitimacy. The Iranian birthplace, problematic to those Sunni Arabs who asserted the...MUSAL AL SADR ................. 81 iv E. BUREAUCRATIC CONTROLS - MANIPULATING MARTYRS ... 93 F. SU M M A RY
1989-03-01
Machine Co. 2068-3 Ooka, Numazu-shi, Shizuoka 410, Japan Y. Taguchi Elionix Inc. 3-7-6, Motoyokoyama-cho, Hachioji-shi, Tokyo 192, Japan T. Kasai ...182, Japan PP2-21 RAPID GROWTH OF DIAMOND FILMS BY ARC DISCHARGE PLASMA CVD Fumio Akatsuka and Yoichi Hirose Department of Electrical Engineering and...Gas Corrosion Protective Coatings and Their Application H.T. Steine and C. Wasserman Castolin SA. St-Sulpice, Switzerland K. Kasai Eutectic of Japan
Hiromitsu, NEGISHI; Kazuo, SUYAMA; Faculty of Agriculture,Tokyo University of Agriculture; Faculty of Agriculture,Tokyo University of Agriculture
2002-01-01
In June 1995, a disease causing round to irregular-shaped, water-soaked, brown to blackish brown spots on mealycup sage (Salvia farinacea Benth.) was found in Atsugi-shi, Kanagawa Prefecture, Japan. The symptoms were seen only on leaves, not on neither flower petals or stems. The disease was also found in Setagaya-ku, Tokyo, Memambetsu-cho, Hokkaido and Shimoda-shi and Matsuzaki-cho, Shizuoka. An Alternaria sp. was frequently isolated from these diseased plants. The isolates were severely pat...
Energy Technology Data Exchange (ETDEWEB)
Le Bouedec, A
1999-11-29
The goal of this study is to characteristic and to localised defects created in {alpha} Poly (vinylidene fluoride) after swift heavy ion irradiations. PVDF films are irradiated with several Swift Heavy Ions (SHI), in the electronic stopping power (dE/dx){sub e}, in order to study the influence of irradiation parameters (absorbed dose, ion). These irradiated films are studied by different analysis techniques such as FTIR, ESR (X and Q band) spectroscopies and DSC. The crystalline level of PVDF is about 50% and we follow it destruction and amorphization as the absorbed dose increase by DSC and FTIR studies. The variation of the various FTIR bands allow us to observe the unsaturations induced by SHI radiations. Two sets of defects are observed: those which yield is sensitive to an increase of (dE/dx){sub e} and those that are not. A spatial distribution of the various defects within the talent track is provided and defects that are difficult to create are the closest of the ion path. The different kind of radicals created after irradiations are studied by ESR spectroscopy. Alkyl, peroxy and polyenyl radicals are detected after SHI radiations like after electron or {gamma} irradiations. Their yield of creation is independent of (dE/dx){sub e} and their localised in the crystalline zone or/and at the interfacial zone between crystalline and amorphous one. An other kind of radicals is created only after SHI radiations that are specific of the SHI-polymer interaction. We observe that these radicals are localised on a carbon cluster, in the core of the latent track for low doses and highly sensitive at the (dE/dx){sub e} of the ion. (author)
Dufour, C; Khomrenkov, V; Wang, Y Y; Wang, Z G; Aumayr, F; Toulemonde, M
2017-03-08
Surface damage appears on materials irradiated by highly charged ions (HCI). Since a direct link has been found between surface damage created by HCI with the one created by swift heavy ions (SHI), the inelastic thermal spike model (i-TS model) developed to explain track creation resulting from the electron excitation induced by SHI can also be applied to describe the response of materials under HCI which transfers its potential energy to electrons of the target. An experimental description of the appearance of the hillock-like nanoscale protrusions induced by SHI at the surface of CaF 2 is presented in comparison with track formation in bulk which shows that the only parameter on which we can be confident is the electronic energy loss threshold. Track size and electronic energy loss threshold resulting from SHI irradiation of CaF 2 is described by the i-TS model in a 2D geometry. Based on this description the i-TS model is extended to three dimensions to describe the potential threshold of appearance of protrusions by HCI in CaF 2 and to other crystalline materials (LiF, crystalline SiO 2 , mica, LiNbO 3 , SrTiO 3 , ZnO, TiO 2 , HOPG). The strength of the electron-phonon coupling and the depth in which the potential energy is deposited near the surface combined with the energy necessary to melt the material defines the classification of the material sensitivity. As done for SHI, the band gap of the material may play an important role in the determination of the depth in which the potential energy is deposited. Moreover larger is the initial potential energy and larger is the depth in which it is deposited.
Ohler, T. A.; Mitchell, C. A.
1996-01-01
Photoperiod and harvest scenario of cowpea (Vigna unguiculata L. Walp) canopies were manipulated to optimize productivity for use in future controlled ecological life-support systems. Productivity was measured by edible yield rate (EYR:g m-2 day-1), shoot harvest index (SHI: g edible biomass [g total shoot dry weight]), and yield-efficiency rate (YER:g edible biomass m-2 day-1 per[g nonedible shoot dry weight]). Breeding lines 'IT84S-2246' (S-2246) and "IT82D-889' (D-889) were grown in a greenhouse under 8-, 12-, or 24-h photoperiods. S-2246 was short-day and D-889 was day-neutral for flowering. Under each photoperiod, cowpeas were harvested either for leaves only, seeds only, or leaves plus seeds (mixed harvest). Photoperiod did not affect EYR of either breeding line for any harvest scenario tested. Averaged over both breeding lines, seed harvest gave the highest EYR at 6.7 g m-2 day-1. The highest SHI (65%) and YER (94 mg m-2 day-1 g-1) were achieved for leaf-only harvest of D-889 under an 8-h photoperiod. For leaf-only harvest of S-2246, both SHI and YER increased with increasing photoperiod, but declined for seed-only and mixed harvests. However, photoperiod had no effect on SHI or YER for D-889 for any harvest scenario. A second experiment utilized the short-day cowpea breeding line 'IT89KD-288' (D-288) and the day-neutral breeding line 'IT87D-941-1' (D-941) to compare yield parameters using photoperiod extension under differing lamp types. This experiment confirmed the photoperiod responses of D-889 and S-2246 to a mixed-harvest scenario and indicated that daylength extension with higher irradiance from high pressure sodium lamps further suppressed EYR, SHI, and YER of the short-day breeding line D-288.
Directory of Open Access Journals (Sweden)
Chu Chu
2014-03-01
Full Text Available The stems of Dendrobium officinale Kimura et Migo, named Tie-pi-shi-hu, is one of the most endangered and precious species in China. Because of its various pharmacodynamic effects, D. officinale is widely recognized as a high-quality health food in China and other countries in south and south-east Asia. With the rising interest of D. officinale, its products have a high price due to a limited supply. This high price has led to the proliferation of adulterants in the market. To ensure the safe use of D. officinale, a fast and convenient method combining normal and fluorescence microscopy was applied in the present study to distinguish D. officinale from three commonly used adulterants including Zi-pi-shi-hu (D. devonianum, Shui-cao-shi-hu (D. aphyllum, Guang-jie-shi-hu (D. gratiosissimum. The result demonstrated that D. officinale could be identified by the characteristic “two hat-shaped” vascular bundle sheath observed under the fluorescence microscopy and the distribution of raphides under normal light microscopy. The other three adulterants could be discriminated by the vascular bundle differences and the distribution of raphides under normal light microscopy. This work indicated that combination of normal light and fluorescence microscopy is a fast and efficient technique to scientifically distinguish D. officinale from the commonly confused species.
Ikegami, Naoki
2006-12-01
Japan has managed to provide universal coverage at relatively low cost by containing prices and restricting the conditions for which services can be billed in the compulsory social health insurance (SHI) program. However, decline in Japan's economic growth ushered in new actors backed by the prime minister who proposed that the providers should be allowed to extra bill for services not covered by the SHI. In 2004 they took the strategy of drawing the attention of the public to areas where the rigidity of the current prohibition appeared to be unfair and ridiculous. They were opposed by the Ministry of Health, Labor, and Welfare and the Japan Medical Association, who strongly objected on the grounds of safety and equity. The compromise reached by the two ministers in charge led to a clarification of the services that are to be covered and of the process for extending coverage to new procedures and drugs. The prohibition on extra billing has remained essentially unchanged, but the momentum for deregulation has been lost. In 2005 an alternate proposal was made to contain SHI expenditures by introducing a global cap on health expenditures and increasing out-of-pocket payment. Although this proposal was not fully adopted, the gradual decline in SHI benefit levels could lead to a renewed move to allow extra billing.
Rodrigues, Thais B; Duan, Jian J; Palli, Subba R; Rieske, Lynne K
2018-03-22
Recent study has shown that RNA interference (RNAi) is efficient in emerald ash borer (EAB), Agrilus planipennis, and that ingestion of double-stranded RNA (dsRNA) targeting specific genes causes gene silencing and mortality in neonates. Here, we report on the identification of highly effective target genes for RNAi-mediated control of EAB. We screened 13 candidate genes in neonate larvae and selected the most effective target genes for further investigation, including their effect on EAB adults and on a non-target organism, Tribolium castaneum. The two most efficient target genes selected, hsp (heat shock 70-kDa protein cognate 3) and shi (shibire), caused up to 90% mortality of larvae and adults. In EAB eggs, larvae, and adults, the hsp is expressed at higher levels when compared to that of shi. Ingestion of dsHSP and dsSHI caused mortality in both neonate larvae and adults. Administration of a mixture of both dsRNAs worked better than either dsRNA by itself. In contrast, injection of EAB.dsHSP and EAB.dsSHI did not cause mortality in T. castaneum. Thus, the two genes identified cause high mortality in the EAB with no apparent phenotype effects in a non-target organism, the red flour beetle, and could be used in RNAi-mediated control of this invasive pest.
DEFF Research Database (Denmark)
Herckenrath, Daan; Fiandaca, G.; Auken, Esben
2013-01-01
hydrogeophysical inversion approaches to inform a field-scale groundwater model with time domain electromagnetic (TDEM) and electrical resistivity tomography (ERT) data. In a sequential hydrogeophysical inversion (SHI) a groundwater model is calibrated with geophysical data by coupling groundwater model parameters...... with the inverted geophysical models. We subsequently compare the SHI with a joint hydrogeophysical inversion (JHI). In the JHI, a geophysical model is simultaneously inverted with a groundwater model by coupling the groundwater and geophysical parameters to explicitly account for an established petrophysical...
A System for Fast Navigation of Autonomous Vehicles
1991-09-01
AD-A243 523 4, jj A System for Fast Navigation of Autonomous Vehicles Sanjiv Singh, Dai Feng, Paul Keller, Gary Shaffer, Wen Fan Shi, Dong Hun Shin...FUNDING NUMBERS A System for Fast Navigation of Autonomous Vehicles 6. AUTHOR(S) S. Singh, D. Feng, P. Keller, G. Shaffer, W.F. Shi, D.H. Shin, J. West...common in the control of autonomous vehicles to establish the necessary kinematic models but to ignore an explicit representation of the vehicle dynamics
Matin, Usep Abdul
2017-01-01
This thesis focuses on Indonesia’s Islamic public sphere and a significant contributor to it over the last four decades, Jalaluddin Rakhmat. He was born in 1949 into a highly conservative Sunnite religious milieu, and began to gradually embrace Shi`ite thought and identity as an adult in 1982. Earlier studies have focused on Rakhmat's Shi`ism, which has been the cause of controversy in predominantly Sunnite Indonesia. This thesis differs from those studies in its attempt to discern a broader ...
DEFF Research Database (Denmark)
Herckenrath, Daan; Fiandaca, G.; Auken, Esben
2013-01-01
with the inverted geophysical models. We subsequently compare the SHI with a joint hydrogeophysical inversion (JHI). In the JHI, a geophysical model is simultaneously inverted with a groundwater model by coupling the groundwater and geophysical parameters to explicitly account for an established petrophysical...... hydrogeophysical inversion approaches to inform a field-scale groundwater model with time domain electromagnetic (TDEM) and electrical resistivity tomography (ERT) data. In a sequential hydrogeophysical inversion (SHI) a groundwater model is calibrated with geophysical data by coupling groundwater model parameters...
Sleeping money: investigating the huge surpluses of social health insurance in China.
Liu, JunQiang; Chen, Tao
2013-12-01
The spreading of social health insurance (SHI) worldwide poses challenges for fledging public administrators. Inefficiency, misuse and even corruption threaten the stewardship of those newly established health funds. This article examines a tricky situation faced by China's largest SHI program: the basic health insurance (BHI) scheme for urban employees. BHI accumulated a 406 billion yuan surplus by 2009, although the reimbursement level was still low. Using a provincial level panel database, we find that the huge BHI surpluses are related to the (temporarily) decreasing dependency ratio, the steady growth of average wages, the extension of BHI coverage, and progress in social insurance agency building. The financial situations of local governments and risk pooling level also matter. Besides, medical savings accounts result in about one third of BHI surpluses. Although these findings are not causal, lessons drawn from this study can help to improve the governance and performance of SHI programs in developing countries.
Structural modification by swift heavy ion at metal/Si interface
Energy Technology Data Exchange (ETDEWEB)
Sisodia, Veenu; Jain, R.K.; Bhattacharaya, D.; Kabiraj, D.; Jain, I.P. E-mail: ipjain46@sify.com
2003-06-01
Transition metal silicides produced by swift heavy ion (SHI) irradiation have found applications in ultra-large-scale integrated circuits due to their small contact resistivities and higher thermal and chemical stabilities. In the present work, the mixing in Ni/Si and Ti/Si systems was studied under irradiation with Au ions. A layer of Ni (15 nm) and Ti (18 nm) was deposited by e-gun evaporation on Si (1 0 0) substrate at 10{sup -8} Torr vacuum. The samples were irradiated with 95 Mev Au ions at room temperature to a fluence of 10{sup 13} ions/cm{sup 2} and 1 pna beam current. Rutherford backscattering spectroscopy and X-Ray reflectivity have been employed to characterize the samples. The large electronic excitation due to SHI irradiation produces defects in the system. It is expected that SHI irradiation followed by thermal annealing in Ni/Si system will provide the required energy to the atoms to diffuse across the interface resulting in mixing.
Modification of PMMA/graphite nanocomposites through ion beam technique
Singhal, Prachi; Rattan, Sunita; Avasthi, Devesh Kumar; Tripathi, Ambuj
2013-08-01
Swift heavy ion (SHI) irradiation is a special technique for inducing physical and chemical modifications in bulk materials. In the present work, the SHI hs been used to prepare nanocomposites with homogeneously dispersed nanoparticles. The nanographite was synthesized from graphite using the intercalation-exfoliation method. PMMA Poly(methyl methacrylate)/graphite nanocomposites have been synthesized by in situ polymerization. The prepared PMMA/graphite nanocomposite films were irradiated with SHI irradiation (Ni ion beam, 80 MeV and C ion beam, 50 MeV) at a fluence of 1×1010 to 3×1012 ions/cm2. The nanocomposite films were characterized by scanning electron microscope (SEM) and were evaluated for their electrical and sensor properties. After irradiation, significant changes in surface morphology of nanocomposites were observed as evident from the SEM images, which show the presence of well-distributed nanographite platelets. The irradiated nanocomposites exhibit better electrical and sensor properties for the detection of nitroaromatics with marked improvement in sensitivity as compared with unirradiated nanocomposites.
AHP 20: Ballad of The Huang River and Other Stories
Directory of Open Access Journals (Sweden)
Jing Shi
2012-11-01
Full Text Available This book contains three novellas originally written in Chinese by the Qinghai author Jing Shi. The novellas provide a finely textured portrayal of Qinghai rural life in the twentieth century. An introduction and transcribed interview provide context to the stories and their author. From the introduction by Keith Dede: "The wide appeal of Jing Shi's fiction is certainly something he welcomes. As he sees it, literature, at one level, should be entertaining. Stories are a way for people to derive pleasure, enjoy a laugh, and while away some time. But stories are also about communication, about communicating ideas concerning the ironies of life and the trajectory of the human condition. Jing Shi thinks deeply about the people of rural Qinghai, their culture, their predicaments, their hopes, and their tragedies, and his stories communicate his thoughts about these things, but also his deep affection for the people and culture that raised him."
AUTHOR|(SzGeCERN)452451
2016-01-01
Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in dierent theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment and outline the performances of a detector operating at the same facility for the search for the tau --> mu mu mu decay
Creation of nanoscale objects by swift heavy ion track manipulations
International Nuclear Information System (INIS)
Fink, D.; Petrov, A.; Stolterfoht, N.
2003-01-01
In this work we give an overview of the possibilities to create new objects with nanoscale dimensions with ion tracks, for future applications. This can be realized in two ways: by manipulation of latent swift heavy ion (SHI) tracks, or by embedding specific structures within etched SHI tracks. In the first case one can make use of irradiation effects such as phase transitions and chemical or structural changes along the tracks. In the latter case, one can fill etched SHI tracks with metals, semiconductors, insulating and conducting polymers, fullerite, or colloides. Wires and tubules with outer diameters, between about 50 nm and 5 μm and lengths of up to about 100 μm can be obtained. The most important production techniques are galvanic and chemical depositions. Ion Transmission Spectrometry has turned out to be an especially useful tool for the characterisation of the produced objects. Present studies aim at the construction of condensers, magnets, diodes, and sensors in etched tracks. An obstacle for the practical realization of smallest-size polymeric ion track devices is the statistical distribution of the ion tracks on the target areas, which yields some pixels without any track, and other pixels even with overlapping tracks on a given sample. In a first test experiment we demonstrate that one can, in principle, overcome that problem by taking self-ordered porous foils as masks for subsequent high-fluence SHI irradiation. (author)
Fu, Lian Guo; Sun, Li Li; Wu, Shao Wei; Yang, Yi De; Li, Xiao Hui; Wang, Zheng He; Wu, Lu; Wang, Fu Zhi; Ma, Jun
2016-12-01
To explore the influence of secular trends in body height and weight on the prevalence of overweight and obesity among Chinese children and adolescents. The data were obtained from five cross-sectional Chinese National Surveys on Students' Constitution and Health. Overweight/obesity was defined as BMI-for-age Z-score of per the Wold Health Organization (WHO) reference values. Body height and weight for each sex and age were standardized to those reported in 1985 (standardized height: SHY; standardized weight: SWY) and for each sex and year at age 7 (standardized height: SHA; standardized weight: SWA) using the Z-score method. The prevalence of overweight/obesity in Chinese children was 20.2% among boys and 10.7% among girls in 2010 and increased continuously from 1985 to 2010. Among boys and girls of normal weight, SHY and SHA were significantly greater than SWY and SWA, respectively (P overweight/obesity, SHY was significantly lower than SWY (P overweight boys aged 7-8 years and girls aged 7-9 years. SHY/SHW and SHA/SWA among normal-weight groups were greater than among overweight and obese groups (P overweight/obesity among Chinese children may be related to a rapid increase in body weight before age 9 and lack of secular increase in body height after age 12. Copyright © 2016 The Editorial Board of Biomedical and Environmental Sciences. Published by China CDC. All rights reserved.
Comparison of fundamental, second harmonic, and superharmonic imaging: a simulation study.
van Neer, Paul L M J; Danilouchkine, Mikhail G; Verweij, Martin D; Demi, Libertario; Voormolen, Marco M; van der Steen, Anton F W; de Jong, Nico
2011-11-01
In medical ultrasound, fundamental imaging (FI) uses the reflected echoes from the same spectral band as that of the emitted pulse. The transmission frequency determines the trade-off between penetration depth and spatial resolution. Tissue harmonic imaging (THI) employs the second harmonic of the emitted frequency band to construct images. Recently, superharmonic imaging (SHI) has been introduced, which uses the third to the fifth (super) harmonics. The harmonic level is determined by two competing phenomena: nonlinear propagation and frequency dependent attenuation. Thus, the transmission frequency yielding the optimal trade-off between the spatial resolution and the penetration depth differs for THI and SHI. This paper quantitatively compares the concepts of fundamental, second harmonic, and superharmonic echocardiography at their optimal transmission frequencies. Forward propagation is modeled using a 3D-KZK implementation and the iterative nonlinear contrast source (INCS) method. Backpropagation is assumed to be linear. Results show that the fundamental lateral beamwidth is the narrowest at focus, while the superharmonic one is narrower outside the focus. The lateral superharmonic roll-off exceeds the fundamental and second harmonic roll-off. Also, the axial resolution of SHI exceeds that of FI and THI. The far-field pulse-echo superharmonic pressure is lower than that of the fundamental and second harmonic. SHI appears suited for echocardiography and is expected to improve its image quality at the cost of a slight reduction in depth-of-field.
Götze, R
2016-11-01
Background: The expansion of trust law to the German statutory health insurance (SHI) and the declining numbers of sickness funds suggest a strong concentration process in the German SHI market. The paper examines the level and development of market concentration since the introduction of the free choice of sickness funds in 1996. Data: The study is based on a dataset containing information on membership, contribution rate, openness, area of activity and legal successor for all sickness funds in the period from 1996 to 2013. Methods: Market concentration is measured by the concentration rate (cumulative market share of the largest market participants) and the Herfindahl-Hirschman index (HHI). In addition, the change in the HHI is also disaggregated into 3 factors: opening, switching and fusion of sickness funds. Results: Concentration rate and HHI decreased significantly between 1996 and 2008 due to opening of former closed sickness funds and a switching behaviour from large to small funds. The SHI Competition Enhancement Act of 2007 led to a turnaround. The reform permitted cross-type mergers and introduced a completely new system of budget allocation with the central health fund. The latter put an end to the growing membership of small funds due to adverse selection processes. As a result, market concentration in the German SHI rises. Although recent mega-mergers were uncritical for nationwide competition, the study already indicates the risk of market dominance on the regional level. © Georg Thieme Verlag KG Stuttgart · New York.
Tunable Stimulated Brillouin Scattering in Planar Optical Circuits
2012-11-01
J. Gauthier, R. W. Boyd, and A. L. Gaeta, Phys. Rev. Lett. 94, 153902 (2005). 4. R. Pant, M. D. Stenner , M. A. Neifeld, and D. J. Gauthier, Opt...Express 16, 2764 (2008). 5. Z. Shi, R. Pant, Z. Zhu, M. D. Stenner , M. A. Neifeld, D. J. Gauthier, and R. W. Boyd, Opt. Lett. 32, 1986 (2007). 6. K. Y...stimulated Brillouin scattering,” Opt. Express 19(9), 8285–8290 (2011). 25. R. Pant, M. D. Stenner , M. A. Neifeld, Z. M. Shi, R. W. Boyd, and D. J
Directory of Open Access Journals (Sweden)
Younsung Choi
2014-06-01
Full Text Available Wireless sensor networks (WSNs consist of sensors, gateways and users. Sensors are widely distributed to monitor various conditions, such as temperature, sound, speed and pressure but they have limited computational ability and energy. To reduce the resource use of sensors and enhance the security of WSNs, various user authentication protocols have been proposed. In 2011, Yeh et al. first proposed a user authentication protocol based on elliptic curve cryptography (ECC for WSNs. However, it turned out that Yeh et al.’s protocol does not provide mutual authentication, perfect forward secrecy, and key agreement between the user and sensor. Later in 2013, Shi et al. proposed a new user authentication protocol that improves both security and efficiency of Yeh et al.’s protocol. However, Shi et al.’s improvement introduces other security weaknesses. In this paper, we show that Shi et al.’s improved protocol is vulnerable to session key attack, stolen smart card attack, and sensor energy exhausting attack. In addition, we propose a new, security-enhanced user authentication protocol using ECC for WSNs.
Implementation of CDC's School Health Index in 3 midwest middle schools: motivation for change.
Sherwood-Puzzello, Catherine M; Miller, Michelle; Lohrmann, David; Gregory, Patricia
2007-08-01
The Centers for Disease Control and Prevention's School Health Index (SHI), a guide for completing a coordinated school-based program needs assessment relative to healthy eating, physical activity, a tobacco-free lifestyle, and prevention of other health risk behaviors and conditions, was used to assess current programming at 3 midwestern middle schools. Employing somewhat different procedures, data were collected from focus groups comprising school administrators, teachers, parents, community members, and students. Participants responded to SHI module questions and provided comments based on their perceptions. Both quantitative and qualitative data were recorded for each module, after which participants answered 3 planning questions intended to guide prioritization of actions to improve policies and programs based on importance, cost, time, commitment, and feasibility. Each school developed recommendations and strategies based on highest priority needs related to community involvement, professional development, health screenings, and health education materials in classrooms. The experience of completing the SHI in 3 different schools provided important insights about the data collection process as well as assessment results that have implications for the design and implementation of prevention programs.
Choi, Younsung; Lee, Donghoon; Kim, Jiye; Jung, Jaewook; Nam, Junghyun; Won, Dongho
2014-06-10
Wireless sensor networks (WSNs) consist of sensors, gateways and users. Sensors are widely distributed to monitor various conditions, such as temperature, sound, speed and pressure but they have limited computational ability and energy. To reduce the resource use of sensors and enhance the security of WSNs, various user authentication protocols have been proposed. In 2011, Yeh et al. first proposed a user authentication protocol based on elliptic curve cryptography (ECC) for WSNs. However, it turned out that Yeh et al.'s protocol does not provide mutual authentication, perfect forward secrecy, and key agreement between the user and sensor. Later in 2013, Shi et al. proposed a new user authentication protocol that improves both security and efficiency of Yeh et al.'s protocol. However, Shi et al.'s improvement introduces other security weaknesses. In this paper, we show that Shi et al.'s improved protocol is vulnerable to session key attack, stolen smart card attack, and sensor energy exhausting attack. In addition, we propose a new, security-enhanced user authentication protocol using ECC for WSNs.
Fryer, Craig S.; Reed, Ernestine A.; Thomas, Stephen B.
2014-01-01
BACKGROUND Insufficient attention has been paid to the process of conducting the Centers for Disease Control and Prevention’s School Health Index (SHI) to promote collaboration between universities and urban school districts when developing adolescent health promotion initiatives. This article provides an overview of the real world contextual challenges and opportunities this type of collaboration can pose. METHODS The SHI and selected collaboration principles were used to facilitate partnership and increase stakeholder buy-in, which led to developing and implementing an eight year health promotion campaign, The Healthy Class of 2010 (HC 2010). RESULTS The focus on planning brought together key stakeholders and allowed for HC 2010 programming to take place despite the competing demands on the schools. The SHI allowed for input from stakeholders to develop campaign activities and inform school- and district-wide policy. Universities and school districts desiring to develop and implement school-based, adolescent health promotion programs should: 1) identify the hierarchical structure of the school district; 2) establish credibility for the program and the university staff; 3) emphasize the benefits to all partners; 4) maintain a cooperative partnership with teachers and administrators; 5) appreciate the need for planning; and, 6) provide as many resources as possible to on an already overburdened school system. CONCLUSIONS Promoting healthy behaviors among students is an important part of the fundamental mission of schools. HC 2010 underscored the significance of collaboration using the SHI in the development and implementation of this health promotion campaign with input from students, teachers, administrators and university partners. PMID:22070509
Directory of Open Access Journals (Sweden)
Zindel Sonja
2012-07-01
Full Text Available Abstract Background Patients undergoing major orthopaedic surgery (MOS, such as total hip (THR or total knee replacement (TKR, are at high risk of developing venous thromboembolism (VTE. For thromboembolism prophylaxis, the oral anticoagulant rivaroxaban has recently been included in the German diagnosis related group (DRG system. However, the cost-effectiveness of rivaroxaban is still unclear from both the German statutory health insurance (SHI and the German hospital perspective. Objectives To assess the cost-effectiveness of rivaroxaban from the German statutory health insurance (SHI perspective and to analyse financial incentives from the German hospital perspective. Methods Based on data from the RECORD trials and German cost data, a decision tree was built. The model was run for two settings (THR and TKR and two perspectives (SHI and hospital per setting. Results Prophylaxis with rivaroxaban reduces VTE events (0.02 events per person treated after TKR; 0.007 after THR compared with enoxaparin. From the SHI perspective, prophylaxis with rivaroxaban after TKR is cost saving (€27.3 saving per patient treated. However, the cost-effectiveness after THR (€17.8 cost per person remains unclear because of stochastic uncertainty. From the hospital perspective, for given DRGs, the hospital profit will decrease through the use of rivaroxaban by €20.6 (TKR and €31.8 (THR per case respectively. Conclusions Based on our findings, including rivaroxaban for reimbursement in the German DRG system seems reasonable. Yet, adequate incentives for German hospitals to use rivaroxaban are still lacking.
Bezshyiko, Iaroslava
2016-01-01
In the SHiP beam-dump of the order of 1011 muons will be produced per second. An active muon-shield is used to magnetically deflect these muons out of the acceptance of the spectrom- eter. This note describes how this shield is modelled and optimized. The SHiP spectrometer is being re-optimized using a conical decay-vessel, and utilizing the possibility to magnetize part of the beam-dump shielding iron. A shield adapted to these new conditions is presented which is significantly shorter and lighter than the shield used in the Technical Proposal (TP), while showing a similar performance.
Horenkamp-Sonntag, D; Linder, R; Engel, S; Verheyen, F
2016-05-01
Due to the insufficient data base the Federal Joint Committee (G-BA) had in 2009 after 7 years of deliberation decided to initiate consultation regarding ambulatory brachytherapy for localised prostate cancer for 10 years from social health insurance (SHI) benefits. The aim is to gain more findings by means of comparative studies. Based on the non-availability of clinical primary data of a methodologically acceptable level, it was analysed to what extent secondary data of the SHI may be used in order to arrive at valid conclusions for benefit aspects. As base approx. 8 million insured of TK with their data of cost reimbursement between 2006 and 2011 were considered. In SHI secondary data no clinical information regarding tumour stage and other prognostic factors are available. Therefore, a novel method with therapy-specific multisectoral inclusion and exclusion criteria, respectively, was developed in order to differentiate between localised and advanced tumours of the prostate. Overall survival, relapse-free survival, event-free survival and side-effects associated to prostate cancer were analysed. Out of 87 822 insured persons with the diagnosis prostate cancer, 795 with PBT, 10 936 with RP and 1 925 with EBRT were investigated in detail. The 4-year event-free survival rate was 73% for RP, 77% for PBT and 71% for EBRT. Many prostate cancer-specific side effects appeared already before intervention. Side effects of the intestinal tract (23.8%) and sexual impairments (26.5%) were more frequent for EBRT than for RP (17.1%/14.8%) and PBT (16.4%/13.2%). By means of SHI secondary data and adequate operationalisation important findings regarding relevant aspects of prostate cancer in healthcare research can be generated. However, these hold methodological limitations and are not suited to draw valid conclusions for benefit assessment. Based solely on SHI routine data valid statements regarding comparative benefit assessment are limited. Limitations could be
Directory of Open Access Journals (Sweden)
Astrid Müller
2018-04-01
Full Text Available Objective: The study aimed at investigating the lifetime prevalence of 22 self-harm behaviors in bariatric surgery candidates (pre-bariatric surgery group; PSG compared to community controls with obesity (obese community group; OCG. Methods: The Self-Harm Inventory (SHI was administered to the PSG (n = 139, BMI ≥ 35 kg/m2 and to the OCG (n = 122, BMI ≥ 35 kg/m2. Results: Group comparison of cumulative SHI scores indicated a trend towards less endorsed SHI items in the PSG compared to the OCG (medianPSG = 1.00, IQRPSG = 2.00, medianOCG = 1.00, IQROCG = 2.25, U = 7.241, p = 0.033, η2 = 0.02. No significant group differences were found with regard to the rate of suicide attempts (12.4% vs. 9.4% for OCG vs. PSG. At least one type of lifetime self-harm behavior was admitted by 51.8% of the PSG and 63.9% of the OCG (χ2(1 = 3.91, p = 0.048. The results of logistic regressions using Firth's bias reduction method with at least one SHI item endorsed as dependent variable, group as categorical predictor (PSG as baseline, and age or BMI or PHQ-4 as continuous control variable indicated that only PHQ-4 had a positive effect on the odds ratio. Conclusion: The results suggest that self-harm (including suicidal attempts is not more prevalent in bariatric surgery candidates than in community control participants with obesity. Further studies are needed to investigate self-harm in bariatric surgery patients, prior and following surgery, compared to non-operated patients with obesity.
Can personality predict individual differences in brook trout spatial learning ability?
White, S.L.; Wagner, Tyler; Gowan, C.; Braithwaite, V.A.
2017-01-01
While differences in individual personality are common in animal populations, understanding the ecological significance of variation has not yet been resolved. Evidence suggests that personality may influence learning and memory; a finding that could improve our understanding of the evolutionary processes that produce and maintain intraspecific behavioural heterogeneity. Here, we tested whether boldness, the most studied personality trait in fish, could predict learning ability in brook trout. After quantifying boldness, fish were trained to find a hidden food patch in a maze environment. Stable landmark cues were provided to indicate the location of food and, at the conclusion of training, cues were rearranged to test for learning. There was a negative relationship between boldness and learning as shy fish were increasingly more successful at navigating the maze and locating food during training trials compared to bold fish. In the altered testing environment, only shy fish continued using cues to search for food. Overall, the learning rate of bold fish was found to be lower than that of shy fish for several metrics suggesting that personality could have widespread effects on behaviour. Because learning can increase plasticity to environmental change, these results have significant implications for fish conservation.
Reddy, Madhavi K; Murdoch, Maureen
2016-02-01
Unwanted sexual stressors experienced by military men and women are associated with a host of negative physical and mental health problems. Government officials are making it a priority to put a stop to these unwanted sexual experiences. However, the measure typically used measures sexual stressors much better for women than for men. The purpose of the present study was to test the factor structure of an alternative measure, the Sexual Harassment Inventory (SHI), to examine whether sexual stressors experienced by men correspond to women's experiences. We used three preexisting datasets in which the SHI was used to assess active and former military members' sexual stressor experiences. We conducted an exploratory factor analysis to identify women's response patterns and a confirmatory factor analysis to determine whether men's response patterns corresponded to women's. Findings showed that the SHI has evidence of factorial validity in female service members and adequate, but not exceptional, factorial fit for male service members. It is imperative that more work be done to better understand how men experience and perceive potential military sexual stressors and how those perceptions and experiences compare to women's. Reprint & Copyright © 2016 Association of Military Surgeons of the U.S.
Coaxing shy particles into an atomic jar
Hellemans, A
2000-01-01
A Dutch-American team claim they can produce anti-hydrogen atoms in far greater quantities than any other current method. They use rubidium ions to trap electrons by applying a pulsed electric field in a series of steps (1 page).
Do talented women shy away from competition?
Hoyer, Britta; van Huizen, T.M.; Keijzer, L.M.; Rezaei Khavas, T.; Rosenkranz, S.; Westbrock, B.
2016-01-01
We study the willingness to compete in a cognitive task among an entire cohort of fresh man business and economics students. Combining data from a lab-in-thefield experiment with university admissions data, we trace the gender gap in competitiveness at different levels of high school performance.
Biased Facial Expression Interpretation in Shy Children
Kokin, Jessica; Younger, Alastair; Gosselin, Pierre; Vaillancourt, Tracy
2016-01-01
The relationship between shyness and the interpretations of the facial expressions of others was examined in a sample of 123 children aged 12 to 14?years. Participants viewed faces displaying happiness, fear, anger, disgust, sadness, surprise, as well as a neutral expression, presented on a computer screen. The children identified each expression…
Testable baryogenesis in seesaw models
Energy Technology Data Exchange (ETDEWEB)
Hernández, P.; Kekic, M. [Instituto de Física Corpuscular, Universidad de Valencia and CSIC,Edificio Institutos Investigación,Catedrático José Beltrán 2, 46980 (Spain); López-Pavón, J. [INFN, Sezione di Genova,via Dodecaneso 33, 16146 Genova (Italy); Racker, J.; Salvado, J. [Instituto de Física Corpuscular, Universidad de Valencia and CSIC,Edificio Institutos Investigación,Catedrático José Beltrán 2, 46980 (Spain)
2016-08-26
We revisit the production of baryon asymmetries in the minimal type I seesaw model with heavy Majorana singlets in the GeV range. In particular we include “washout” effects from scattering processes with gauge bosons, Higgs decays and inverse decays, besides the dominant top scatterings. We show that in the minimal model with two singlets, and for an inverted light neutrino ordering, future measurements from SHiP and neutrinoless double beta decay could in principle provide sufficient information to predict the matter-antimatter asymmetry in the universe. We also show that SHiP measurements could provide very valuable information on the PMNS CP phases.
Structure and Properties of the Fe/Y2O3 Interface from First Principles Calculations
Energy Technology Data Exchange (ETDEWEB)
Choudhury, Samrat [Los Alamos National Laboratory; Stanek, Christopher R. [Los Alamos National Laboratory; Uberuaga, Blas P. [Los Alamos National Laboratory
2012-07-31
Fundamentals of radiation damage are: (1) Formation of Frenkel pair (interstitial-vacancy pair) defects in the lattice; (2) Concentration of Frenkel pair defects >>> thermal equilibrium thermodynamic concentration; and (3) The radiation damage response of a material is determined by the fate of these excess Frenkel pair defects in the lattice. The objective is to understand the electronic and atomic structure of Fe/Y{sub 2}O{sub 3} interface and segregation behavior of the alloying elements at the interface. The significance of the results of this report are: (1) Provides a science based approach to design new radiation resistant materials. Obtained two controlling parameters - Dislocation density (composition, orientation relationship) and Oxygen partial pressure; (2) Applicable to any other metal/oxide interfaces (both functional and structural properties at the interface) - (a) Nano Catalysts: Oxide-supported metal catalysts Ni/ZrO{sub 2}, (b) Thermal barrier coatings (Ni/Al{sub 2}O{sub 3}), (c) Corrosion of metals and alloys.
Natural History Study of Synucleinopathies
2018-01-23
Patients With Synucleinopathies; Neurogenic Orthostatic Hypotension; Pure Autonomic Failure; REM Sleep Behavior Disorder; Parkinson Disease; Dementia With Lewy Bodies; Multiple System Atrophy; Shy-Drager Disease
Quasi-Two-Dimensional Magnetism in Co-Based Shandites
Kassem, Mohamed A.; Tabata, Yoshikazu; Waki, Takeshi; Nakamura, Hiroyuki
2016-06-01
We report quasi-two-dimensional (Q2D) itinerant electron magnetism in the layered Co-based shandites. Comprehensive magnetization measurements were performed using single crystals of Co3Sn2-xInxS2 (0 ≤ x ≤ 2) and Co3-yFeySn2S2 (0 ≤ y ≤ 0.5). The magnetic parameters of both systems; the Curie temperature TC, effective moment peff and spontaneous moment ps; exhibit almost identical variations against the In- and Fe-concentrations, indicating significance of the electron count on the magnetism in the Co-based shandite. The ferromagnetic-nonmagnetic quantum phase transition is found around xc ˜ 0.8. Analysis based on the extended Q2D spin fluctuation theory clearly reveals the highly Q2D itinerant electron character of the ferromagnetism in the Co-based shandites.
International Nuclear Information System (INIS)
Hlatshwayo, T T; Kuhudzai, R J; Njoroge, E G; Malherbe, J B; O’Connell, J H; Skuratov, V A; Msimanga, M
2015-01-01
The effect of swift heavy ion (Xe 167 MeV) irradiation on polycrystalline SiC individually implanted with 360 keV Kr and Xe ions at room temperature to fluences of 2 × 10 16 cm −2 and 1 × 10 16 cm −2 respectively, was investigated using transmission electron microscopy (TEM), Raman spectroscopy and Rutherford backscattering spectrometry (RBS). Implanted specimens were each irradiated with 167 MeV Xe +26 ions to a fluence of 8.3 × 10 14 cm −2 at room temperature. It was observed that implantation of 360 keV Kr and Xe ions individually at room temperature amorphized the SiC from the surface up to a depth of 186 and 219 nm respectively. Swift heavy ion (SHI) irradiation reduced the amorphous layer by about 27 nm and 30 nm for the Kr and Xe samples respectively. Interestingly, the reduction in the amorphous layer was accompanied by the appearance of randomly oriented nanocrystals in the former amorphous layers after SHI irradiation in both samples. Previously, no similar nanocrystals were observed after SHI irradiations at electron stopping powers of 33 keV nm −1 and 20 keV nm −1 to fluences below 10 14 cm −2 . Therefore, our results suggest a fluence threshold for the formation of nanocrystals in the initial amorphous SiC after SHI irradiation. Raman results also indicated some annealing of radiation damage after swift heavy ion irradiation and the subsequent formation of small SiC crystals in the amorphous layers. No diffusion of implanted Kr and Xe was observed after swift heavy ion irradiation. (paper)
Amelung, Volker; Wolf, S; Ozegowski, S; Eble, S; Hildebrandt, H; Knieps, F; Lägel, R; Schlenker, R-U; Sjuts, R
2015-04-01
The traditional separation of health care into sectors in Germany causes communication problems that hinder continuous, patient-oriented care. This is most evident in the transition from inpatient to outpatient care. That said, there are also breaks in the flow of information, a lack of supply, or even incorrect information flowing within same-sector care. The transition from a division of functions into sectors to a patient-oriented process represents a change in the paradigm of health care that can only be successfully completed with considerable effort. Germany's statutory health insurance (SHI) funds play a key role here, as they are the contracting parties as well as the financiers of integrated care, and are strategically located at the center of the development process.The objective of this article is to explore how Germany's SHI funds view integrated care, what they regard as being the drivers of and barriers to transitioning to such a system, and what recommendations they can provide with regard to the further development of integrated care. For this purpose semi-structured interviews with board members and those responsible for implementing integrated care into the operations of ten SHI funds representing more than half of Germany's SHI-insured population were conducted. According to the interviewees, a better framework for integrated care urgently needs to be developed and rendered more receptive to innovation.Only in this way will the widespread stagnation of the past several years be overcome. The deregulation of § 140a-d SGB V and the establishment of a uniform basis for new forms of care in terms of a new innovation clause are among the central recommendations of this article. The German federal government's innovation fund was met with great hope, but also implied risks. Nonetheless, the new law designed to strengthen health care overall generated high expectations.
International Nuclear Information System (INIS)
Hazarika, J.; Kumar, A.
2014-01-01
Highlights: • Upon SHI irradiation the average diameters of PPy nanoparticles increases. • Crystallinity of PPy nanoparticles increases with increasing ion fluence. • IR active vibrational bands have different cross sections for SHI irradiation. • Upon SHI irradiation optical band gap energy of PPy nanoparticles decreases. • Upon SHI irradiation thermal stability of PPy nanoparticles increases. -- Abstract: In this study we report 160 MeV Ni 12+ swift heavy ion irradiation induced enhancement in the structural, optical and electrical properties of spherical polypyrrole (PPy) nanoparticles. High resolution transmission electron microscope results show that the pristine PPy nanoparticles have an average diameter of 11 nm while upon irradiation the average diameter increases to 18 nm at the highest ion fluence of 1 × 10 12 ions/cm 2 . X-ray diffraction studies show an enhancement of crystallinity and average crystallite size of PPy nanoparticles with increasing fluence. Studies of Fourier transform infrared spectra suggest the structural modifications of different functional groups upon irradiation. It also reveals that different functional groups have different sensitivity to irradiation. The infrared active N–H vibrational band at 3695 cm −1 is more sensitive to irradiation with a formation cross-section of 5.77 × 10 −13 cm 2 and effective radius of 4.28 nm. The UV–visible absorption spectra of PPy nanoparticles show that the absorption band undergoes a red shift with increasing fluence. Moreover upon irradiation the optical band gap energy decreases and Urbach’s energy increases with fluence. Thermo-gravimetric analysis studies suggest that upon irradiation the thermal stability of PPy nanoparticles increases which may be attributed to their enhanced crystallinity. Current–voltage characteristics of PPy nanoparticles exhibit non-Ohmic, symmetric behavior which increases with fluence
Energy Technology Data Exchange (ETDEWEB)
Hazarika, J.; Kumar, A., E-mail: ask@tezu.ernet.in
2014-01-01
Highlights: • Upon SHI irradiation the average diameters of PPy nanoparticles increases. • Crystallinity of PPy nanoparticles increases with increasing ion fluence. • IR active vibrational bands have different cross sections for SHI irradiation. • Upon SHI irradiation optical band gap energy of PPy nanoparticles decreases. • Upon SHI irradiation thermal stability of PPy nanoparticles increases. -- Abstract: In this study we report 160 MeV Ni{sup 12+} swift heavy ion irradiation induced enhancement in the structural, optical and electrical properties of spherical polypyrrole (PPy) nanoparticles. High resolution transmission electron microscope results show that the pristine PPy nanoparticles have an average diameter of 11 nm while upon irradiation the average diameter increases to 18 nm at the highest ion fluence of 1 × 10{sup 12} ions/cm{sup 2}. X-ray diffraction studies show an enhancement of crystallinity and average crystallite size of PPy nanoparticles with increasing fluence. Studies of Fourier transform infrared spectra suggest the structural modifications of different functional groups upon irradiation. It also reveals that different functional groups have different sensitivity to irradiation. The infrared active N–H vibrational band at 3695 cm{sup −1} is more sensitive to irradiation with a formation cross-section of 5.77 × 10{sup −13} cm{sup 2} and effective radius of 4.28 nm. The UV–visible absorption spectra of PPy nanoparticles show that the absorption band undergoes a red shift with increasing fluence. Moreover upon irradiation the optical band gap energy decreases and Urbach’s energy increases with fluence. Thermo-gravimetric analysis studies suggest that upon irradiation the thermal stability of PPy nanoparticles increases which may be attributed to their enhanced crystallinity. Current–voltage characteristics of PPy nanoparticles exhibit non-Ohmic, symmetric behavior which increases with fluence.
Fundamental Studies of Recombinant Hydrogenases
Energy Technology Data Exchange (ETDEWEB)
Adams, Michael W. [Univ. of Georgia, Athens, GA (United States)
2014-01-25
This research addressed the long term goals of understanding the assembly and organization of hydrogenase enzymes, of reducing them in size and complexity, of determining structure/function relationships, including energy conservation via charge separation across membranes, and in screening for novel H2 catalysts. A key overall goal of the proposed research was to define and characterize minimal hydrogenases that are produced in high yields and are oxygen-resistant. Remarkably, in spite of decades of research carried out on hydrogenases, it is not possible to readily manipulate or design the enzyme using molecular biology approaches since a recombinant form produced in a suitable host is not available. Such resources are essential if we are to understand what constitutes a “minimal” hydrogenase and design such catalysts with certain properties, such as resistance to oxygen, extreme stability and specificity for a given electron donor. The model system for our studies is Pyrococcus furiosus, a hyperthermophile that grows optimally at 100°C, which contains three different nickel-iron [NiFe-] containing hydrogenases. Hydrogenases I and II are cytoplasmic while the other, MBH, is an integral membrane protein that functions to both evolve H2 and pump protons. Three important breakthroughs were made during the funding period with P. furiosus soluble hydrogenase I (SHI). First, we produced an active recombinant form of SHI in E. coli by the co-expression of sixteen genes using anaerobically-induced promoters. Second, we genetically-engineered P. furiosus to overexpress SHI by an order of magnitude compared to the wild type strain. Third, we generated the first ‘minimal’ form of SHI, one that contained two rather than four subunits. This dimeric form was stable and active, and directly interacted with a pyruvate-oxidizing enzyme with any intermediate electron carrier. The research resulted in five peer-reviewed publications.
Some specific features of a surface-screw plasma instability in semiconductors
International Nuclear Information System (INIS)
Karavaev, G.F.; Tsipivka, Yu.I.
1976-01-01
A numerical analysis of the dispersion relation has been carried out, which enables to discover some new peculiarities in the behaviour of the surface helical instability (SHI) of a semiconductor plasma. To simplify the dispersion relation a semiconductor with nearly equal electron and hole mobilities has been considered. The dependences of threshold characteristics of SHI on a magnetic field H for different angular harmonics are represented graphically. A comparison of the formulas obtained shows that the approximation of truncated series yields an incorrect qualitative dependence of the wavelength on H, whereas asymptotic formulas in the range of strong magnetic fields yield not only a correct qualitative dependence of the threshold characteristics on H, but also a good quantitative agreement
Second harmonic inversion for ultrasound contrast harmonic imaging
Energy Technology Data Exchange (ETDEWEB)
Pasovic, Mirza; Danilouchkine, Mike; Faez, Telli; Van Neer, Paul L M J; Van der Steen, Antonius F W; De Jong, Nico [THORAXCENTER, Department of Biomedical Engineering Ee2302, Erasmus MC, Rotterdam (Netherlands); Cachard, Christian; Basset, Olivier, E-mail: mirza.pasovic@creatis.insa-lyon.fr [CREATIS-LRMN, Universite de Lyon, INSA-Lyon, Universite Lyon 1, Inserm U630, CNRS UMR 5220 (France)
2011-06-07
Ultrasound contrast agents (UCAs) are small micro-bubbles that behave nonlinearly when exposed to an ultrasound wave. This nonlinear behavior can be observed through the generated higher harmonics in a back-scattered echo. In past years several techniques have been proposed to detect or image harmonics produced by UCAs. In these proposed works, the harmonics generated in the medium during the propagation of the ultrasound wave played an important role, since these harmonics compete with the harmonics generated by the micro-bubbles. We present a method for the reduction of the second harmonic generated during nonlinear-propagation-dubbed second harmonic inversion (SHI). A general expression for the suppression signals is also derived. The SHI technique uses two pulses, p' and p'', of the same frequency f{sub 0} and the same amplitude P{sub 0} to cancel out the second harmonic generated by nonlinearities of the medium. Simulations show that the second harmonic is reduced by 40 dB on a large axial range. Experimental SHI B-mode images, from a tissue-mimicking phantom and UCAs, show an improvement in the agent-to-tissue ratio (ATR) of 20 dB compared to standard second harmonic imaging and 13 dB of improvement in harmonic power Doppler.
Cancer antigens are expressed in a carcinogen-transformed Bloom syndrome B-lymphoblastoid cell line
International Nuclear Information System (INIS)
Shiraishi, Yukimasa; Soma, Hiroaki
1988-01-01
The authors have cloned malignant cells carrying specific antigens associated with ovarian cancer (OVC) and malignant lymphoma (ML) from BS-SHI-4M cells, a line derived from a 1-methyl-3-nitro-1-nitrosoguanidine-treated B-lymphoblastoid cell line isolated from a patient with Bloom syndrome. Since BS-SHI-4M cells react with sera from various individual cancer patients at relatively low frequencies (2-9%), as detected by an indirect immunofluorescence technique, cell clones that specifically react with sera from patients with OVC and ML were separated by the panning method in which polystyrene dishes were coated with sera from OVC and ML patients and cells with the corresponding antigens bound to the dishes. Subsequent cloning by limiting dilution provided cell clones highly enriched for OVC- and ML-associated antigens. Karyotype analyses revealed that cell clones with OVC and ML antigens had common marker chromosomes. Interestingly, in cell clones with a strong OVC antigen response, the distal part of the Y chromosome (Yq11) was missing in 100% of the cells. Therefore the cell line BS-SHI-4M appears to be a reservoir of cell clones each of which carries a specific tumor antigen and thus provides a potential tool for rapid serological diagnosis of cancer
Second harmonic inversion for ultrasound contrast harmonic imaging
International Nuclear Information System (INIS)
Pasovic, Mirza; Danilouchkine, Mike; Faez, Telli; Van Neer, Paul L M J; Van der Steen, Antonius F W; De Jong, Nico; Cachard, Christian; Basset, Olivier
2011-01-01
Ultrasound contrast agents (UCAs) are small micro-bubbles that behave nonlinearly when exposed to an ultrasound wave. This nonlinear behavior can be observed through the generated higher harmonics in a back-scattered echo. In past years several techniques have been proposed to detect or image harmonics produced by UCAs. In these proposed works, the harmonics generated in the medium during the propagation of the ultrasound wave played an important role, since these harmonics compete with the harmonics generated by the micro-bubbles. We present a method for the reduction of the second harmonic generated during nonlinear-propagation-dubbed second harmonic inversion (SHI). A general expression for the suppression signals is also derived. The SHI technique uses two pulses, p' and p'', of the same frequency f 0 and the same amplitude P 0 to cancel out the second harmonic generated by nonlinearities of the medium. Simulations show that the second harmonic is reduced by 40 dB on a large axial range. Experimental SHI B-mode images, from a tissue-mimicking phantom and UCAs, show an improvement in the agent-to-tissue ratio (ATR) of 20 dB compared to standard second harmonic imaging and 13 dB of improvement in harmonic power Doppler.
Can personality predict individual differences in brook trout spatial learning ability?
White, S L; Wagner, T; Gowan, C; Braithwaite, V A
2017-08-01
While differences in individual personality are common in animal populations, understanding the ecological significance of variation has not yet been resolved. Evidence suggests that personality may influence learning and memory; a finding that could improve our understanding of the evolutionary processes that produce and maintain intraspecific behavioural heterogeneity. Here, we tested whether boldness, the most studied personality trait in fish, could predict learning ability in brook trout. After quantifying boldness, fish were trained to find a hidden food patch in a maze environment. Stable landmark cues were provided to indicate the location of food and, at the conclusion of training, cues were rearranged to test for learning. There was a negative relationship between boldness and learning as shy fish were increasingly more successful at navigating the maze and locating food during training trials compared to bold fish. In the altered testing environment, only shy fish continued using cues to search for food. Overall, the learning rate of bold fish was found to be lower than that of shy fish for several metrics suggesting that personality could have widespread effects on behaviour. Because learning can increase plasticity to environmental change, these results have significant implications for fish conservation. Copyright © 2016 Elsevier B.V. All rights reserved.
Nano-Hydroxyapatite Thick Film Gas Sensors
International Nuclear Information System (INIS)
Khairnar, Rajendra S.; Mene, Ravindra U.; Munde, Shivaji G.; Mahabole, Megha P.
2011-01-01
In the present work pure and metal ions (Co and Fe) doped hydroxyapatite (HAp) thick films have been successfully utilized to improve the structural, morphological and gas sensing properties. Nanocrystalline HAp powder is synthesized by wet chemical precipitation route, and ion exchange process is employed for addition of Co and Fe ions in HAp matrix. Moreover, swift heavy ion irradiation (SHI) technique is used to modify the surface of pure and metal ion exchanged HAp with various ion fluence. The structural investigation of pure and metal ion exchanged HAp thick films are carried out using X-ray diffraction and the presence of functional group is observed by means FTIR spectroscopy. Furthermore, surface morphology is visualized by means of SEM and AFM analysis. CO gas sensing study is carried out for, pure and metal ions doped, HAp thick films with detail investigation on operating temperature, response/recovery time and gas uptake capacity. The surface modifications of sensor matrix by SHI enhance the gas response, response/recovery and gas uptake capacity. The significant observation is here to note that, addition of Co and Fe in HAp matrix and surface modification by SHI improves the sensing properties of HAp films drastically resulting in gas sensing at relatively lower temperatures.
Damage formation and annealing in InP due to swift heavy ions
International Nuclear Information System (INIS)
Kamarou, A.; Wesch, W.; Wendler, E.; Klaumuenzer, S.
2004-01-01
Virgin and pre-damaged InP samples were irradiated at room temperature (RT) and at liquid nitrogen temperature (LNT) with different fluences of 140 MeV Kr, 390 MeV Xe and 600 MeV Au ions. The pre-damaging was performed with 600 keV Ge ions at LNT to obtain different damage levels. The samples were analysed by means of Rutherford backscattering spectrometry (RBS) in random and channelling geometry. A relatively weak damage accumulation in virgin InP and a very significant defect annealing in pre-damaged InP occurs due to 140 MeV Kr irradiation. The damaging of virgin InP with 390 MeV Xe and 600 MeV Au is much more efficient in comparison with that of 140 MeV Kr. Further, annealing of the pre-damaged InP due to 390 MeV Xe irradiation is hardly visible. At LNT InP appears to be much more radiation-resistant to swift heavy ion (SHI) irradiation than at RT. Our results show that during SHI irradiation of InP both damage formation and damage annealing occur simultaneously. Whether the first or the second one plays a more important role depends on the SHI mass and energy
... peripheral; Neuritis - peripheral; Nerve disease; Polyneuropathy; Chronic pain - peripheral neuropathy ... Philadelphia, PA: Elsevier; 2016:chap 107. Shy ME. Peripheral neuropathies. In: Goldman L, Schafer AI, eds. Goldman's Cecil ...
Estimation of Tumor Angiogenesis With Contrast Enhanced Subharmonic Ultrasound Imaging
National Research Council Canada - National Science Library
Forsberg, Flemming
2002-01-01
.... Hence, the current project proposes to increase the ability of breast ultrasound to differentiate between benign and malignant lesions by combining injection of an ultrasound contrast agent with SHI...
Estimation of Tumor Angiogenesis with Contrast Enhanced Subharmonic Ultrasound Imaging
National Research Council Canada - National Science Library
Forsberg, Flemming
2004-01-01
.... Hence, the current project proposes to increase the ability of breast ultrasound to differentiate between benign and malignant lesions by combining injection of an ultrasound contrast agent with SHI...
Estimation of Tumor Angiogenesis With Constrast Enhanced Subharmonic Ultrasound Imaging
National Research Council Canada - National Science Library
Forsberg, Fleming
2003-01-01
.... Hence, the current project proposes to increase the ability of breast ultrasound to differentiate between denign and malignant lesions by combining injection of an ultrasound contrast agent with SHI...
National Aeronautics and Space Administration — I propose to investigate the newly discovered oscillation modes specific to Magnetically Shied (MS) Hall Effect Thrusters (HET). Although HETs are classified as a...
Compulsive buying and borderline personality symptomatology.
Sansone, Randy A; Chang, Joy; Jewell, Bryan; Sellbom, Martin; Bidwell, Mark
2013-04-01
In this study, the authors investigated the relationship between compulsive buying and borderline personality disorder (BPD) symptomatology--two disorders possibly linked through impulsivity. Using a survey methodology in a cross-sectional consecutive sample of nonemergent female outpatients from an obstetrics/gynecology clinic, the authors assessed compulsive buying with the compulsive buying scale (CBS) and BPD symptomatology through the BPD scale of the personality diagnostic questionnaire-4 (PDQ-4) and the self-harm Inventory (SHI). In this sample, 8% of Caucasian women and 9% of African-American women scored positively for compulsive buying. The correlations between scores on the CBS and the PDQ-4 and SHI were 0.43 and 0.41, respectively-both statistically significant at the p buying and BPD, particularly among African-American women.
Ion beam induced effects on the ferromagnetism in Pd nanoparticles
International Nuclear Information System (INIS)
Kulriya, P. K.; Mehta, B. R.; Agarwal, D. C.; Agarwal, Kanika; Kumar, Praveen; Shivaprasad, S. M.; Avasthi, D. K.
2012-01-01
Present study demonstrates the role of metal-insulator interface and ion irradiation induced defects on the ferromagnetic properties of the non-magnetic materials. Magnetic properties of the Pd nanoparticles(NPs) embedded in the a-silica matrix synthesized using atom beam sputtering technique, were determined using SQUID magnetometry measurements which showed that ferromagnetic response of Pd increased by 3.5 times on swift heavy ion(SHI) irradiation. The ferromagnetic behavior of the as-deposited Pd NPs is due to strain induced by the surrounding matrix and modification in the electronic structure at the Pd-silica interface as revealed by insitu XRD and XPS investigations, respectively. The defects created by the SHI bombardment are responsible for enhancement of the magnetization in the Pd NPs.
Sun, Bai-Ye; Kan, Shi-Hong; Zhang, Yan-Zong; Wu, Jun; Deng, Shi-Huai; Liu, Chun-Sheng; Yang, Gang
2010-01-15
The following article from Environmental Toxicology, 'Long-term Copper Toxicity in Apple Trees (Malus pumila Mill) and Bioaccumulation in Fruits' by Bai-Ye Sun, Shi- Hong Kan, Yan-Zong Zhang, Jun Wu, Shi-Huai Deng, Chun-Sheng Liu and Gang Yang, published online on January 15, 2010 in Wiley InterScience (www.interscience.wiley.com; DOI: 10.1002/tox.20565), has been retracted by agreement between the authors, the journal Editor in Chief, Dr. Paul Tchounwou, and Wiley Periodicals, Inc. The retraction has been agreed at the request of the authors due to overlap with 'Copper Toxicity and Bioaccumulation in Chinese Cabbage (Brassica pekinensis Rupr.)' by Zhi-Ting Xiong and Hai Wang, published in Environmental Toxicology, Volume 20, pages 188-194, 2005.
Proceedings – Mathematical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Jiangtao Shi1 Cui Zhang1 2. School of Mathematics and Information Science, Yantai University, Yantai 264005, China; University of Primorska, IAM, Muzejski trg 2, 6000 Koper, Slovenia ...
Kui nuustakulased Berliinis käisid / Jaak Lõhmus
Lõhmus, Jaak
2007-01-01
57. Berliini filmifestivali peaauhinna Kuldkaru sai Hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"). Ka teistest auhinnasaajatest. Kokkuvõte festivalist ja eestlastest festivalil
Nõela all : Igakuine vinüülitutvustus / Ninja
Ninja
1999-01-01
Heliplaatide The Ram Trilogy "Chapter Three EP", JMJ & Richie "Zebra 3/Temporal Mechanics", USG feat. Monica Elam "Life Is 4 Living", Shy FX "bambaata ", Bloefield "Nexus", Leon Thomas "The Antology" tutvustus
Synthesis and characterization of cobaltite nanotubes for solid-oxide fuel cell cathodes
Energy Technology Data Exchange (ETDEWEB)
Napolitano, F; Baque, L; Troiani, H; Granada, M; Serquis, A, E-mail: aserquis@cab.cnea.gov.a [Instituto Balseiro-Centro Atomico Bariloche and CONICET, San Carlos de Bariloche (Argentina)
2009-05-01
La{sub 1-x}Sr{sub x}Co{sub 1-y}FeyO{sub 3-d}elta oxides are good candidates for solid oxide fuel cell (SOFC) cathodes because these materials present high ionic and electronic conductivity, and compatibility with Cerium Gadolinium Oxide (CGO) electrolytes allowing a lower operation temperature. In this work, we report the synthesis of La{sub 0.4}Sr{sub 0.6}Co{sub 0.8}Fe{sub 0.2}O{sub 3-d}elta (LSCF) nanotubes prepared by a porous polycarbonate membrane approach, obtaining different microstructures depending on sintering conditions. The structure and morphology of the nanotubes and deposited films were characterized by X-ray diffraction, transmission and scanning microscopy. Finally, we obtained nanostructured films of vertically aligned LSCF tubes deposited over the whole surface of CGO pellets with diameter up to 2.5cm in a direct and single step process.
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Yang Xian-Lin1 2 Tang Jia-Shi1. College of Mechanics and Aerospace, Hunan University, Changsha, Hunan 410082, China; Hunan Radio and Television University, Changsha, Hunan 410004, China ...
Victorian Dragons: The Reluctant Brood.
Berman, Ruth
1984-01-01
Relates why nineteenth century fantasy writers shied away from the use of dragons in their stories and rejoices over the return and happy transformation of this mythical beast in children's literature. (HOD)
Search for heavy sterile neutrinos with SHiP
Jacobsson, Richard
Invited contribution to the White Paper on keV sterile neutrino Dark Matter as proceedings of the v-Dark 2015 international workshop which was held at the Institute for Advanced Study of the Technical University of Munich, Garching, Germany, 7 - 9 December 2015. White Paper will be submitted to JCAP.
Iranian Influence in Iraqi Shi’a Groups
2012-06-01
Movement in Iraq, 254. 60 Jabar, The Shīʻite Movement in Iraq, 254. 61 Robert Fisk, The Great War For Civilisation : the Conquest of the Middle East...by Iran in 62 Fisk, The Great War For Civilisation : the Conquest of the Middle East, 647. 63 John...U.S. soldier missing in Iraq. AAH sources indicated that the group was not behind the killing but rather just mediators in the process of returning
Lifescience Database Archive (English)
Full Text Available 34, mRNA sequence. 42 5.0 1 DV288069 |DV288069.1 NAAHW80TF Aedes aegypti - Fat Bodie...583TR Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0... 1 DV284076 |DV284076.1 NAAG583TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) ...Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0 1 DV276964 |DV276964.1 NAAFQ66TR Aedes aegypti - Fat Bodie...AAFQ66TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAFQ66, mRNA sequence. 42
Lifescience Database Archive (English)
Full Text Available ESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHALTNSIQDAVV RYHRMKG*slfmgtryrscrycnts...KQEAEEKIVREHIEKILKTPKGEKKDVSSLLSSYHPTAV ESIWYDYWLDNGYFSPEKQMEIQPHVVKDKKFVIVIPPPNVTGSLHLGHALTNSIQDAVV RYHRMKG*slfmgtryrscrycnts
Lifescience Database Archive (English)
Full Text Available nt alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 106 4e-22 BC1384...82_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 104 2e-21 (Q9JLC8) RecName: Full=Sacsi
Lifescience Database Archive (English)
Full Text Available 044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering ...Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50... 0.068 1 CR034434 |CR034434.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPP142o16. 50 0.068 1 BX990136 |B...X990136.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHP
Lifescience Database Archive (English)
Full Text Available . 42 8.2 1 CR129751 |CR129751.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPN147m24. 42 8.2 1 CR010531 |CR010531.1 Reverse strand read... from insert in 5'HPRT insertion targeting and chromosome engineering clone MHPN2...17j13. 42 8.2 1 CR103480 |CR103480.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering
Manufacturability of compact synchrotron mirrors
Douglas, Gary M.
1997-11-01
While many of the government funded research communities over the years have put their faith and money into increasingly larger synchrotrons, such as Spring8 in Japan, and the APS in the United States, a viable market appears to exist for smaller scale, research and commercial grade, compact synchrotrons. These smaller, and less expensive machines, provide the research and industrial communities with synchrotron radiation beamline access at a portion of the cost of their larger and more powerful counterparts. A compact synchrotron, such as the Aurora-2D, designed and built by Sumitomo Heavy Industries, Ltd. of japan (SHI), is a small footprint synchrotron capable of sustaining 20 beamlines. Coupled with a Microtron injector, with 150 MeV of injection energy, an entire facility fits within a 27 meter [88.5 ft] square floorplan. The system, controlled by 2 personal computers, is capable of producing 700 MeV electron energy and 300 mA stored current. Recently, an Aurora-2D synchrotron was purchased from SHI by the University of Hiroshima. The Rocketdyne Albuquerque Operations Beamline Optics Group was approached by SHI with a request to supply a group of 16 beamline mirrors for this machine. These mirrors were sufficient to supply 3 beamlines for the Hiroshima machine. This paper will address engineering issues which arose during the design and manufacturing of these mirrors.
Farmers` satisfaction with the performance of the Mooi River ...
African Journals Online (AJOL)
2013-08-15
Aug 15, 2013 ... Key performance issues in SHI schemes range from technical, agronomic .... selected through stratified random sampling during the. 2010/11 irrigation season. ..... fied with the irrigation service endeavour to achieve optimum.
Investigation of Au9+ swift heavy ion irradiation on CdS/CuInSe2 thin films
International Nuclear Information System (INIS)
Joshi, Rajesh A.; Taur, Vidya S.; Singh, Fouran; Sharma, Ramphal
2013-01-01
In the present manuscript we report about the preparation of CdS/CuInSe 2 heterojunction thin films by chemical ion exchange method and investigation of 120 MeV Au 9+ swift heavy ions (SHI) irradiation effect on its physicochemical as well as optoelectronic properties. These pristine (as grown) samples are irradiated with 120 MeV Au 9+ SHI of 5×10 11 and 5×10 12 ions/cm 2 fluencies and later on characterized for structural, compositional, morphological, optical and I–V characteristics. X-ray diffraction (XRD) pattern obtained from pristine and irradiated films shows considerable modifications in peak intensity as well as rising of some new peaks, corresponding to In 2 Se 3 , Cu 3 Se 2 and CuIn 2 Se 3 materials. Transmission electron microscope (TEM) images show decrease in grain size upon increase in irradiation ion fluencies, which is also supported from the observation of random and uneven distribution of nano-grains as confirmed through scanning electron microscope (SEM) images. Presence of Cd, Cu, In, S and Se in energy dispersive X-ray spectrum analysis (EDAX) confirms the expected and observed elemental composition in thin films, the absorbance peaks are related to band to band transitions and spin orbit splitting while energy band gap is observed to increase from 1.36 for pristine to 1.53 eV for SHI irradiated thin films and I–V characteristics under illumination to 100 mW/cm 2 light source shows enhancement in conversion efficiency from 0.26 to 1.59% upon irradiation. - Highlights: • Nanostructured CdS/CuInSe 2 can be grown by chemical ion exchange method. • Physicochemical and optoelectronic properties can be modified by 120 MeV Au 9+ SHI Irradiation. • Solar energy conversion efficiency improved from 0.26 to 1.59% in CdS/CuInSe 2 upon irradiation
... sports like baseball and basketball to martial arts, biking, hiking, and playing outside. As kids learn basic ... shoes might help a shy teen feel comfortable biking or going to the gym. Kids' Fitness Personalities ...
... this site from a secured browser on the server. Please enable scripts and reload this page. Turn ... then an evaluation by a child mental-health professional would be helpful. Time to adjust Most shy ...
Study on Climate and Grassland Fire in HulunBuir, Inner Mongolia Autonomous Region, China
Directory of Open Access Journals (Sweden)
Meifang Liu
2017-03-01
distributed in Xin Barag Youqi, Xin Barag Zuoqi, Zalantun Shi, Oroqen Zizhiqi, and Molidawa Zizhiqi; the zones with medium fire climate index are mainly distributed in Chen Barag Qi, Ewenkizu Zizhiqi, Manzhouli Shi, and Arun Qi; and the zones with lower fire climate index are mainly distributed in Genhe Shi, Ergun city, Yakeshi Shi, and Hailar Shi. The results of this study will contribute to the quantitative assessment and management of early warning and forecasting for mid-to long-term grassland fire risk in HulunBuir.
Study of low vibration 4 K pulse tube cryocoolers
Xu, Mingyao; Nakano, Kyosuke; Saito, Motokazu; Takayama, Hirokazu; Tsuchiya, Akihiro; Maruyama, Hiroki
2012-06-01
Sumitomo Heavy Industries, Ltd. (SHI) has been continuously improving the efficiency and reducing the vibration of a 4 K pulse tube cryocooler. One advantage of a pulse tube cryocooler over a GM cryocooler is low vibration. In order to reduce vibration, both the displacement and the acceleration have to be reduced. The vibration acceleration can be reduced by splitting the valve unit from the cold head. One simple way to reduce vibration displacement is to increase the wall thickness of the tubes on the cylinder. However, heat conduction loss increases while the wall thickness increases. To overcome this dilemma, a novel concept, a tube with non-uniform wall thickness, is proposed. Theoretical analysis of this concept, and the measured vibration results of an SHI lowvibration pulse tube cryocooler, will be introduced in this paper.
PATTERNS OF SEVEN AND COMPLICATED MALARIA IN CHILDREN
African Journals Online (AJOL)
GB
To address this, Ethiopia is currently introducing Social Health Insurance. However ... adequate awareness creation and discussion should be made with all employees at various levels for the .... description included the SHI benefits as well as.
... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...
Numerical simulation of laser bending of AISI 304 plate with a ...
African Journals Online (AJOL)
Keywords: laser bending; process modeling; bending angle; response surface models. ... (Shi et al., 2007) presented numerical simulation of bending for with different shapes of laser ..... Matlab 2011a application code is used to develop and.
Irritable Bowel Syndrome and Complementary Health Practices
... IBS) in adults: conventional and complementary/alternative approaches. Alternative Medicine Review. 2011;16(2):134–151. Herbal Supplements Shi J, Tong Y, Shen JG, et al. Effectiveness and safety of herbal medicines in the treatment ...
A novel parameter estimation method for metal oxide surge arrester ...
Indian Academy of Sciences (India)
the program, which is based on MAPSO algorithm and can determine the fitness and parameters .... to solve many optimization problems (Kennedy & Eberhart 1995; Eberhart & Shi 2001; Gaing. 2003 ... describe the content of this concept. V el.
Estimation of Tumor Angiogenesis With Contrast Enhanced Subharmonic Ultrasound Imaging
National Research Council Canada - National Science Library
Forsberg, Flemming
2005-01-01
...) and receiving at the subharmonic (f0). Hence, the current project proposes to increase the ability of breast ultrasound to differentiate between benign and malignant lesions by combining injection of an ultrasound contrast agent with SHI...
Secondary School Students Preferences for Instructional Strategies ...
African Journals Online (AJOL)
User
Yet, value pertaining to discipline in sexual attitude among adolescent is gradually being eroded. ... education into the secondary school curriculum. .... hidden. This result also goes to confirm the researcher's opinion that parents tend to shy ...
Olivine-Based Blended Compounds as Positive Electrodes for Lithium Batteries
Directory of Open Access Journals (Sweden)
Christian M. Julien
2016-05-01
Full Text Available Blended cathode materials made by mixing LiFePO4 (LFP with LiMnPO4 (LMP or LiNi1/3Mn1/3Co1/3O2 (NMC that exhibit either high specific energy and high rate capability were investigated. The layered blend LMP–LFP and the physically mixed blend NMC–LFP are evaluated in terms of particle morphology and electrochemical performance. Results indicate that the LMP–LFP (66:33 blend has a better discharge rate than the LiMn1−yFeyPO4 with the same composition (y = 0.33, and NMC–LFP (70:30 delivers a remarkable stable capacity over 125 cycles. Finally, in situ voltage measurement methods were applied for the evaluation of the phase evolution of blended cathodes and gradual changes in cell behavior upon cycling. We also discuss through these examples the promising development of blends as future electrodes for new generations of Li-ion batteries.
... Enlarged breast tissue (gynecomastia) Weak bones Low energy levels Tendency to be shy and sensitive Difficulty expressing thoughts and feelings or socializing Problems with reading, writing, spelling or math Men Low sperm count or no sperm Small ...
Engineering of E. coli for increased production of L- lactic acid
African Journals Online (AJOL)
STORAGESEVER
2009-09-15
Sep 15, 2009 ... Wakamatsu-ku, Kitakyushu-shi, Fukuoka, Japan. Accepted 11 ... was cloned into pBAD vector and transformed into E. coli SZ85 by electroporation. SDS-page and ..... replacement. In the first construct, the internal promoter.
Estimation of Tumor Angiogenesis With Contrast Enhanced Subharmonic Ultrasound Imaging
National Research Council Canada - National Science Library
Forsberg, Flemming
2001-01-01
...) and receiving at the subharmonic (f0) . Because of no subharmonic generation in tissue and significant subharmonic scattering from some new contrast agents SHI has the potential to detect slow, small volume blood flow associated with tumor...
Effect of 1-methylcyclopropene (1- MCP) treatment on antioxidant ...
African Journals Online (AJOL)
ajl2
2013-02-13
Feb 13, 2013 ... antioxidant enzymes of postharvest Japanese apricot. Ting Shi1, Zhiqiang Li2 ... ethylene in plants, increased the post-harvest life of fruits ... raw material processing. .... period. Interestingly, the activity of the treated group rose.
Lebanon's Hizbollah Movement: The Party of God
National Research Council Canada - National Science Library
Schad, Andrew
1999-01-01
In the summer of 1982 in Lebanon, a group of radical Shi'a Muslim clerics in association with Iranian Revolutionary Guardsmen formed the secretive and at times deadly movement known as Hizbollah, or the Party of God...
Energy Technology Data Exchange (ETDEWEB)
Starke, K.
1997-01-01
The door to China`s vast market for power generation was opened a bit further for foreign firms in November. That is when power ministry head Shi Dazhen said the country would rely on overseas investors for 20 percent of the funding needed to boost output--double the amount foreigners were previously allowed to contribute. Through 1995, foreigners invested $12.2 billion in China`s electricity industry, accounting for 10 percent of total investment. According to Shi, foreign investors will be asked to provide about $17 billion of the $84 billion China plans to invest in the sector over the next five years. Under China`s Ninth Five-Year Plan (1996-2000), the government aims to boost the country`s power generation capacity at the rate of 15,000 MW to 20,000 MW annually by the year 2000. Since China`s public external debt balance already exceeds $80 billion, however, the government would seem to have little choice but to allow foreigners a greater role. Shi also said that foreigners would be allowed 100 percent ownership of PRC power projects. This is discouraged under China`s current industry guidelines. It is, however, expected to be permitted under China`s first build-operate-transfer (BOT) law, which was anticipated by the end of 1996, says Susan Urkevich, director of project finance at HSBC Investment Bank Asia in Hong Kong. Indeed, China`s first BOT is already happening.
Model of wet chemical etching of swift heavy ions tracks
Gorbunov, S. A.; Malakhov, A. I.; Rymzhanov, R. A.; Volkov, A. E.
2017-10-01
A model of wet chemical etching of tracks of swift heavy ions (SHI) decelerated in solids in the electronic stopping regime is presented. This model takes into account both possible etching modes: etching controlled by diffusion of etchant molecules to the etching front, and etching controlled by the rate of a reaction of an etchant with a material. Olivine ((Mg0.88Fe0.12)2SiO4) crystals were chosen as a system for modeling. Two mechanisms of chemical activation of olivine around the SHI trajectory are considered. The first mechanism is activation stimulated by structural transformations in a nanometric track core, while the second one results from neutralization of metallic atoms by generated electrons spreading over micrometric distances. Monte-Carlo simulations (TREKIS code) form the basis for the description of excitations of the electronic subsystem and the lattice of olivine in an SHI track at times up to 100 fs after the projectile passage. Molecular dynamics supplies the initial conditions for modeling of lattice relaxation for longer times. These simulations enable us to estimate the effects of the chemical activation of olivine governed by both mechanisms. The developed model was applied to describe chemical activation and the etching kinetics of tracks of Au 2.1 GeV ions in olivine. The estimated lengthwise etching rate (38 µm · h-1) is in reasonable agreement with that detected in the experiments (24 µm · h-1).
The proton therapy system for Massachusetts General Hospital's Northeast Proton Therapy Center
International Nuclear Information System (INIS)
Jongen, Y.
1996-01-01
In 1989, two companies, Ion Beam Applications in Belgium (IBA) and Sumitomo Heavy Industries in Japan (SHI) started to design proton therapy equipments based on cyclotrons. In 1991, SHI and IBA decided to join their development efforts in this field. In 1993, the Massachusetts General Hospital (MGH), pioneer in the field of proton therapy, launched an international request for proposals for the procurement of an in-hospital proton therapy facility. The 18 may 1994, the contract was signed with a team of industries led by IBA, including also SHI and General Atomics (GA) of California. The proposed system is based on a fixed energy, isochronous cyclotron, followed by an energy degrader and an energy selection system. The variable energy beam can be rapidly switched in any one of three treatment rooms. Two rooms are equipped with large isocentric gantries and robotic patient positioners allowing to direct the proton beam within the patient from any direction. The third room is equipped with fixed horizontal beam. The complete system is computer controlled by a distributed network of computers, programmable logic controllers and workstations. This computer control allows to change the energy in one treatment room is less than two second, a performance matching or exceeding the flexibility offered by synchrotrons. The system is now built and undergoing factory tests. The beam has been accelerated to full energy in the cyclotron, and beam extraction tests are underway. Installation in the hospital building will take place in 1997. (author)
International Nuclear Information System (INIS)
Benyagoub, A.
2015-01-01
This paper discusses recent results on the recrystallization effect induced by swift heavy ions (SHI) in pre-damaged silicon carbide. The recrystallization kinetics was followed by using increasing SHI fluences and by starting from different levels of initial damage within the SiC samples. The quantitative analysis of the data shows that the recrystallization rate depends drastically on the local amount of crystalline material: it is nil in fully amorphous regions and becomes more significant with increasing amount of crystalline material. For instance, in samples initially nearly half-disordered, the recrystallization rate per incident ion is found to be 3 orders of magnitude higher than what it is observed with the well-known IBIEC process using low energy ions. This high rate can therefore not be accounted for by the existing IBIEC models. Moreover, decreasing the electronic energy loss leads to a drastic reduction of the recrystallization rate. A comprehensive quantitative analysis of all the experimental results shows that the SHI induced high recrystallization rate can only be explained by a mechanism based on the melting of the amorphous zones through a thermal spike process followed by an epitaxial recrystallization initiated from the neighboring crystalline regions if the size of the latter exceeds a certain critical value. This quantitative analysis also reveals that recent molecular dynamics calculations supposed to reproduce this phenomenon are wrong since they overestimated the recrystallization rate by a factor ∼40.
Child shyness and peer likeability: The moderating role of pragmatics and vocabulary.
Cheung, Hoi Shan; Elliott, John M
2017-11-01
The association between shyness and children's likeability by peers was examined, with pragmatic difficulty and receptive and expressive vocabularies as moderators. Participants were 164 preschoolers (72 boys, 92 girls) between 52 and 79 months old in Singapore. A cross-informant methodology was used, with peers and teachers contributing to separate peer likeability ratings. The findings highlighted a conceptual distinction between peer- and teacher-rated likeability by peers. For the latter only, a 3-way interaction involving shyness, vocabulary, and pragmatic difficulty was found, indicating that for shy children with low vocabulary scores, those who experienced less pragmatic difficulty tended to be seen by teachers as more well-liked by peers than those with more pragmatic difficulty. This suggests that pragmatic skills may serve a protective function especially for shy children with poor vocabulary skills. Statement of contribution What is already known on this subject? Child shyness is related to poorer peer acceptance and social competence Expressive vocabulary and pragmatic competence each has a buffering effect for shy children What the present study adds? Shyness is related to poorer peer likeability as assessed by teachers Shyness is unrelated to peer likeability as assessed by same- or different-sex peers Pragmatic skills buffer the effects of teacher-rated shyness only for children with poor receptive and expressive vocabularies The buffering effect of language ability is shown in a multilingual educational context. © 2017 The British Psychological Society.
Evaluation of Anti-tumor and Chemoresistance-lowering Effects of ...
African Journals Online (AJOL)
Evaluation of Anti-tumor and Chemoresistance-lowering Effects of Pectolinarigenin from Cirsium japonicum Fisch ex DC in Breast Cancer. Mingqian Lu, Xinhua Xu, Hongda Lu, Zhongxin Lu, Bingqing Xu, Chao Tan, Kezhi Shi, Rong Guo, Qingzhi Kong ...
Bayram, Yasemin; Parlak, Mehmet; Çıkman, Aytekin
2013-01-01
Amaç: Çalışmada dört yıllık sürede Giardia intestinalis ve Entemoeba histolytica/ Entemoeba dispar saptanma oranı, yıllar göre dağılımı ile yaş grupları ve cinsiyete göre dağılımının retrospektif olarak belirlenmesi amaçlanmış­tır. Gereç ve yöntem: Ocak 2008 ile Aralık 2011 tarihleri arasında laboratuvarımıza gönderilen 9911 dışkı örneği parazitolojik yönden incelenmiştir. Taze dışkı örneklerinde Entamoeba sp., Giardia trofozoit ve kistlerinin mikrosko­bik teşhisi i...
Medvezhja shkura dostalas kitaiskim kinematografistam / Lauri Kärk
Kärk, Lauri, 1954-
2007-01-01
57. Berliini filmifestivali peaauhinna Kuldkaru sai Hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"). Autor oma eelistusest - Sam Garbarski mängufilmist "Irina Palm". Lisatud tähtsamaid auhindu saanute nimekiri
Berlinale karunahk "Tuya abielu" turvamas / Lauri Kärk
Kärk, Lauri, 1954-
2007-01-01
57. Berliini filmifestivali peaauhinna Kuldkaru sai Hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"). Autor oma eelistusest - Sam Garbarski mängufilmist "Irina Palm". Lisatud tähtsamaid auhindu saanute nimekiri
GPU-based normalized cuts for road extraction using satellite imagery
Indian Academy of Sciences (India)
on the framework NVIDIA CUDA. Apart from the ... quality and to generate the elongated road network for further ... the framework of normalized cuts introduced by. Shi and Malik ..... Youn J and Bethel J S 2004 Adaptive snakes for urban.
Proton radioactivity with analytically solvable potential
Indian Academy of Sciences (India)
The multidimensional evolution of the system is reduced to one- dimensional case by ... Shi and Swiatecki [13] have shown that inclusion of the nuclear ... the Coulomb barrier such that it has a parabolic shape near its top. Guzmann et al.
A versatile and an efficient synthesis of 5-substituted-1H-tetrazoles
Indian Academy of Sciences (India)
tions.1 In general, this nitrogen-rich ring system is used in propellants,2 ... tetrazole-based compounds have also shown good ... reference. GC-MS spectra were obtained on a Shi- madzu GC-MS QP 5050A (equipped with a 30 meter.
English Pronunciation Errors: A Case Study of Amhara and Oromia ...
African Journals Online (AJOL)
unique firstlady
speak better than introverts who are always shy to interact with others. Historical Factor: ... over of education by the natives after the fall of the Imperial regime. After the ..... delusion of native or local technology as some people are campaigning.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences; Volume 130; Issue 2. Polynuclear and one-dimensional cyanide-bridged heterobimetallic complexes: synthesis, crystal structures and magnetic properties. JINGWEN SHI WENLONG LAN YIN ZHOU CHONGCHONG XUE QINGYUN LIU DAOPENG ZHANG. Volume 130 Issue ...
The Shifts in Hizbullah's Ideology : Religious Ideology, Political Ideology, and Political Program
Alagha, Joseph
2006-01-01
De Libanese Shi'itische verzetsbeweging Hizbullah ondergaat een opzienbarende politieke en ideologische transformatie. Ten tijde van de stichting in 1978, door Libanese geestelijken en leiders en met Iranese steun, was Hizbullah vooral een islamitische beweging die zich verzette tegen sociale en
Full Text Available ... Repayment More » Search the NIH Guide Quick Links RePORT eRA Commons NIH Common Fund NIH and the ... if you feel embarrassed or shy. Have an open dialogue with your doctor — ask questions to make ...
124---14 Dec 2009.indd [FINAL VERSION].indd
African Journals Online (AJOL)
2009-12-14
Dec 14, 2009 ... convinced as Danny Postel (2006:15) was three years ago, during the most .... Every forty days, the masses re-appeared to mourn, as Shi'ite. Muslims do, the ...... the modernising of Islamic countries in a European fashion.
TRANSPORT AND DEPOSITION OF NANO-SIZE PARTICLES IN THE UPPER HUMAN RESPIRATORY AIRWAYS
TRANSPORT AND DEPOSITION OF NANO-SIZE PARTICLES IN THE UPPER HUMAN RESPIRATORY AIRWAYS. Zhe Zhang*, Huawei Shi, Clement Kleinstreuer, Department of Mechanical and Aerospace Engineering, North Carolina State University, Raleigh, NC 27695-7910; Chong S. Kim, National Health and En...
Sexual orientation, prejudice and segregation
Plug, E.; Webbink, D.; Martin, N.
2014-01-01
This article examines whether gay and lesbian workers sort into tolerant occupations. With information on sexual orientation, prejudice, and occupational choice taken from Australian Twin Registers, we find that gays and lesbians shy away from prejudiced occupations. We show that our segregation
Erythropoietin protects the retinal pigment epithelial barrier against ...
African Journals Online (AJOL)
O2-induced hyperpermeability. H Zhang, Y Gong, X Wu, Y Shi, L Yin, Y Qiu. Abstract. Erythropoietin (EPO) is not limited to hematopoiesis; it may act as a protective cytokine. In this study, the retinal pigment epithelial (RPE) cell viability, cell ...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences. YIN ZHOU. Articles written in Journal of Chemical Sciences. Volume 130 Issue 2 February 2018 pp 19. Polynuclear and one-dimensional cyanide-bridged heterobimetallic complexes: synthesis, crystal structures and magnetic properties · JINGWEN SHI WENLONG LAN YIN ...
African Journals Online (AJOL)
Items 501 - 550 of 1007 ... A. Ur Rehman, A. Khan, M. Humayun, G. Bibi, K. Shi, F. Raziq ... No 1 (2015), Effect of preparation temperature and ions doping on size, morphology and catalytic activity of Co-B amorphous nano catalyst, Abstract PDF.
Gevonden, M. J.; Myin-Germeys, I.; van den Brink, W.; van Os, J.; Selten, J. P.; Booij, J.
2015-01-01
Minor stresses measured in daily life have repeatedly been associated with increased momentary psychotic experiences, both in individuals with psychotic disorders and in persons who are genetically at an increased risk for these disorders. Severe hearing impairment (SHI) is an environmental risk
A MAPPING BASED ON PHYSICO-CHEMICAL FEATURES: LESSONS LEARNT
The ban on animal testing of cosmetic products for systemic toxicity in Europe is foreseen in 2013. Several research programs involving the public and private sectors have been initiated with the aim of fulfilling regulatory requirements and complying with this transformative shi...
Genetic dissection of seed vigour traits in maize (Zea mays L.) under ...
Indian Academy of Sciences (India)
subjected to cold stress and frequently exhibit poor early- season vigour that ... Yong Shi, Guohui Li and Zhiqiang Tian contributed equally to this work. Yu82 × Shen137 is .... Other vigour-related traits within the three parental lines exhibited no ...
Sunni and Shi’a Terrorism: Differences that Matter
2008-12-29
Upon the United States (Washington, DC: St. Martin’s Press, 2004), 88‐89. The report’s language was curiously qualified when discussing the Iranian...such a tactic cannot be ruled out in the future. 84 Poland, the Czech Republic, the Slovak Republic...Democratic Front for the Liberation of Palestine (DFLP)* Hamas* Iranian Extremists/Militants – Kuwait ( label applied by Sunni Kuwait government
Regional Implications of Shi’a Revival in Iraq
2004-01-01
From the marshes of southern Iraq to the ghettoes of Karachi, the Shi‘a have been the underdogs —oppressed and marginalized by Sunni ruling regimes and...former with “true” Is- lam—and their governments as its defenders—and branding the latter as obscurantist extremism. They dismissed Khomeini as Shi‘a... branding his vitriol against the House of Saud in the 1980s as fitna (illegitimate rebellion and sowing of disunity) against the Muslim community.7
Multiple System Atrophy with Orthostatic Hypotension (Shy-Drager Syndrome)
... the onset of symptoms. A problem with the respiratory system is the most common cause of death. x ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. View ...
Brief report: Perceptions of social withdrawal during emerging adulthood in Lagos, Nigeria.
Bowker, Julie C; Ojo, Adesola Adebusola; Bowker, Matthew H
2016-02-01
The study of social withdrawal subtypes is no longer limited to Western societies but has extended to non-Western countries, such as China. This study considers, for the first time, social withdrawal subtypes in an African country (Nigeria) by examining emerging adults' (N = 151; 54% female; Mage = 19.92 years, SD = 2.54) perceptions, attitudes, and responses to shy, unsociable, and socially competent behaviors. Results revealed that Nigerian emerging adults perceived significant differences between shy, unsociable, and socially competent behavior in several ways incommensurate with participants of previous studies conducted in North America, Europe, and China. Findings highlight the diversity of social meanings attached to social withdrawal in non-Western societies, and point to the need for additional research on social withdrawal and its perception in Africa. Copyright © 2015 The Foundation for Professionals in Services for Adolescents. Published by Elsevier Ltd. All rights reserved.
Measurement of associated charm production induced by 400 GeV/c protons
Akmete, A; Anokhina, A; Aoki, S; Atkin, E; Azorskiy, N; Back, JJ; Bagulya, A; Baranov, A; Barker, GJ; Battistin, M; Bauche, J; Bay, A; Bayliss, V; Bencivenni, G; Berdnikov, AY; Berdnikov, YA; Bertani, M; Betancourt, C; Bezshyiko, I; Bezshyyko, O; Bick, D; Bieschke, S; Blanco, A; Boehm, J; Bogomilov, M; Bondarenko, K; Bonivento, WM; Borburgh, J; Boyarsky, A; Brenner, R; Breton, D; Brundler, R; Bruschi, M; B\\"{u}scher, V; Buonaura, A; Buonocore, L; Buontempo, S; Cadeddu, S; Calcaterra, A; Calviani, M; Campanelli, M; Chau, P; Chauveau, J; Chepurnov, A; Chernyavskiy, M; Choi, K-Y; Chumakov, A; Ciambrone, P; Cornelis, K; Cristinziani, M; Dallavalle, GM; Datwyler, A; D'Ambrosio, N; D'Appollonio, G; De Carvalho Saraiva, J; De Lellis, G; De Roeck, A; De Serio, M; Dedenko, L; Dergachev, P; Di Crescenzo, A; Di Marco, N; Dib, C; Dijkstra, H; Dmitrenko, V; Dmitrievskiy, S; Domenici, D; Donskov, S; Dubreuil, A; Ebert, J; Ehlert, M; Enik, T; Etenko, A; Fabbri, F; Fabbri, L; Fabich, A; Fedin, O; Fedorova, G; Felici, G; Ferro-Luzzi, M; Fini, RA; Fonte, P; Franco, C; Fraser, M; Froeschl, R; Fukuda, T; Galati, G; Gavrilov, G; Gerlach, S; Goddard, B; Golinka-Bezshyyko, L; Golovatiuk, A; Golubkov, D; Golutvin, A; Gorbunov, D; Gorbunov, P; Gorbunov, S; Gorkavenko, V; Gornushkin, Y; Gorshenkov, M; Grachev, V; Graverini, E; Grenard, J-L; Grichine, V; Gruzinskii, N; Guler, A~M; Guz, Yu; Hagner, C; Hakobyan, H; van Herwijnen, E; Hollnagel, A; Hosseini, B; Hushchyn, M; Iaselli, G; Iuliano, A; Jacobsson, R; Jokovi\\'{c}, D; Jonker, M; Kadenko, I; Kamiscioglu, C; Kamiscioglu, M; Karaman, M; Khabibullin, M; Khaustov, G; Khotyantsev, A; Kim, SH; Kim, V; Kim, YG; Kitagawa, N; Ko, J-W; Kodama, K; Kolesnikov, A; Kolev, DI; Kolosov, V; Komatsu, M; Kono, A; Konovalova, N; Korkmaz, MA; Korol, I; Korol'ko, I; Korzenev, A; Kostyukhin, V; Kovalenko, S; Krasilnikova, I; Krivova, K; Kudenko, Y; Kurbatov, P; Kurochka, V; Kuznetsova, E; Lacker, HM; Lai, A; Lanfranchi, G; Lantwin, O; Lauria, A; Lebbolo, H; Lee, KS; Lee, KY; L\\'{e}vy, J-M; Likhacheva, V; Lopes, L; Lyubovitsky, V; Maalmi, J; Magnan, A; Maleev, V; Malinin, A; Manabe, Y; Manfredi, M; Mefodev, A; Mermod, P; Mikado, S; Mikhaylov, Yu; Milstead, DA; Mineev, O; Montanari, A; Montesi, MC; Morishima, K; Movchan, S; Naganawa, N; Nakamura, M; Nakano, T; Nishio, A; Novikov, A; Obinyakov, B; Ogawa, S; Okateva, N; Osborne, J; Ovchynnikov, M; Owtscharenko, N; Owen, PH; Pacholek, P; Paoloni, A; Park, BD; Park, SK; Paparella, R; Pastore, A; Patel, M; Pereyma, D; Perillo-Marcone, A; Petrenko, D; Petridis, K; Podgrudkov, D; Poliakov, V; Polukhina, N; Prokudin, M; Prota, A; Rademakers, A; Rakai, A; Ratnikov, F; Rawlings, T; Razeti, M; Redi, F; Ricciardi, S; Rinaldesi, M; Rodin, Volodymyr; Rodin, Viktor; Roganova, T; Rogozhnikov, A; Rokujo, H; Rosa, G; Rovelli, T; Ruchayskiy, O; Ruf, T; Samoylenko, V; Ull, A~Sanz; Saputi, A; Sato, O; Savchenko, ES; Schliwinski, J; Schmidt-Parzefall, W; Serra, N; Sgobba, S; Shadura, O; Shakin, A; Shaposhnikov, M; Shatalov, P; Shchedrina, T; Shchutska, L; Shevchenko, V; Shibuya, H; Shustov, A; Silverstein, SB; Simone, S; Simoniello, R; Skorokhvatov, M; Smirnov, S; Sohn, JY; Sokolenko, A; Solodko, E; Solovev, V; Starkov, N; Storaci, B; Strolin, P; Sukhonos, D; Suzuki, Y; Takahashi, S; Timiryasov, I; Tioukov, V; Tommasini, D; Torii, M; Tosi, N; Tramontano, F; Treille, D; Tsenov, R; Ulin, S; Ustyuzhanin, A; Uteshev, Z; Vankova-Kirilova, G; Vannucci, F; Venkova, P; Venturi, V; Vilchinski, S; Villa, M; Vincke, Heinz; Vincke, Helmuth; Vlasik, K; Volkov, A; Voronkov, R; Wanke, R; Woo, J-K; Wurm, M; Xella, S; Yilmaz, D; Yilmazer, AU; Yoon, CS; Zaytsev, Yu
2017-01-01
An important input for the interpretation of the measurements of the SHiP ex- periment is a good knowledge of the differential charm production cross section, including cascade production. This is a proposal to measure the associated charm production cross section, employing the SPS 400 GeV/c proton beam and a replica of the first two interaction lengths of the SHiP target. The detection of the produc- tion and decay of charmed hadron in the target will be performed through nuclear emulsion films, employed in an Emulsion Cloud Chamber target structure. In order to measure charge and momentum of decay daughters, we intend to build a mag- netic spectrometer using silicon pixel, scintillating fibre and drift tube detectors. A muon tagger will be built using RPCs. An optimization run is scheduled in 2018, while the full measurement will be performed after the second LHC Long Shutdown.
International Nuclear Information System (INIS)
Lagarde, M; Del Grosso, M; Fasce, D; Dommarco, R; Laino, S; Fasce, L.A
2012-01-01
The ultra high molecular weight polyethylene (UHMWPE) is a biomaterial widely used in total joint replacement. In this work, the effect of two different irradiation techniques on UHMWPE is analyzed. One technique involves gamma irradiation (γ) followed by a thermal treatment, thus modifying the material bulk. The other implies swift heavy ion irradiation (SHI), which have an effect only on the near surface layers. The surface nanomechanical properties are evaluated from depth sensing indentation experiments, while changes in crystallinity and chemical structure are determined by DSC and Raman spectroscopy. The results show that even when both techniques are able to improve the UHMWPE wear behavior, the effect on other mechanical properties and molecular structure modification is different. The γ irradiated sample exhibits lower crystallinity, hardness and modulus than the pristine UHMWPE, while the SHI irradiated sample exhibits higher crystallinity and enhanced mechanical properties than the later
Tononi, Giulio; Cirelli, Chiara
2014-01-08
Sleep is universal, tightly regulated, and its loss impairs cognition. But why does the brain need to disconnect from the environment for hours every day? The synaptic homeostasis hypothesis (SHY) proposes that sleep is the price the brain pays for plasticity. During a waking episode, learning statistical regularities about the current environment requires strengthening connections throughout the brain. This increases cellular needs for energy and supplies, decreases signal-to-noise ratios, and saturates learning. During sleep, spontaneous activity renormalizes net synaptic strength and restores cellular homeostasis. Activity-dependent down-selection of synapses can also explain the benefits of sleep on memory acquisition, consolidation, and integration. This happens through the offline, comprehensive sampling of statistical regularities incorporated in neuronal circuits over a lifetime. This Perspective considers the rationale and evidence for SHY and points to open issues related to sleep and plasticity. Copyright © 2014 Elsevier Inc. All rights reserved.
Cost-effectiveness of tiotropium versus salmeterol: the POET-COPD trial.
Hoogendoorn, Martine; Al, Maiwenn J; Beeh, Kai-Michael; Bowles, David; Graf von der Schulenburg, J Matthias; Lungershausen, Juliane; Monz, Brigitta U; Schmidt, Hendrik; Vogelmeier, Claus; Rutten-van Mölken, Maureen P M H
2013-03-01
The aim of this study was to perform a 1-yr trial-based cost-effectiveness analysis (CEA) of tiotropium versus salmeterol followed by a 5-yr model-based CEA. The within-trial CEA, including 7,250 patients with moderate to very severe chronic obstructive pulmonary disease (COPD), was performed alongside the 1-yr international randomised controlled Prevention of Exacerbations with Tiotropium (POET)-COPD trial comparing tiotropium with salmeterol regarding the effect on exacerbations. Main end-points of the trial-based analysis were costs, number of exacerbations and exacerbation days. The model-based analysis was conducted to extrapolate results to 5 yrs and to calculate quality-adjusted life years (QALYs). 1-yr costs per patient from the German statutory health insurance (SHI) perspective and the societal perspective were €126 (95% uncertainty interval (UI) €55-195) and €170 (95% UI €77-260) higher for tiotropium, respectively. The annual number of exacerbations was 0.064 (95% UI 0.010-0.118) lower for tiotropium, leading to a reduction in exacerbation-related costs of €87 (95% UI €19-157). The incremental cost-effectiveness ratio was €1,961 per exacerbation avoided from the SHI perspective and €2,647 from the societal perspective. In the model-based analyses, the 5-yr costs per QALY were €3,488 from the SHI perspective and €8,141 from the societal perspective. Tiotropium reduced exacerbations and exacerbation-related costs, but increased total costs. Tiotropium can be considered cost-effective as the resulting cost-effectiveness ratios were below commonly accepted willingness-to-pay thresholds.
Protracted storage of CR chondrules in a region of the disk transparent to galactic cosmic rays
Roth, Antoine S. G.; Metzler, Knut; Baumgartner, Lukas P.; Hofmann, Beda A.; Leya, Ingo
2017-10-01
Renazzo-type carbonaceous (CR) chondrites are accretionary breccias that formed last. As such they are ideal samples to study precompaction exposures to cosmic rays. Here, we present noble gas data for 24 chondrules and 3 dark inclusion samples (DIs) from Shişr 033 (CR2). The meteorite was selected based on the absence of implanted solar wind noble gases and an anomalous oxygen isotopic composition of the DIs; the oxygen isotopes match those in CV3 and CO3 chondrites. Our samples contain variable mixtures of galactic cosmic ray (GCR)-produced cosmogenic noble gases and trapped noble gases of presolar origin. Remarkably, all chondrules have cosmogenic 3He and 21Ne concentrations up to 4.3 and 7.1 times higher than the DIs, respectively. We derived an average 3He-21Ne cosmic ray exposure (CRE) age for Shişr 033 of 2.03 ± 0.20 Ma (2 SD) and excesses in cosmogenic 3He and 21Ne in chondrules (relative to the DIs) in the range (in 10-8 cm3STP/g) 3.99-7.76 and 0.94-1.71, respectively. Assuming present-day GCR flux density, the excesses translate into average precompaction 3He-21Ne CRE ages of 3.1-27.3 Ma depending on the exposure geometry. The data can be interpreted assuming a protracted storage of a single chondrule generation prior to the final assembly of the Shişr 033 parent body in a region of the disk transparent to GCRs.
Yoshida, Hiroshi; Yamada, Hajime; Nogami, Wataru; Dohi, Keiji; Kurino-Yamada, Tomomi; Sugiyama, Koji; Takahashi, Koji; Gahara, Yoshinari; Kitaura, Motoji; Hasegawa, Minoru; Oshima, Itsuki; Kuwabara, Kenji
2018-03-01
Lusutrombopag (S-888711), an oral small-molecule thrombopoietin receptor (TPOR) agonist, has gained first approval as a drug to treat thrombocytopenia of chronic liver disease in patients undergoing elective invasive procedures in Japan. Preclinical studies were performed to evaluate its efficacy against megakaryopoiesis and thrombopoiesis. To investigate the proliferative activity and efficacy of megakaryocytic colony formation via human TPOR, lusutrombopag was applied to cultured human c-Mpl-expressing Ba/F3 (Ba/F3-hMpl) cells and human bone marrow-derived CD34-positive cells, respectively. Lusutrombopag caused a robust increase in Ba/F3-hMpl cells by activating pathways in a manner similar to that of thrombopoietin and induced colony-forming units-megakaryocyte and polyploid megakaryocytes in human CD34-positive cells. Because lusutrombopag has high species specificity for human TPOR, there was no suitable experimental animal model for drug evaluation, except for immunodeficient mouse-based xenograft models. Therefore, a novel genetically modified knock-in mouse, TPOR-Ki/Shi, was developed by replacing mouse Mpl with human-mouse chimera Mpl. In TPOR-Ki/Shi mice, lusutrombopag significantly increased circulating platelets in a dose-dependent manner during 21-day repeated oral administration. Histopathological study of the TPOR-Ki/Shi mice on day 22 also revealed a significant increase in megakaryocytes in the bone marrow. These results indicate that lusutrombopag acts on human TPOR to upregulate differentiation and proliferation of megakaryocytic cells, leading to platelet production. Copyright © 2018 ISEH – Society for Hematology and Stem Cells. Published by Elsevier Inc. All rights reserved.
Efficient strategy to Cu/Si catalyst into vertically aligned carbon ...
Indian Academy of Sciences (India)
Abstract. Bamboo-shaped vertically aligned carbon nanotubes (bs-VACNTs) were fabricated on Cu/Si catalyst by ... on Si wafer material when compared to the other commer- ..... [3] Li H, Zhao N, He C, Shi C, Du X, Li J and Cui Q 2008 Mater.
Casein kinase 1-Like 3 is required for abscisic acid regulation of ...
African Journals Online (AJOL)
Casein kinase 1-Like 3 is required for abscisic acid regulation of seed germination, root growth, and gene expression in Arabidopsis. M Wang, D Yu, X Guo, X Li, J Zhang, L Zhao, H Chang, S Hu, C Zhang, J Shi, X Liu ...
Cross sectional study of low back pain among merchant seafarers at a medical centre in Singapore
DEFF Research Database (Denmark)
Nair, Ravindran; Jensen, Olaf Chresten; Gómez Muñiz, Fernando
2011-01-01
Background: Low back pain [LBP] either acute or chronic is the most common musculoskeletal complaint seen in a clinic. Majority of them are involved with manual handling of heavy objects. Objectives: To explore prevalence characteristics of low back pain syndrome among seafarers from merchant shi...
General practitioners and national health insurance results of a ...
African Journals Online (AJOL)
Objective. To determine the attitudes of South African general practitioners (GPs) to national health insurance (NHI), social health insurance (SHI) and other related health system reforms. Design. A national survey using postal questionnaires and telephonic follow-up of non-responders. Setting. GPs throughout South Africa.
Halpin, Glennelle; And Others
1982-01-01
In a study of teacher trainees' personality characteristics related to pupil control, humanistically oriented educators tended to be emotionally stable, expedient, positive, imaginative, venturesome, relaxed and had high self-concepts. Authoritarian educators were more affected by feelings, conscientious, sober, practical, shy, reserved, tense and…
Interfacing the NRL 1-D High Vertical Resolution Aerosol Model with COAMPS
2006-09-30
model integrated with mesoscale meterological data to study marine boundary layer aerosol dynamics, J. Geophys. Res., in press, 2006. Hoppel, W. A...W.A. Hoppel, J.J. Shi: A one-dimensional sectional aerosol model integrated with mesoscale meterological data to study marine boundary layer aerosol
Lifescience Database Archive (English)
Full Text Available on: Department of Biosciences, Faculty of Science and Engineering, Teikyo Univers...ity Contact address 1-1, Toyosatodai, Utsunomiya-shi, Tochigi 320-8551 Japan Department of Biosciences, Faculty of Science and Engine...ering, Teikyo University Tomoko Shinomura E-mail : Database classification Plant da
The Effectiveness of the Behavioural Training for Preschool Children
Koglin, Ute; Petermann, Franz
2011-01-01
This study investigated the short-term effects of behavioural training for preschool children. The goals of this programme were to reduce disruptive behaviour as well as shy and withdrawn behaviour, and to promote social-emotional competencies. In young children, insufficient emotional competencies and difficulties concerning adequate conflict…
A NOVEL S-ADENOSYL-L-METHIONINE: ARSENIC (III) METHYLTRANSFERASE FROM RAT LIVER CYTOSOL
A Novel S-Adenosyl-L-methionine: Arsenic(III) Methyltransferase from Rat Liver CytosolShan Lin, Qing Shi, F. Brent Nix, Miroslav Styblo, Melinda A. Beck, Karen M. Herbin-Davis, Larry L. Hall, Josef B. Simeonsson, and David J. Thomas S-adenosyl-L-methionine (AdoMet): ar...
Beatson, Ruth M.; Bayer, Jordana K.; Perry, Alexandra; Mathers, Megan; Hiscock, Harriet; Wake, Melissa; Beesley, Kate; Rapee, Ronald M.
2014-01-01
Temperamental inhibition has been identified as a key risk factor for childhood anxiety and internalizing problems. An efficacious early prevention programme for shy/inhibited children has been developed; however, accurate, efficient and acceptable screening is needed to support wider implementation. We explore community screening options in the…
African Journal of Biotechnology - Vol 10, No 7 (2011)
African Journals Online (AJOL)
Effects of deoxycycline induced lentivirus encoding FasL gene on apoptosis of Th1 cells · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H Luo, T Wang, A Luo, J Wang, Y Zhao, H Jiang, Q Shi, 1081-1087 ...
2010-12-01
Similar nanostructures have been used to improve electrostatic capacitors. For example, metal- insulator - metal capacitor arrays fabricated in anodic...Materials, vol. 25, pp. 285-290 (2010). [11] X. Li, C. Han, X. Chen, C. Shi, Microporous and Mesoporous Materials, vol. 131, pp. 303- 309 (2010). [12] D
Dual-Targeting of AR and Akt Pathways by Berberine in Castration-Resistant Prostate Cancer
2014-08-01
underlying the downregulation of full-length and splice variants of AR by the phytochemical berberine (BBR). We concluded that BBR inhibits the...46-54. [34] Narizhneva NV, Tararova ND, Ryabokon P, Shy- shynova I, Prokvolit A, Komarov PG, Purmal AA, Gudkov AV, Gurova KV. Small molecule screen
Using Oblivious RAM in Genomic Studies
Karvelas, Nikolaos P.; Peter, Andreas; Katzenbeisser, Stefan; Garcia-Alfaro, Joaquin; Navarro-Aribas, Guillermo; Hartenstein, Hannes; Herrera-Joancomarti, Jordi
2017-01-01
Since the development of tree-based Oblivious RAMs by Shi et al. it has become apparent that privacy preserving outsourced storage can be practical. Although most current constructions follow a client-server model, in many applications, such as Genome Wide Association Studies (GWAS), it is desirable
The Clerical Establishment in Iran
1989-06-01
Political Action and Legitimate Domi- nation in Shi’ite Iran: Fourteenth to Eighteenth Centuries, A.D.," Archives Europ~ennes de Sociologie , Vol. 20, No...139 Archives Europ6ennes de Sociologie Bours, (moderate centrist) weekly in Persian, Tehran Conflict Studies, quarterly in English, London Enghelab
African Journals Online (AJOL)
Nelson Edewor
social media technology in marketing their information products and services to ... Going into the history of the early Internet „Web 1.0 were used but it was a ... is one of the alternative means for shy students to be able to voice their thoughts in.
An Alternative to "Preaching to the Choir"
DEFF Research Database (Denmark)
Reisch, Lucia; Bietz, Sabine; Kreeb, Martin
2007-01-01
the effectiveness of a TV program that tries to communicate options in sustainable consumption and production in an entertaining, emotionally positive, and fascinating way (“sustainment”). The preliminary results show that viewer-consumers do not shy away from such a difficult topic if the communication style fits...
SYNTHESIS AND CHARACTERISATION OF Ni0.25Co0.75Fe2O4 ...
African Journals Online (AJOL)
characterised for their size and structure using X-ray diffraction (XRD), high .... the sample shows broad peaks, indicating the fine crystalline nature of the particles. ... Zhao, L.J.; Zhang, H.J.; Xing,Y.; Song, S.Y.; Yu, S.Y.; Shi, W.D.; Guo, X.M.; ...
Bail-in and Market Stabilization
DEFF Research Database (Denmark)
Ringe, Georg
2016-01-01
of the concept, in particular relating to the fear that regulators may shy away from taking bail-in action in the decisive moment of rescue operations. Regulatory frameworks are ambivalent about the precise trigger requirements and substantial conditions for applying it. At the bottom of this vagueness...
2014-12-22
Shona McLaughlin2, Jason S. H. Lo1, Chao Shi1, Jared Lenos3, and Andrew Vincelli4 1CanmetMATERIALS, Natural Resources Canada, 183 Longwood Road...Steel”, REVISTA DE METALURGIA, 2011, 47, 426-444. Figures Fig. 1 EMI shielding effectiveness calculated via Equation (1) vs
HoeklteSlt.-ekings / Hook Ilevie"Ts
African Journals Online (AJOL)
Manchester, the gifted storyteller, presents. MacArthur in all his many faceted glory, complexity and contradiction. MacArthur, as. Manchester so ably puts it, ' ... was a great thundering paradox of a man, noble and ignoble, inspiring and outrageous, arrogant and shy, the. CONTEMPORARY POLITICAL IDEOLO-. GIES BY ...
Kinetic Ising model in a time-dependent oscillating external magnetic field: effective-field theory
International Nuclear Information System (INIS)
Deviren, Bayram; Canko, Osman; Keskin, Mustafa
2010-01-01
Recently, Shi et al. [2008 Phys. Lett. A 372 5922] have studied the dynamical response of the kinetic Ising model in the presence of a sinusoidal oscillating field and presented the dynamic phase diagrams by using an effective-field theory (EFT) and a mean-field theory (MFT). The MFT results are in conflict with those of the earlier work of Tomé and de Oliveira, [1990 Phys. Rev. A 41 4251]. We calculate the dynamic phase diagrams and find that our results are similar to those of the earlier work of Tomé and de Oliveira; hence the dynamic phase diagrams calculated by Shi et al. are incomplete within both theories, except the low values of frequencies for the MFT calculation. We also investigate the influence of external field frequency (ω) and static external field amplitude (h 0 ) for both MFT and EFT calculations. We find that the behaviour of the system strongly depends on the values of ω and h 0 . (general)
Domahidi, Emese; Quandt, Thorsten
2014-01-01
Abstract Some researchers believe that online gaming spaces can be socially accommodating environments for socially inhibited individuals, such as the socially inept, socially anxious, or shy. While previous research has examined, and found, significant links between these populations and online video game play, it remains unknown to what extent these spaces are contributing to tangible social benefits for the socially inhibited. The current study addresses this question by evaluating the link between gaming-related friendships and shyness, as quantified by emotional sensitivity. Drawing from a representative sample of German game players, the results indicate that emotionally sensitive players are using online gaming spaces differently from their less emotionally sensitive counterparts and reporting tangible differences in their in-game friendship networks. This suggests that online games hold the potential to be socially advantageous for shy individuals by allowing them to overcome their traditional social difficulties and generate new friendships as well as strengthen old ones. PMID:24660878
Directory of Open Access Journals (Sweden)
Anna Dashchenko
2016-10-01
Full Text Available The article presents the first Russian translation of "Essay on Ci" with detailed comments. It was written by the outstanding Chinese poetess Li Qingzhao and considered to be the first theoretical treatise dedicated to genre ci. The article revealed that the poetess used three strategies to make a genre demarcation: to legitimise, dichotomise and historicise. To legitimise means to justify that ci is a genre of poetry by identifying the same traits with official poetry shi (e.g. using the classical quotations and allusions. To dichotomise is to determine a core element of genre and oppose it to the other element identifying the similar genre (e.g. music separates ci from shi. To historicise is to develop or discover the unique historical past (e.g. the source of ci is in antiquity. The article also examined the strategy to invent classics: Li Qingzhao wrote the apophatic history of genre ci pointing not to the merits but weaknesses of her predecessors.
Kowert, Rachel; Domahidi, Emese; Quandt, Thorsten
2014-07-01
Some researchers believe that online gaming spaces can be socially accommodating environments for socially inhibited individuals, such as the socially inept, socially anxious, or shy. While previous research has examined, and found, significant links between these populations and online video game play, it remains unknown to what extent these spaces are contributing to tangible social benefits for the socially inhibited. The current study addresses this question by evaluating the link between gaming-related friendships and shyness, as quantified by emotional sensitivity. Drawing from a representative sample of German game players, the results indicate that emotionally sensitive players are using online gaming spaces differently from their less emotionally sensitive counterparts and reporting tangible differences in their in-game friendship networks. This suggests that online games hold the potential to be socially advantageous for shy individuals by allowing them to overcome their traditional social difficulties and generate new friendships as well as strengthen old ones.
Choudhary, Ritika; Chauhan, Rishi Pal
2017-07-01
The modification in various properties of thin films using high energetic ion beam is an exciting area of basic and applied research in semiconductors. In the present investigations, cadmium selenide (CdSe) thin films were deposited on ITO substrate using electrodeposition technique. To study the swift heavy ion (SHI) induced effects, the deposited thin films were irradiated with 120 MeV heavy Ag9+ ions using pelletron accelerator facility at IUAC, New Delhi, India. Structural phase transformation in CdSe thin film from metastable cubic phase to stable hexagonal phase was observed after irradiation leading to decrease in the band gap from 2.47 eV to 2.12 eV. The phase transformation was analyzed through X-ray diffraction patterns. During SHI irradiation, Generation of high temperature and pressure by thermal spike along the trajectory of incident ions in the thin films might be responsible for modification in the properties of thin films.[Figure not available: see fulltext.
On the self-serving function of social anxiety: shyness as a self-handicapping strategy.
Snyder, C R; Smith, T W; Augelli, R W; Ingram, R E
1985-04-01
We tested the hypothesis that socially anxious or shy individuals use their anxiety symptoms as a strategy to control attributions made about their performances in social-evaluative settings (i.e., self-handicapping strategies). Specifically, we predicted that trait-socially anxious or shy persons would report more symptoms of social anxiety in an evaluative setting in which anxiety or shyness could serve as an excuse for poor performance than would individuals in (a) an evaluative setting in which shyness was precluded as an excuse or (b) a nonevaluative setting. Furthermore, we predicted that this self-protective pattern of symptom reporting would not occur for individuals who were not trait-socially anxious because these persons would not commonly use such symptoms as a self-handicapping strategy. Results supported these predictions for male subjects, but not for female subjects. Sex differences in the strategic use of shyness are discussed in relation to other research on sex differences in the etiology and correlates of social anxiety.
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. Yi Tan. Articles written in Bulletin of Materials Science. Volume 38 Issue 5 September 2015 pp 1429-1433. Evaluation on electrical resistivity of silicon materials after electron beam melting · Hafiz Muhammad Noor Ul Huda Khan Asghar Shuang Shi Dachuan Jiang Yi Tan.
Is Military Science Scientific?
2014-01-01
the Battlefields of Modernity (New York: Columbia University Press, 2009). 4 John Shy, “Jomini,” in Makers of Modern Strategy: From Machiavelli to...War, ed. and trans. Michael Howard and Peter Paret ( Princ - eton: Princeton University Press, 1984), 117. 21 Hayek, “Pretense of Knowledge.” 22 Van
2012-11-01
www.osmfoundation.org/wiki/Data_Working_Group. 126 Devillers, Rodolphe, Alfred Stein, Yvan Bédard, Nicholas Chrisman, Peter Fisher, and Wenzhong Shi...Francis, Peter J. Blancher, Susan R. Drennan, Mar- shall A. Howe, Denis Lepage, Chandler . S. Robbins, Kenneth V. Rosen- berg, John R. Sauer, and
Alleviating effect of exogenous nitric oxide in cucumber seedling ...
African Journals Online (AJOL)
Administrator
2011-05-23
May 23, 2011 ... oxidation (Shi et al., 2007). To protect cells and organelles from the damaging effects of ROS, complex antioxidant defense system have been evolved which comprises of enzymes such as superoxide dismutase (SOD), catalase. (CAT), peroxidase (POD) and glutathione reeducate (GR). (Lee et al., 2000; ...
Proceedings of the 13th symposium on advanced photon research
International Nuclear Information System (INIS)
2013-09-01
The 13th Symposium on Advanced Photon Research was held at Kansai Photon Science Institute, Japan Atomic Energy Agency (JAEA-KPSI) in Kizugawa-shi, Kyoto on November 15 - 16, 2012. This report consists of invited and contributed papers presented at the oral and poster sessions in the Symposium. (author)
The Effect of Age on the Use of Health and Self-Care Information: Confronting the Stereotype
Wagner, Lisa Smith; Wagner, Todd H.
2003-01-01
Purpose: Given stereotypes of older adults, there is the perception that older adults will not use health information technologies. One concern is that practitioners might shy away from providing older patients with health information, and in particular, computerized information. The study's primary objective was to evaluate whether a health…
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. Naiqin Zhao. Articles written in Bulletin of Materials Science. Volume 34 Issue 1 February 2011 pp 75-79. Microwave absorbing properties of activated carbon fibre polymer composites · Tianchun Zou Naiqin Zhao Chunsheng Shi Jiajun Li · More Details Abstract Fulltext PDF.
Relevance of the Rationalist-Intuitionist Debate for Ethics and Professionalism in Medical Education
Leffel, G. Michael; Mueller, Ross A. Oakes; Curlin, Farr A.; Yoon, John D.
2015-01-01
Despite widespread pedagogical efforts to modify discrete behaviors in developing physicians, the professionalism movement has generally shied away from essential questions such as what virtues characterize the good physician, and how are those virtues formed? Although there is widespread adoption of medical ethics curricula, there is still no…
Give Me a Hand... As We Dance With the Dragon: Fine Tuning the Asia-Pacific Hands Concept
2015-06-01
John Shy wrote, “human beings do not kill and risk death for no reason. Beneath the raw irrationality of violence lies motive—some psychic ...half. The other half is employed in the industry and services sectors; of the active labor force, only about seven percent remains unemployed .38
Efficacy of chlorhexidine gluconate ointment (Oronine H® for experimentally-induced comedones
Directory of Open Access Journals (Sweden)
Yamakoshi T
2012-07-01
Full Text Available Takako Yamakoshi,1 Teruhiko Makino,1 Kenji Matsunaga,1 Yoko Yoshihisa,1 Mati Ur Rehman,1 Taisuke Seki,2 Yoshito Hayashi,3 Tadamichi Shimizu11Department of Dermatology, Graduate School of Medicine and Pharmaceutical Sciences, University of Toyama, Toyama-shi, Toyama; 2Seki Dermatological Clinic, Toyama-shi, Toyama; 3Otsuka Pharmaceutical Factory Inc, Naruto-shi, Tokushima, JapanBackground: Oronine H® ointment, which contains chlorhexidine gluconate as its active component, is a well known disinfectant, and has been widely used for treatment of acne in Japan. In this study, we investigated the inhibitory effect of this ointment on the formation of comedones induced by application of 50% oleic acid on the orifices of the external auditory canals of rabbits.Methods: The application sites were observed with a dermatoscope, and the area of the hair pores was measured using an Image analysis software program.Results: The chlorhexidine gluconate ointment inhibited comedone formation significantly more effectively than the liquid paraffin used as a control (P < 0.001. We also investigated the therapeutic effect of this ointment on comedones. After starting application of chlorhexidine gluconate ointment or liquid paraffin on the comedone area, the hair pore size was gradually decreased in the group treated with chlorhexidine gluconate ointment compared with the hair pore size at baseline.Conclusion: These results suggest that chlorhexidine gluconate ointment is effective for inhibiting comedone formation as well as for treating already formed comedones. Chlorhexidine gluconate ointment is a useful topical medicine for the treatment of early-stage acne and for preventing acne.Keywords: chlorhexidine gluconate ointment, comedones, dermatoscope, oleic acid
Préaud, Emmanuelle; Uhart, Mathieu; Böhm, Katharina; Aidelsburger, Pamela; Anger, Delphine; Bianic, Florence; Largeron, Nathalie
2015-01-01
Herpes zoster (HZ; shingles) is a common viral disease that affects the nerves and surrounding skin causing a painful dermatomal rash and leading to debilitating complications such as, mainly, post-herpetic neuralgia (PHN). Currently, there is no effective treatment for HZ and PHN. The objective of this study was to assess the cost-effectiveness of a HZ vaccination program in Germany. An existing Markov Model was adapted to the German healthcare setting to compare a vaccination policy to no vaccination on a lifetime time-horizon, considering 2 scenarios: vaccinating people starting at the age of 50 or at the age of 60 years, from the perspective of the statutory health insurance (SHI) and the societal perspective. According to the perspective, vaccinating 20% of the 60+ German population resulted in 162,713 to 186,732 HZ and 31,657 to 35,793 PHN cases avoided. Corresponding incremental cost-effectiveness ratios (ICER) were 39,306 €/QALY from the SHI perspective and 37,417 €/QALY from a societal perspective. Results for the 50+ German population ranged from 336,468 to 394,575 HZ and from 48,637 to 56,087 PHN cases avoided from the societal perspective. Corresponding ICER were 39,782 €/QALY from a SHI perspective and 32,848 €/QALY from a societal perspective. Sensitivity analyses showed that results are mainly impacted by discount rates, utility values and use of alternative epidemiological data.The model indicated that a HZ vaccination policy in Germany leads to significant public health benefits and could be a cost-effective intervention. The results were robust and consistent with local and international existing literature.
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-03-01
For promoting the introduction of new energy and for enhancing people's consciousness of such at Murakami City, Niigata Prefecture, surveys and studies were conducted involving energy consumption in the town, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The annual energy consumption of the city is estimated at 78,000 kL in terms of oil. The residential/commercial sector consumes 24,000 kL, the industrial sector 28,000 kL, and the transportation sector 26,000 kL, with the three sectors demanding similar amounts. The carbon dioxide emitted by the sectors is estimated at 223,000 t-CO2/year. New energy introduction projects were discussed, which included hot water supply, heating, road heating, and power generation, all these utilizing heat from the Senami hot spa; biogas fueled power generation and BDF (bio-diesel) bus operation in the Senami hot spa district; the introduction of a hybrid wind power/photovoltaic power generation system into Ogata Seaside Park; the introduction of a mini-scale hydroelectric power generation system into the Kamikaifu district; a large-scale wind power generation business at the Iwafune district; the introduction of wind power and photovoltaic power generation facilities into primary and junior high schools; the use of clean energy vehicles for official use; and so forth. (NEDO)
Coplan, Robert J.; Rose-Krasnor, Linda; Weeks, Murray; Kingsbury, Adam; Kingsbury, Mila; Bullock, Amanda
2013-01-01
The primary goals of this study were to test a conceptual model linking social approach and avoidance motivations, socially withdrawn behaviors, and peer difficulties in later childhood and to compare the socioemotional functioning of different subtypes of withdrawn children (shy, unsociable, avoidant). Participants were 367 children, aged 9-12…
Implementation of CDC's School Health Index in 3 Midwest Middle Schools: Motivation for Change
Sherwood-Puzzello, Catherine M.; Miller, Michelle; Lohrmann, David; Gregory, Patricia
2007-01-01
Background: The Centers for Disease Control and Prevention's School Health Index (SHI), a guide for completing a coordinated school-based program needs assessment relative to healthy eating, physical activity, a tobacco-free lifestyle, and prevention of other health risk behaviors and conditions, was used to assess current programming at 3…
Cognitive Biases and the Link between Shyness and Social Anxiety in Early Adolescence
Weeks, Murray; Ooi, Laura L.; Coplan, Robert J.
2016-01-01
Shy children display wariness in unfamiliar social situations and often experience feelings of social anxiety. This study explored the potential mediating role of cognitive biases in the link between shyness and social anxiety in early adolescence. In particular, we focused on judgments of the probability and cost of negative social situations…
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Ping Chen1 2 Qing-Sheng Wu1 Ya-Ping Ding3 Pin-Shi Yuan1. Department of Chemistry, Tongji University, 1239 Siping Road, Shanghai 200092, P.R. China; Department of Chemistry, Chizhou College, Chizhou, Anhui 247000, P.R. China; Department of Chemistry, Shanghai University, Shanghai 200436, P.R. China ...
Chronic inflammatory cells and damaged limbal cells in pterygium
African Journals Online (AJOL)
EB
2013-09-03
Sep 3, 2013 ... Objective: To explain chronic inflammation in pterygium, and to clarify whether damaged limbal basal epithelial cells were ..... Jiang Y, Goldberg ID, Shi YE. Complex roles of tissue inhibitors of metalloproteinases in cancer. Oncogene 2002; 21: 2245-2252. 6. Kato S, Aoshima H, Saitoh Y, Miwa N. Fullerene-.
"It's Not Rocket Science!": High School Sociology Teachers' Conceptions of Sociology
DeCesare, Michael
2006-01-01
Since academic sociology's birth in this country, sociologists have not been shy about publicly praising and ridiculing the discipline. Though sociologists have been the primary participants in the seemingly endless debates about sociology's proper subject matter, methods, and purpose, there is another group that has also struggled over the past…
The "Tyranny of Choice": Choice Overload as a Possible Instance of Effort Discounting
Reed, Derek D.; Reed, Florence D. DiGennaro; Chok, James; Brozyna, Gary A.
2011-01-01
When making a choice, people like to have options, but an emerging literature on "choice overload" suggests that the provision of too many options results in adverse experiences, including a depletion of cognitive resources and postdecision feelings of regret. A strong implication is that individuals should shy away from situations…
The use of 65Zn for estimating group size of brown hyaenas Hyaena ...
African Journals Online (AJOL)
MacDonald 1983), is influenced by the quality of resources within a territory (Mills 1982). Group size is, however, difficult to determine accurately using routine methods (i.e., direct counts and mark recapture techniques) owing to the shy, elusive and nocturnal habits of brown hyaenas and the physiognomic characteristics of ...
Radical and Ethnic Differences in Breast Cancer Risk Factors
2001-07-01
consumed by San Francisco Bay Area women were analyzed by Dr. Stephen Barnes at the University of Alabama at Birmingham using HPLC -mass spectrometry...Exp Biol Med 1995;208:3-5. 25. Seow A, Shi CY, Franke AA, et al. Isoflavonoid levels in spot 9. Miksicek RJ. Estrogenic flavonoids : structural
Cluster radioactivity leading to doubly magic 100Sn and 132Sn ...
Indian Academy of Sciences (India)
lap region), we used simple power-law interpolation. Proximity potential was first used by Shi and Swiatecki [21] ... consideration. In the present model, assault frequency υ is calculated for each parent– cluster combination, which is associated with zero point vibration energy. For zero point vibration energy Ev, we used the ...
1998-01-23
Morinosato Wakamiya, Atsugi-shi, Kanagawa, 243-01, Japan. t present address: University of Tokyo, Institute for Industrial Science, 7-22-1 Roppongi...Lluis Sole i Sabaris 1-3, E-08028 Barcelona, Spain. 3CNM, "Instituto de Microelectrönica de Madrid", Isaac Newton 8, Parque Tecnologico de Madrid, E
Correlative Structural Biology: How to Investigate the Fine Details of Viral Structure
Directory of Open Access Journals (Sweden)
Elizabeth R. Wright
2010-01-01
Full Text Available Commentary on Byeon, I.J.; Meng, X.; Jung, J.; Zhao, G.; Yang, R.; Ahn, J.; Shi, J.; Concel, J.; Aiken, C.; Zhang, P.; Gronenborn, A.M. Structural convergence between Cryo-EM and NMR reveals intersubunit interactions critical for HIV-1 capsid function. Cell 2009, 139, 780-790.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences. Hai-Liang Zhu. Articles written in Journal of Chemical Sciences. Volume 121 Issue 4 July 2009 pp 463-470. Synthesis, antimicrobial activity of lamotrigine and its ammonium derivatives · Yong Qian Peng-Cheng Lv Lei Shi Rui-Qin Fang Zhong-Cheng Song Hai-Liang Zhu.
Using a Hybrid Approach for a Leadership Cohort Program
Norman, Maxine A.
2013-01-01
Because information technology continues to change rapidly, Extension is challenged with learning and using technology appropriately. We assert Extension cannot shy away from the challenges but must embrace technology because audiences and external forces demand it. A hybrid, or blended, format of a leadership cohort program was offered to public…
Bioconversion of paper sludge with low cellulosic content to ethanol ...
African Journals Online (AJOL)
The purpose of the present work was to evaluate the possibility of converting paper sludge into ethanol using xylose-fermenting yeast SHY07-1 in separate hydrolysis and fermentation. In the enzymatic hydrolysis step, sludge on 2% (w/v, expressed in terms of total carbohydrate mass) substrate consistency was incubated ...
Antibodies Expressed by Intratumoral B Cells as the Basis for a Diagnostic Test for Lung Cancer
2015-06-01
including stromal, endothelial, and immune cells (20,21). Tumors can be infiltrated with many types of lymphocytes, some that may foster and others that may...reactive and less clonally expanded anti-hemagglutinin antibodies than influenza vaccination. PLoS One 6, e25797 32. Chen, Z. J., Wheeler , C. J., Shi, W
8a. Jornada de Mecatrònica : Robòtica: present i futur
Universitat de Vic - Universitat Central de Catalunya. Facultat de Ciències i Tecnologia
2016-01-01
Tríptic de la 8a. Jornada de Mecatrònica adreçada a estudiants, professors i empreses interessats en l’àrea de la Mecatrònica, vol donar a conèixer diversos camps d’aplicació d'aquesta disciplina i els estudis que s'hi relacionen.
The role of library in sexual dysfunction management among ageing ...
African Journals Online (AJOL)
This paper looks at sexual dysfunction problems among ageing couples as it leads to family problems such as family disunity between couples, shying away from responsibilities, drunkenness, battering and the like ; then the library information provision role to solve such problems and how far library in our community has ...
Use of Hypnotherapy for Assertive Training and Behavioral Rehearsal: An Active Mode of Therapy.
DeVoge, Susan D.
This paper describes a treatment approach which uses hypnotherapy techniques in combination with assertive training and behavioral rehearsal. It discusses the use of this treatment with a client who exhibited psychogenic symptoms due to personal anxiety. At the beginning of the treatment the client was shy, non-assertive and extremely…
Doing What Your Big Sister Does: Sex, Postfeminism and the YA Chick Lit Series
Bullen, Elizabeth; Toffoletti, Kim; Parsons, Liz
2011-01-01
Mass-marketed teen chick lit has become a publishing phenomenon and has begun to attract critical interest among children's literature scholars. Much of this critical work, however, has shied away from robust critical assessment of the postfeminist conditions informing the production and reception of young adult series like Private, Gossip Girl…
Validating Models of Clinical Word Recognition Tests for Spanish/English Bilinguals
Shi, Lu-Feng
2014-01-01
Purpose: Shi and Sánchez (2010) developed models to predict the optimal test language for evaluating Spanish/English (S/E) bilinguals' word recognition. The current study intended to validate their conclusions in a separate bilingual listener sample. Method: Seventy normal-hearing S/E bilinguals varying in language profile were included.…
Sport Psychology Teaching Approaches for High School Coaches and Their Student-Athletes
Gilbert, Jenelle N.
2017-01-01
Coaches lacking a formal background in sport psychology may shy away from teaching these skills in favor of teaching physical skills with which they are more familiar. Other coaches may assume that athletes will learn sport psychology skills as a byproduct of their coaching pedagogy. Regardless, high school coaches are responsible for teaching…
The Scientific Instruments of Charles Wheatstone and the Blending of Science, Art, and Culture
Metz, Don
2015-01-01
Charles Wheatstone was a British scientist who is most often remembered for his association with the Wheatstone bridge for measuring electrical resistance. A painfully shy man in public, Wheatstone, in reality, possessed a vibrant personality and a wide array of personal interests from acoustics to electricity to optics and parlour tricks. In this…
Electrically Mediated Trauma Repair
1994-07-07
potential (TEP) (Johnston and Hoshiko, 1971; Rick et al., 1988; Shi and Borgens, 1994). In the axolotl neurulae, a gradient of 10 - 20 mV/mm is...reach 60-80 mV/mm. A more shallow voltage gradient is observed in the transverse plane of axolotl neurulae associated with mirror image outwardly
Bile acids cycle disruption in patients with nasopharyngeal ...
African Journals Online (AJOL)
2014-12-31
Dec 31, 2014 ... promotes the elevation of interleukin-10 secretion. Cheng-Shi Wang1 ... Nasopharyngeal carcinoma (NPC) is uncommon in the ... Immune function has close relationship with the patho- genesis of ... Liver is the major organ responsible for the synthesis of primary bile acids, and the function of bacteria in the ...
Distribution of genes associated with yield potential and water ...
Indian Academy of Sciences (India)
Supplementary data: Distribution of genes associated with yield potential and water-saving in. Chinese Zone II wheat detected by developed functional markers. Zhenxian Gao, Zhanliang Shi, Aimin Zhang and Jinkao Guo. J. Genet. 94, 35–42. Table 1. Functional markers for high-yield or water-saving genes in wheat and ...
Berlinalel hõrku kinokunsti maitsmas / Annika Koppel
Koppel, Annika
2007-01-01
57. Berliini filmifestivali auhinnatud filmidest. Peaauhind Kuldkaru - hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"), parima režissööri Hõbekaru - iisraellane Joseph Cedar ("Beafort"), parim meesnäitleja - Julio Chavez (Ariel Rotteri "Teine"), parim naisnäitleja - Nina Hossa (Christian Petzoldi "Yella")
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences. SONG XUE. Articles written in Journal of Biosciences. Volume 41 Issue 2 June 2016 pp 229-236 Article. Silencing of HMGA2 promotes apoptosis and inhibits migration and invasion of prostate cancer cells · Zhan Shi Ding Wu Run Tang Xiang Li Renfu Chen Song Xue Chengjing ...
2011-01-01
bowel syndrome. Scand J Gastroenterol 2000;35:306-11. . 26. Choudhury BK, Shi XZ, Sarna SK. Gene plasticity in colonic circular smooth muscle cells...Malik A. Din nella JE, Kwoh CK et al. Poor validation of medical record ICD-9 diagnoses of gout in a veterans affairs database. J Rheumatol 2009;36
Spatial Citizenship in Gellerup, Denmark
DEFF Research Database (Denmark)
2018-01-01
by Aysha Amin—a young resident who does not shy away from critically addressing the political agenda of urban development—and with a good reason: Gellerup is a “ghetto,” at least according to the so-called “ghettolist,” established by the Danish government to define high unemployment, percentage of people...
Music in the Life Skills Classroom
van Vuuren, Eurika Jansen; van Niekerka, Caroline
2015-01-01
Generalist educators in South Africa shy away from music in the subjects Life Skills (Dance, Drama, Music, Visual Art, Physical Education and Personal and Social Well-being) and Creative Arts (Dance, Drama, Music, Visual Art) and universities are not delivering generalist students for the subject demands. In-service educators, as well as subject…
Two-way learning | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
2011-07-08
Jul 8, 2011 ... Government officials have sometimes attended the seminars, which have also given the young scholars a venue to present an early draft of their paper for ... The young researchers are more adept at using the latest econometric techniques and software, so senior scholars also learn from them, Li Shi notes.
A tool for identifying potential Eucalyptus nitens seed orchard sites ...
African Journals Online (AJOL)
Shy seed production in orchards of Eucalyptus nitens is a major barrier to the deployment of genetic gain in South African plantations. A machine learning method was used to identify optimal sites for the establishment of E. nitens seed orchards within the plantation forestry landscape of the summer rainfall region of South ...
Effect of parent and daughter deformation on half-life time in exotic ...
Indian Academy of Sciences (India)
Shi and Swiatecki [6] put forward a model for exotic decay studies that uses Coulomb and proximity potential as interacting barrier for post-scission region and uses simple power law for overlap region. These authors [7] studied the effect of deformation of parent, daughter and shell attenuation on half-life time treating ...
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Ruoxue Liu1 Beibei Lü1 Xiaomeng Wang1 Chunling Zhang1 Shuping Zhang1 Jun Qian1 Lei Chen1 Haojie Shi1 Hansong Dong1. State Ministry of Agriculture Key Laboratory of Monitoring and Management of Crop Pathogens and Insect Pests, Nanjing Agricultural University, Nanjing 210095, China ...
2010-09-30
5593-1, 2010, EGU General Assembly 2010. Shi, Y., J. Zhang, J. S. Reid, E. Hyer, Evaluation of MISR Aerosol Optical Depth Product for Aerosol Data...a surrogate for aerosol type, as large η values are generally related to fine mode aerosols, such as sulfate and smoke aerosols, and small η values
The SHiP experiment and its detector for neutrino physics
Buonaura, Annarita
2016-01-01
SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400GeV proton beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A detector downstream of the target will allow to search long-lived exotic particles with masses below O(10) GeV/c2 forseen in extension of the Standard Model. Another dedicated detector, that will be the focus of this talk, will allow to study active neutrino cross- sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electr...
Status and physics of the SHiP experiment at CERN
Buonaura, Annarita
2017-01-01
SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...
Search for Hidden Particles (SHiP): a new experiment proposal
De Lellis, G.
2015-06-01
Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. We propose a new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been observed so far. We therefore propose an experiment to search for hidden particles and study tau neutrino physics at the same time.
Current status of X-ray system at SHI Tsukuba facility
International Nuclear Information System (INIS)
Washio, Masakazu; Kato, Hiroo; Yamase, Yutaka; Odera, Masatoshi; Thompson, C.C.; Cleland, M.R.
1992-01-01
Many studies have been carried out on X-ray converter system, characteristics of the X-rays and its applications. In this paper, following items will be described. 1. Characteristics of electron beam obtained from 5 MeV Dynamitron, 2. Design and status of the X-ray converter, 3. Characteristics of converted X-ray, 4. Preliminary results of sterilization of certain microbiological reference standard. (J.P.N.)
Status and physics of the SHiP experiment at CERN
Buonaura, Annarita
2018-01-01
SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...
Institucional'naja podgotovka Pol'shi k vstupleniju v Evropejskij sojuz
Directory of Open Access Journals (Sweden)
Tomaszewski W.
2015-05-01
Full Text Available In May 2014 it was aready ten years since Poland’s accession to the European Union. The accession was preceded by a long period of political action and negotiations between the Polish and the EU institutions. The process of integration was extremely complex. It covered almost all areas of economic, legal and civil aspects of the aspiring country’s economy, in which all necessary requirements had to be met. The aim of the article was to present the institutional framework created for efficient implementation of the process of accession. The considerations involved especially an institutional method. The research resulted in poining out both the actually efficient and less efficient bodies participating in the process of integration.
Once hurt, twice shy: Social pain contributes to social anxiety.
Fung, Klint; Alden, Lynn E
2017-03-01
Social rejection has been consistently linked to the development of social anxiety. However, mechanisms underlying the relation have been largely unexplored, which presents an obstacle to fully understanding the origins of social anxiety and to the development of effective prevention and treatment strategies. Two studies were conducted to test the hypothesis that the emotion of social pain following rejection promotes the development of social anxiety in subsequent situations. In Study 1, undergraduate participants were exposed to 2 social situations (Cyberball) 2 days apart. Participants who were rejected in the first situation reported higher social anxiety before and during the second situation relative to those who were included. This effect was fully mediated by initial social pain intensity. In Study 2, all participants were initially rejected. Using double-blinded drug administration, participants were randomly assigned to ingest acetaminophen to alleviate the social pain from rejection, or a sugar placebo. As predicted, the acetaminophen group reported lower social anxiety before and during the second situation. Approximately half of the effect was mediated by reduction in social pain. Notably, the immediate effect of acetaminophen was specific to social pain rather than social anxiety. Results were discussed in the context of literature on the etiology of social anxiety and social pain. Future directions were suggested. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
SHI induced damage in electrical properties of silicon NPN BJTs
Energy Technology Data Exchange (ETDEWEB)
Kumar, M. Vinay, E-mail: vkm288@gmail.com; Krishnaveni, S. [Department of studies in Physics, University of Mysore, Mysore (India); Kumar, Santhosh [Department of Physics, Regional Institute of Education, Mysore (India); Yashoda, T. [Department of Physics, AVK College for Women, Hassan (India)
2016-05-23
The investigation of radiation damage in Si microelectronic circuitry and devices are being carried out by various research groups globally. In particular the Si Bipolar junction transistors are very sensitive to high energetic radiation. In the present study, radiation response of NPN Bipolar junction transistor (2N3773) has been examined for 60 MeV B{sup 4+} ion. Key electrical properties like Gummel, dc current gain and capacitance – voltage (C-V) characteristics of 60 MeV B{sup 4+} ion irradiated transistor were studied before and after irradiation. Ion irradiation and subsequent electrical characterizations were performed at room temperature. Current voltage (I-V) measurements showed the increase in collector current for V{sub BE} ≤ 0.4 V as a function of fluence, which is due to B{sup 4+} ion induced surface leakage currents. Base current is observed to be more sensitive than collector current and gain appears to be degraded with ion fluence. Also, C-V measurements shows that both built in potential and doping concentration increased significantly after irradiation.
Magnetocaloric effect and multifunctional properties of Ni-Mn-based Heusler alloys
Energy Technology Data Exchange (ETDEWEB)
Dubenko, Igor, E-mail: igor_doubenko@yahoo.com [Department of Physics, Southern Illinois University, Carbondale, IL 62901 (United States); Samanta, Tapas; Kumar Pathak, Arjun [Department of Physics, Southern Illinois University, Carbondale, IL 62901 (United States); Kazakov, Alexandr; Prudnikov, Valerii [Faculty of Physics, Moscow State University, Vorob' evy Gory, 11999I Moscow (Russian Federation); Stadler, Shane [Department of Physics and Astronomy, Louisiana State University, Baton Rouge, LA 70803 (United States); Granovsky, Alexander [Faculty of Physics, Moscow State University, Vorob' evy Gory, 11999I Moscow (Russian Federation); IKERBASQUE, The Basque Foundation for Science, 48011 Bilbao (Spain); Departamento de Fisica de Materiales, Facultad de Quimica, Universidad del Pais Vasco, Paseo M. de Lardizabal 3, 20018 Donostia - San Sebastian (Spain); Zhukov, Arcady [IKERBASQUE, The Basque Foundation for Science, 48011 Bilbao (Spain); Departamento de Fisica de Materiales, Facultad de Quimica, Universidad del Pais Vasco, Paseo M. de Lardizabal 3, 20018 Donostia - San Sebastian (Spain); Ali, Naushad [Department of Physics, Southern Illinois University, Carbondale, IL 62901 (United States)
2012-10-15
The studies of magnetocaloric properties, phase transitions, and phenomena related to magnetic heterogeneity in the vicinity of the martensitic transition (MT) in Ni-Mn-In and Ni-Mn-Ga off-stoichiometric Heusler alloys are summarized. The crystal structure, magnetocaloric effect (MCE), and magnetotransport properties were studied for the following alloys: Ni{sub 50}Mn{sub 50-x}In{sub x}, Ni{sub 50-x}Co{sub x}Mn{sub 35}In{sub 15}, Ni{sub 50}Mn{sub 35-x}Co{sub x}In{sub 15}, Ni{sub 50}Mn{sub 35}In{sub 14}Z (Z=Al, Ge), Ni{sub 50}Mn{sub 35}In{sub 15-x}Si{sub x}, Ni{sub 50-x}Co{sub x}Mn{sub 25+y}Ga{sub 25-y}, and Ni{sub 50-x}Co{sub x}Mn{sub 32-y}FeyGa{sub 18}. It was found that the magnetic entropy change, {Delta}S, associated with the inverse MCE in the vicinity of the temperature of the magneto-structural transition, TM, persists in a range of (125-5) J/(kg K) for a magnetic field change {Delta}H=5 T. The corresponding temperature varies with composition from 143 to 400 K. The MT in Ni{sub 50}Mn{sub 50-x}In{sub x} (x=13.5) results in a transition between two paramagnetic states. Associated with the paramagnetic austenite-paramagnetic martensite transition {Delta}S=24 J/(kg K) was detected for {Delta}H=5 T at T=350 K. The variation in composition of Ni{sub 2}MnGa can drastically change the magnetic state of the martensitic phase below and in the vicinity of TM. The presence of the martensitic phase with magnetic moment much smaller than that in the austenitic phase above TM leads to the large inverse MCE in the Ni{sub 42}Co{sub 8}Mn{sub 32-y}FeyGa{sub 18} system. The adiabatic change of temperature ({Delta}T{sub ad}) in the vicinity of TC and TM of Ni{sub 50}Mn{sub 35}In{sub 15} and Ni{sub 50}Mn{sub 35}In{sub 14}Z (Z=Al, Ge) was found to be {Delta}T{sub ad}=-2 K and 2 K for {Delta}H=1.8 T, respectively. It was observed that |{Delta}T{sub ad}| Almost-Equal-To 1 K for {Delta}H=1 T for both types of transitions. The results on resistivity, magnetoresistance, Hall
Self-organised nano-structuring of thin oxide-films under swift heavy ion bombardment
International Nuclear Information System (INIS)
Bolse, Wolfgang
2006-01-01
Surface instabilities and the resulting self-organisation processes play an important role in nano-technology since they allow for large-array nano-structuring. We have recently found that the occurrence of such instabilities in thin film systems can be triggered by energetic ion bombardment and the subsequent self-assembly of the surface can be nicely controlled by fine-tuning of the irradiation conditions. The role of the ion in such processes is of double nature: If the instability is latently present already in the virgin sample, but self-assembly cannot take place because of kinetic barriers, the ion impact may just supply the necessary atomic mobility. On the other hand, the surface may become instable due to the ion beam induced material modifications and further irradiation then results in its reorganisation. In the present paper, we will review recently observed nano-scale self-organisation processes in thin oxide-films induced by the irradiation with swift heavy ions (SHI) at some MeV/amu energies. The first example is about SHI induced dewetting, which is driven by capillary forces already present in the as-deposited samples. The achieved dewetting pattern show an amazing similarity to those observed for liquid polymer films on Si, although in the present case the samples were kept at 80 K and hence have never reached their melting point. The second example is about self-organised lamellae formation driven by planar stresses, which are induced by SHI bombardment under grazing incidence and result in a surface instability and anisotropic plastic deformation (hammering effect). Taking advantage of these effects and modifying the irradiation procedure, we were able to generate more complex structures like NiO-'nano-towers' of 2 μm height and 200 nm in diameter
Varying plant density and harvest time to optimize cowpea leaf yield and nutrient content
Ohler, T. A.; Nielsen, S. S.; Mitchell, C. A.
1996-01-01
Plant density and harvest time were manipulated to optimize vegetative (foliar) productivity of cowpea [Vigna unguiculata (L.) Walp.] canopies for future dietary use in controlled ecological life-support systems as vegetables or salad greens. Productivity was measured as total shoot and edible dry weights (DW), edible yield rate [(EYR) grams DW per square meter per day], shoot harvest index [(SHI) grams DW per edible gram DW total shoot], and yield-efficiency rate [(YER) grams DW edible per square meter per day per grams DW nonedible]. Cowpeas were grown in a greenhouse for leaf-only harvest at 14, 28, 42, 56, 84, or 99 plants/m2 and were harvested 20, 30, 40, or 50 days after planting (DAP). Shoot and edible dry weights increased as plant density and time to harvest increased. A maximum of 1189 g shoot DW/m2 and 594 g edible DW/m2 were achieved at an estimated plant density of 85 plants/m2 and harvest 50 DAP. EYR also increased as plant density and time to harvest increased. An EYR of 11 g m-2 day-1 was predicted to occur at 86 plants/m2 and harvest 50 DAP. SHI and YER were not affected by plant density. However, the highest values of SHI (64%) and YER (1.3 g m-2 day-1 g-1) were attained when cowpeas were harvested 20 DAP. The average fat and ash contents [dry-weight basis (dwb)] of harvested leaves remained constant regardless of harvest time. Average protein content increased from 25% DW at 30 DAP to 45% DW at 50 DAP. Carbohydrate content declined from 50% DW at 30 DAP to 45% DW at 50 DAP. Total dietary fiber content (dwb) of the leaves increased from 19% to 26% as time to harvest increased from 20 to 50 days.
Onoka, Chima A; Hanson, Kara; Mills, Anne
2016-08-01
There has been growing interest in the potential for private health insurance (PHI) and private organisations to contribute to universal health coverage (UHC). Yet evidence from low and middle income countries remains very thin. This paper examines the evolution of health maintenance organisations (HMOs) in Nigeria, the nature of the PHI plans and social health insurance (SHI) programmes and their performance, and the implications of their business practices for providing PHI and UHC-related SHI programmes. An embedded case study design was used with multiple subunits of analysis (individual HMOs and the HMO industry) and mixed (qualitative and quantitative) methods, and the study was guided by the structure-conduct-performance paradigm that has its roots in the neo-classical theory of the firm. Quantitative data collection and 35 in-depth interviews were carried out between October 2012 to July 2013. Although HMOs first emerged in Nigeria to supply PHI, their expansion was driven by their role as purchasers in the government's national health insurance scheme that finances SHI programmes, and facilitated by a weak accreditation system. HMOs' characteristics distinguish the market they operate in as monopolistically competitive, and HMOs as multiproduct firms operating multiple risk pools through parallel administrative systems. The considerable product differentiation and consequent risk selection by private insurers promote inefficiencies. Where HMOs and similar private organisations play roles in health financing systems, effective regulatory institutions and mandates must be established to guide their behaviours towards attainment of public health goals and to identify and control undesirable business practices. Lessons are drawn for policy makers and programme implementers especially in those low and middle-income countries considering the use of private organisations in their health financing systems. Copyright © 2016 Elsevier Ltd. All rights reserved.
Effects of model approximations for electron, hole, and photon transport in swift heavy ion tracks
Energy Technology Data Exchange (ETDEWEB)
Rymzhanov, R.A. [Joint Institute for Nuclear Research, Joliot-Curie 6, 141980 Dubna, Moscow Region (Russian Federation); Medvedev, N.A., E-mail: nikita.medvedev@fzu.cz [Department of Radiation and Chemical Physics, Institute of Physics, Czech Academy of Sciences, Na Slovance 2, 182 21 Prague 8 (Czech Republic); Laser Plasma Department, Institute of Plasma Physics, Czech Academy of Sciences, Za Slovankou 3, 182 00 Prague 8 (Czech Republic); Volkov, A.E. [Joint Institute for Nuclear Research, Joliot-Curie 6, 141980 Dubna, Moscow Region (Russian Federation); National Research Centre ‘Kurchatov Institute’, Kurchatov Sq. 1, 123182 Moscow (Russian Federation); Lebedev Physical Institute of the Russian Academy of Sciences, Leninskij pr., 53,119991 Moscow (Russian Federation); National University of Science and Technology MISiS, Leninskij pr., 4, 119049 Moscow (Russian Federation); National Research Nuclear University MEPhI, Kashirskoye sh., 31, 115409 Moscow (Russian Federation)
2016-12-01
The event-by-event Monte Carlo code, TREKIS, was recently developed to describe excitation of the electron subsystems of solids in the nanometric vicinity of a trajectory of a nonrelativistic swift heavy ion (SHI) decelerated in the electronic stopping regime. The complex dielectric function (CDF) formalism was applied in the used cross sections to account for collective response of a matter to excitation. Using this model we investigate effects of the basic assumptions on the modeled kinetics of the electronic subsystem which ultimately determine parameters of an excited material in an SHI track. In particular, (a) effects of different momentum dependencies of the CDF on scattering of projectiles on the electron subsystem are investigated. The ‘effective one-band’ approximation for target electrons produces good coincidence of the calculated electron mean free paths with those obtained in experiments in metals. (b) Effects of collective response of a lattice appeared to dominate in randomization of electron motion. We study how sensitive these effects are to the target temperature. We also compare results of applications of different model forms of (quasi-) elastic cross sections in simulations of the ion track kinetics, e.g. those calculated taking into account optical phonons in the CDF form vs. Mott’s atomic cross sections. (c) It is demonstrated that the kinetics of valence holes significantly affects redistribution of the excess electronic energy in the vicinity of an SHI trajectory as well as its conversion into lattice excitation in dielectrics and semiconductors. (d) It is also shown that induced transport of photons originated from radiative decay of core holes brings the excess energy faster and farther away from the track core, however, the amount of this energy is relatively small.
Knowledge and understanding of health insurance: challenges and remedies.
Barnes, Andrew J; Hanoch, Yaniv
2017-07-13
As coverage is expanded in health systems that rely on consumers to choose health insurance plans that best meet their needs, interest in whether consumers possess sufficient understanding of health insurance to make good coverage decisions is growing. The recent IJHPR article by Green and colleagues-examining understanding of supplementary health insurance (SHI) among Israeli consumers-provides an important and timely answer to the above question. Indeed, their study addresses similar problems to the ones identified in the US health care market, with two notable findings. First, they show that overall-regardless of demographic variables-there are low levels of knowledge about SHI, which the literature has come to refer to more broadly as "health insurance literacy." Second, they find a significant disparity in health insurance literacy between different SES groups, where Jews were significantly more knowledgeable about SHI compared to their Arab counterparts.The authors' findings are consistent with a growing body of literature from the U.S. and elsewhere, including our own, presenting evidence that consumers struggle with understanding and using health insurance. Studies in the U.S. have also found that difficulties are generally more acute for populations considered the most vulnerable and consequently most in need of adequate and affordable health insurance coverage.The authors' findings call attention to the need to tailor communication strategies aimed at mitigating health insurance literacy and, ultimately, access and outcomes disparities among vulnerable populations in Israel and elsewhere. It also raises the importance of creating insurance choice environments in health systems relying on consumers to make coverage decisions that facilitate the decision process by using "choice architecture" to, among other things, simplify plan information and highlight meaningful differences between coverage options.
Applying the School Health Index to a Nationally Representative Sample of Schools: Update for 2006
Brener, Nancy D.; Pejavara, Anu; McManus, Tim
2011-01-01
Background: The School Health Index (SHI) is a tool designed to help schools assess the extent to which they are implementing practices included in the research-based guidelines and strategies for school health and safety programs developed by the Centers for Disease Control and Prevention (CDC). CDC previously analyzed data from the 2000 School…
Investigation of genetic diversity in flixweed (Descurainia sophia ...
African Journals Online (AJOL)
NEO
2012-05-29
May 29, 2012 ... 1997; Bornet and Branchard, 2001). A study carried out by Shi et al. (2010) on 22 types of Cornus sp. using 19. ISSR markers also showed that ISSR molecular markers can be considered appropriate instruments for DNA fingerprinting. Since flixweed is considered to be an extremely important plant in Iran, ...
The M198 Howitzer as a Direct Support Weapon during Amphibious Operations.
1980-06-06
critical to the success of f:;ture amphibio ..s ot.er-.tions. Purpose of the Study, The purpose of this study is to determine the imrpact of the ,19 ’s...principle amphibio ;- shies lift capatilities and physical characte-istics indic -tcs thir flexibility a ,d speed, or lack tnhreof, in d::>.rking large
Gimba, R. W.; Hassan, A. M.; Yaki, A. A; Chado, A. M.
2018-01-01
It has been observed that students shy away from the study of Science and Technology even though Science and Technology occupies a central position in the development of the nation. This shows the negative attitude and poor performance of students in Science and Technology. This has prompted the research into teachers and students' perceptions of…
Purification and characterization of a protease from Thermophilic ...
African Journals Online (AJOL)
AJB SERVER
2006-10-19
Oct 19, 2006 ... protein liquid chromatography. The method gave a ... gent industry are the proteases from bacteria sources ... In this paper, we report our recent progress on the purification ... 10 to 60 min, then cooled in ice-water and the residue activity was measured .... Huo P, Mao J, Shi Y (2003). ... Kumar CG (2002).
PRELIMINARY NOTES ON mE SUNI, NESOTRAGUS MOSCHATUS ...
African Journals Online (AJOL)
PRELIMINARY NOTES ON mE SUNI, NESOTRAGUS MOSCHATUS ~'lD. RED DUIKER, CEPHALOPHUS ... it as being "not uncommon at Mkuzi river, but very shy, taking refuge in the tangled scrub of the flats and only coming into the .... The one chased the other, while making a "tchie-tchie" sound, but louder and more ...
Are Plush Dorms and Fancy Food Plans Important Drivers of College Cost?
Archibald, Robert B.; Feldman, David H.
2011-01-01
Like most schools, College of William and Mary is not shy about touting its amenities. The Webpage that advertises the college's housing and dining options begins with, "Wireless and Starbucks? Thomas Jefferson never had it this good." Advertising of this sort is a double-edged public-relations sword. Colleges and universities clearly want to…
Carreras i Quilis, Josep Maria
2009-01-01
En aquest article s'expliciten els procediments metodològics que s'han utilitzat per determinar els 10.630 municipis urbans i les 104 aglomeracions metropolitanes europees. També s'hi fa una comparació amb els resultats amb l'edició de 2002 i amb els d'altres estudis de referència.
Spine surgery in Nepal: the 2015 earthquake.
Sutterlin, Chester E
2015-12-01
At noon on Saturday, 25 April 2015, a 7.8 magnitude earthquake struck Nepal. It was centered in the Himalaya northwest of Kathmandu, the capital of over 1 million people. The violent tremors were felt as far away as New Delhi, India 1,000 km from the epicenter, but the worst of its destructive force was experienced in the heavily populated Kathmandu valley and in the remote mountainous villages of the Himalaya. Ancient temples crumbled; poorly constructed buildings collapsed; men, women, and children were trapped and injured, sometimes fatally. Avalanches killed mountain climbers, Sherpa guides, and porters at Everest base camp (EBC). The death toll to date exceeds 8,600 with as many as 20,000 injured. Spinal Health International (SHI), a nonprofit volunteer organization, has been active in Nepal in past years and responded to requests by Nepali spine surgeons for assistance with traumatic spine injury victims following the earthquake. SHI volunteers were present during the 2(nd) major earthquake of magnitude 7.3 on 12 May 2015. Past and current experiences in Nepal will be presented.
Snapshot imaging Fraunhofer line discriminator for detection of plant fluorescence
Gupta Roy, S.; Kudenov, M. W.
2015-05-01
Non-invasive quantification of plant health is traditionally accomplished using reflectance based metrics, such as the normalized difference vegetative index (NDVI). However, measuring plant fluorescence (both active and passive) to determine photochemistry of plants has gained importance. Due to better cost efficiency, lower power requirements, and simpler scanning synchronization, detecting passive fluorescence is preferred over active fluorescence. In this paper, we propose a high speed imaging approach for measuring passive plant fluorescence, within the hydrogen alpha Fraunhofer line at ~656 nm, using a Snapshot Imaging Fraunhofer Line Discriminator (SIFOLD). For the first time, the advantage of snapshot imaging for high throughput Fraunhofer Line Discrimination (FLD) is cultivated by our system, which is based on a multiple-image Fourier transform spectrometer and a spatial heterodyne interferometer (SHI). The SHI is a Sagnac interferometer, which is dispersion compensated using blazed diffraction gratings. We present data and techniques for calibrating the SIFOLD to any particular wavelength. This technique can be applied to quantify plant fluorescence at low cost and reduced complexity of data collection.
Nous parlants de basc: identitat i legitimitat
Directory of Open Access Journals (Sweden)
Ane Ortega
2014-05-01
Full Text Available En els últims 40 anys el nombre de bascoparlants ha crescut molt a causa, sobretot, de l'augment dels nous parlants o, utilitzant la terminologia en basc, euskaldunberris, definits aquí com totes aquelles persones que han après aquesta llengua per un mitjà diferent de la transmissió familiar. Encara que el grup dels nous parlants de basc és estratègic per al desenvolupament futur de la llengua, fins a aquesta recerca no hi ha hagut cap estudi en profunditat sobre ells.Aquest article presenta alguns dels resultats relacionats amb la identitat lingüística dels nous parlants. S'hi exploren les autoadscripcions a les tres principals categories que les vehiculen —euskaldun zaharra (parlant nadiu, euskaldunberri (nou parlant i euskaldun (parlant de basc— i s'hi argumenta que aquestes categories indexen identitats que se situen en un continuum d'autenticitat que, al seu torn, es correlaciona amb l'autopercepció dels parlants com a legítims parlants de basc.
Elayaraja, K.; Joshy, M. I. Ahymah; Suganthi, R. V.; Kalkura, S. Narayana; Palanichamy, M.; Ashok, M.; Sivakumar, V. V.; Kulriya, P. K.; Sulania, I.; Kanjilal, D.; Asokan, K.
2011-01-01
Titanium substrate was coated with hydroxyapatite by radiofrequency magnetron sputtering (rf-magnetron sputtering) technique and subjected to swift heavy ion (SHI) irradiation of 125 MeV with Si 9+ at fluences of 1 × 10 10, 1 × 10 11 and 1 × 10 12 ions/cm 2. The glancing incidence X-ray diffraction (GIXRD) analysis confirmed the HAp phase of the irradiated film. There was a considerable decrease in crystallinity and particle size after irradiation. In addition, DRS-UV reflectance spectra revealed a decrease in optical band gap ( Eg) from 5.2 to 4.6 eV. Wettability of biocompatible materials plays an important role in biological cells proliferation for tissue engineering, drug delivery, gene transfer and bone growth. HAp thin films irradiated with 1 × 10 11 ions/cm 2 fluence showed significant increase in wettability. While the SHI irradiated samples exhibited enhanced bioactivity, there was no significant variation in cell viability. Surface roughness, pores and average particle size were analyzed by atomic force microscopy (AFM).
[Commitment at the heart of the nursing profession].
Lecointre, Brigitte
2017-12-01
Although it is a free choice and appears paradoxical, the choice to be a nurse is binding. In keeping with its Code of Ethics, the nursing profession demands an ethical, social, political and collective commitment that we cannot shy away from or we will fail to fulfil our obligations. Copyright © 2017. Published by Elsevier Masson SAS.
An Evaluation of Elementary School Nutrition Practices and Policies in a Southern Illinois County
Sherry, Jennifer S.
2008-01-01
The purpose of this study is to assess elementary school nutrition programs in a rural county in southern Illinois. The researcher interviewed the food service managers of eight schools and completed the School Health Index (SHI) based on their responses. Eighty-seven percent of the schools did not have venues such as vending machines outside the…
Wong, Ting-Hong
2015-01-01
This paper compares public-private partnerships (PPPs) in education in post-war Singapore and Hong Kong. After the Second World War the Singapore government shied away from PPPs, while the state in Hong Kong collaborated extensively with the non-state sector in education. Singapore was a small city-state flanked by two Muslim nations, and its…
Animation and Game Industry:For a Good Prospect
Institute of Scientific and Technical Information of China (English)
Rose Yan
2011-01-01
@@ On October 24th, International Development Forum on Animation and Game Industry was held in Shi-jingshan District Beijing.The Forum was centered on the theme "Innovation and Development of Animation and Game Industry".Experts, government officials, entrepreneurs in the related fields gathered together and discussed the development of the animation and game industry now and in the future.
Determination of Heavy Metal Ions in Tobacco and Tobacco Additives
African Journals Online (AJOL)
NJD
This paper describes a new method for the simultaneous determination of heavy metal ions in tobacco and tobacco additives by ... The HPLC system consisted of a Waters 2690 Alliance separation ..... 1 Z.H. Shi and C.G. Fu, Talanta, 1997, 44, 593. ... 5 Q.F. Hu, G.Y. Yang, J.Y. Yin and Y. Yao, Talanta, 2002, 57, 751.
Enzymatic hydrolysis of esters from 2-carboxy-6- methoxy-2,3 ...
African Journals Online (AJOL)
STORAGESEVER
2009-11-02
Nov 2, 2009 ... Full Length Research Paper. Enzymatic hydrolysis .... ml), followed by water (2 × 15 ml) and dried with anhydrous sodium .... dOptical purity of the acid was determined as the methyl ester by HPLC. eE values ..... Harada I, Hirose Y, Nakaozaki M (1968). ... Nicholas WR, Yang CG, Shi Z, He C (2006). Gold(I)- ...
Finite Groups with Given Quantitative Non-Nilpotent Subgroups II
DEFF Research Database (Denmark)
Shi, Jiangtao; Zhang, Cui
2014-01-01
As an extension of Shi and Zhang's 2011 article [4], we prove that any finite group having at most 23 non-normal non-nilpotent proper subgroups is solvable except for G ≅ A 5 or SL(2, 5), and any finite group having at most three conjugacy classes of non-normal non-nilpotent proper subgroups is s...
Role of Polymerase Gamma Mutations in Breast Tumorigenesis
2010-08-01
triggers steatosis in mouse liver. J Pharmacol. Exp. Ther 2007;321:526–535. [PubMed: 17277197] 21. Yu M, Zhou Y, Shi Y, Ning L, Yang Y, Wei X, et al...encodes an inner mitochondrial membrane protein and is mutated in infantile hepatic mitochondrial DNA depletion. Nat. Genet 2006;38:570–575. [PubMed
Rehabilitation effect of exercise with soft tissue manipulation in ...
African Journals Online (AJOL)
Rehabilitation effect of exercise with soft tissue manipulation in patients with lumbar muscle strain. H Li, H Zhang, S Liu, Y Wang, D Gai, Q Lu, H Gan, Y Shi, W Qi. Abstract. Objective: To study the rehabilitation effect of exercise with soft tissue manipulation therapy for patients with lumbar muscle strain. Methods: Patients with ...
Disrupting Islamophobia: Teaching the Social Construction of Terrorism in the Mass Media
McQueeney, Krista
2014-01-01
This article presents a critical media literacy technique for teaching about the social construction of terrorism. In a post-9/11 context where the human rights of Arabs and Muslims in the United States and overseas are threatened by drone attacks, profiling, detentions, and hate crimes, educators must not shy away from this issue. I use visual…
Someone to Lean on: Assessment and Implications of Social Surrogate Use in Childhood
Arbeau, Kimberley A.; Coplan, Robert J.; Matheson, Adrienne
2012-01-01
A social surrogate is a person who helps a shy individual deal with the stresses of a social situation. Previous research has only investigated social surrogate use in adults. The purpose of the current study was to develop and evaluate a new self-report measure of social surrogacy in middle childhood and to explore the implications of this…
Aligners: the Invisible Corrector-A Boon or Bane.
Mahendra, Lodd
2018-03-01
The trend of clinical orthodontics has shown a palpable shift from conventional braces to innovative technologies like invisible aligners. Aligners are sequences of clear trays worn by patients to straighten their teeth. They were envisaged for the main purpose of esthetics, mainly directed toward self-conscious teenagers who otherwise would shy away from essential correction of malocclusion.
Business plan basics for the nurse.
Crawford, Pam
2013-01-01
In conclusion, no nurse should shy away from understanding the finances of the health care world. We must all embrace the need to understand the costs of care. As we gain this basic understanding, we can excel in demonstrating ideas to improve health care in the most efficient manner, a winning combination in today's financially focused world!
Recent advances on Fe- and Mn-based cathode materials for lithium and sodium ion batteries
Zhu, Xiaobo; Lin, Tongen; Manning, Eric; Zhang, Yuancheng; Yu, Mengmeng; Zuo, Bin; Wang, Lianzhou
2018-06-01
The ever-growing market of electrochemical energy storage impels the advances on cost-effective and environmentally friendly battery chemistries. Lithium-ion batteries (LIBs) are currently the most critical energy storage devices for a variety of applications, while sodium-ion batteries (SIBs) are expected to complement LIBs in large-scale applications. In respect to their constituent components, the cathode part is the most significant sector regarding weight fraction and cost. Therefore, the development of cathode materials based on Earth's abundant elements (Fe and Mn) largely determines the prospects of the batteries. Herein, we offer a comprehensive review of the up-to-date advances on Fe- and Mn-based cathode materials for LIBs and SIBs, highlighting some promising candidates, such as Li- and Mn-rich layered oxides, LiNi0.5Mn1.5O4, LiFe1-xMnxPO4, NaxFeyMn1-yO2, Na4MnFe2(PO4)(P2O7), and Prussian blue analogs. Also, challenges and prospects are discussed to direct the possible development of cost-effective and high-performance cathode materials for future rechargeable batteries.
Energy Technology Data Exchange (ETDEWEB)
Fu, Shaofang; Song, Junhua; Zhu, Chengzhou; Xu, Gui-Liang; Amine, Khalil; Sun, Chengjun; Li, Xiaolin; Engelhard, Mark H.; Du, Dan; Lin, Yuehe
2018-02-01
Nickel iron hydroxides are the most promising non-noble electrocatalysts for oxygen evolution reaction (OER) in alkaline media. By in situ reduction of metal precursors, compositionally controlled three-dimensional (3D) NixFeyB nanofoams (NFs) are synthesized with high surface area and uniformly distributed bimetallic networks. The resultant ultrafine amorphous Ni2Fe1B NFs exhibit extraordinary electrocatalytic performance toward OER and overall water splitting in alkaline media. At a potential as low as 1.42 V (vs. RHE), Ni2Fe1B NFs can deliver a current density of 10 mA/cm2 and show negligible activity loss after 12 hours’ stability test. Even at large current flux of 100 mA/cm2, an ultralow overpotential of 0.27 V is achieved, which is about 0.18 V more negative than benchmark RuO2. Both ex-situ Mӧssbauer spectroscopy and X-ray Absorption Spectroscopy (XAS) reveal a phase separation and transformation for the Ni2Fe1B catalyst during OER process. The evolution of oxidation state and disordered structure of Ni2Fe1B might be a key to the high catalytic performance for OER.
Modulation of epithelial sodium channel in human alveolar epithelial ...
African Journals Online (AJOL)
Modulation of epithelial sodium channel in human alveolar epithelial cells by lipoxin A4 through AhR-cAMP-dependent pathway. Bi-Huan Cheng1,2, Li-Wei Pan2, Sheng-Rong Zhang3, Bin-Yu Ying2, Ben-Ji. Wang2, Guo-Liang Lin2 and Shi-Fang Ding1*. 1Department of Critical Care Medicine, Qilu Hospital of Shandong ...
Institute of Scientific and Technical Information of China (English)
2017-01-01
supplier gongyingshang供应商e-commerce dianzi shangwu电子商务Taobao village Taobaocun淘宝村manufacturer zhizaoshang制造商online store wangdian网店physical store shitidian实体店A secure network is the key to an e-commerce platform.Anqudn shi dianzi shangwu pingtai de guanjian.安全是电子商务平台的关键。
Demystifying the Citizen Soldier
2015-01-01
limitations. Indeed, as historian John Shy notes, General George Washington “never ceased complaining about his militia—about their undependability, their...Despite his misgiving about their military utility, George Washington declared in 1791 that “the militia is certainly an object of primary importance...century. The Guard was still 22 Louis Cantor , “Elihu Root and the National Guard: Friend or Foe
Liu et al., Afr J Tradit Complement Altern Med. (2016) 13(1):157-168 ...
African Journals Online (AJOL)
acer
Figure 4: The forest plot of LH levels. E2. 10 out of 12 RCTs (Xia et al., 2008; Deng et al., 2005; Cao et al., 2007; Xing et al., 2001; Yuan, 2006; Yan, 2002; Shi et al., 2008; Zhang et al., 2008; Yang, 2012) conducted a comparison of the therapeutic effects of E2 levels between integrated Chinese and western medicine and.
Calycosin regulates glucocorticoid-induced apoptosis via Nrf2/ARE ...
African Journals Online (AJOL)
Lifeng Fu1, WeiLiang Wu2, Jian Zhu2, Shu Qiang2, Jansong Chen2* ... Results: CA reduced the apoptosis and accumulation of ROS in DEX-treated cells. ..... its downstream effectors (Figure 5 A-C). However .... Cao J, Chen Z, Zhu Y, Li Y, Guo C, Gao K, Chen L, Shi ... Hong W. Experimental study on the effect of Calycosin.
Biological and Clinical Characterization of Novel lncRNAs Associated with Metastatic Prostate Cancer
2014-10-01
Matthew K. Iyer, Yang Shi, Xia Jiang, June Escara-Wilke, Rachell Brendenis, Dmitry Borkin, Anastasia K. Yocum, Dattatreya Mellacheruvu, Yuanyuan... Anastasia Yocum, Anton Poliakov, Vishal Kothari, Xiaojun Jing, Harika Gundlapalli, Xuhong Cao, Xiaoju Wang, Rohit Malik, PhD...Yuanyuan Qiao, Anton Poliakov, Anastasia K. Yocum, Yong Li, Wei Chen, Xuhong Cao, Xia Jiang, Arun Dahiya, Clair Harris, Felix Y. Feng, Sundeep Kalantry
Nucleation mechanisms in high energy ion beam induced dewetting
Energy Technology Data Exchange (ETDEWEB)
Haag, Michael; Garmatter, Daniel; Ferhati, Redi; Amirthapandian, Sankarakumar; Bolse, Wolfgang [Institut fuer Halbleiteroptik und Funktionelle Grenzflaechen, Universitaet Stuttgart (Germany)
2011-07-01
Solid coatings, when heated above their melting points, often break up by forming small round holes, which then grow, coalesce and finally turn the initially contiguous film into a pattern of isolated droplets. Such dewetting has been intensively studied using thin polymer films on Si. Three different hole nucleation mechanisms were discovered: homogeneous (spontaneous) nucleation, heterogeneous nucleation at defects, and spinodal dewetting by self-amplifying capillary waves. We have recently found that swift heavy ion (SHI) irradiation of thin oxide films on Si results in similar dewetting patterns, even though the films were kept far below their melting points. Using our new in-situ SEM at the UNILAC accelerator of GSI, we were now able to identify the mechanisms behind this SHI induced dewetting phenomenon. By varying the film thickness and introducing defects at the interface, we can directly address the hole nucleation processes. Besides homogeneous and heterogeneous nucleation, we also found a process, which very much resembles the spinodal mechanism found for liquid polymers, although in the present case the instable wavy surface is not generated by capillary waves, but by ion beam induced stresses.
Saturation of plastic deformation by swift heavy ion irradiation: Ion hammering vs. surface effects
Energy Technology Data Exchange (ETDEWEB)
Ferhati, Redi; Dautel, Knut; Bolse, Wolfgang [Institut fuer Halbleiteroptik und Funktionelle Grenzflaechen, Universitaet Stuttgart (Germany); Fritzsche, Monika [Helmholtz-Zentrum Dresden-Rossendorf (Germany)
2012-07-01
Swift heavy ion (SHI) induced plastic deformation is a subject of current research and scientific discussion. This *Ion Hammering* phenomenon was first observed 30 years ago in amorphous materials like metallic glasses. About 10 years ago, Feyh et al. have shown that stress generation and *Ion Hammering* result in self-organization of thin NiO-films on Si-wafers into a sub-micron lamellae-like structure under grazing angle irradiation. The growth of the lamellae was found to saturate as soon as they have reached a thickness of a few hundreds of nm. Here we show our latest results on the restructuring of pre-patterned thin oxide films by SHI under various irradiation conditions. The experiments were performed by employing (in-situ) scanning electron microscopy, and were complemented by (in-situ) energy dispersive x-ray analysis and atomic force microscopy. As we will show, the saturation behavior can be understood as a competition of *Ion Hammering* and surface energy effects, while the unexpected fact, that the initially crystalline films undergo *Ion Hammering* can possibly be attributed to oxygen loss and thus amorphization during irradiation.
Alternative approaches to electronic damage by ion-beam irradiation: Exciton models
Energy Technology Data Exchange (ETDEWEB)
Agullo-Lopez, F.; Munoz-Martin, A.; Zucchiatti, A. [Centro de Micro-Analisis de Materiales, Universidad Autonoma de Madrid, 28049, Madrid (Spain); Climent-Font, A. [Centro de Micro-Analisis de Materiales, Universidad Autonoma de Madrid, 28049, Madrid (Spain); Departamento de Fisica Aplicada, Universidad Autonoma de Madrid, 28049, Madrid (Spain)
2016-11-15
The paper briefly describes the main features of the damage produced by swift heavy ion (SHI) irradiation. After a short revision of the widely used thermal spike concept, it focuses on cumulative mechanisms of track formation which are alternative to those based on lattice melting (thermal spike models). These cumulative mechanisms rely on the production of point defects around the ion trajectory, and their accumulation up to a final lattice collapse or amorphization. As to the formation of point defects, the paper considers those mechanisms relying on direct local conversion of the excitation energy into atomic displacements (exciton models). A particular attention is given to processes based on the non-radiative recombination of excitons that have become self-trapped as a consequence of a strong electron-phonon interaction (STEs). These mechanisms, although operative under purely ionizing radiation in some dielectric materials, have been rarely invoked, so far, to discuss SHI damage. They are discussed in this paper together with relevant examples to materials such as Cu{sub 3}N, alkali halides, SiO{sub 2}, and LiNbO{sub 3}. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Effect of type of schooling and gender on sociability and shyness among students
Directory of Open Access Journals (Sweden)
Archana Singh
2017-01-01
Full Text Available Background: Sociability and shyness are orthogonal personality traits, wherein both are characterized by varying behavioral and psychophysiological correlates. Shyness should not be equated with the lack of sociability, as shyness relates to discomfort that occurs in the presence of others and sociability is identified with an individual's preference for being with others rather than alone. Objectives: The objective of this study was to examine the effect of type of schooling on sociability and shyness among students and to study the gender differences between sociability and shyness among students. Methodology: The sample comprised 210 students from both private and government schools situated in Delhi. Data were collected using Eysenck Personality Profiler for measuring sociability and Revised Cheek and Buss Shyness Scale. Results and Conclusion: The results obtained from ANOVA revealed that government school students were observed to be more sociable as compared to private school students. On the other hand, private school students were found to be more shy as compared to government school students. Females were observed to be more shy as compared to males. In addition, significant interactive effect was observed for sociability when school and gender were taken altogether.
Shy Children Are Less Sensitive to Some Cues to Facial Recognition
Brunet, Paul M.; Mondloch, Catherine J.; Schmidt, Louis A.
2010-01-01
Temperamental shyness in children is characterized by avoidance of faces and eye contact, beginning in infancy. We conducted two studies to determine whether temperamental shyness was associated with deficits in sensitivity to some cues to facial identity. In Study 1, 40 typically developing 10-year-old children made same/different judgments about…
Do Women Shy Away From Competition? Do Men Compete Too Much?
Muriel Niederle; Lise Vesterlund
2005-01-01
Competitive high ranking positions are largely occupied by men, and women remain scarce in engineering and sciences. Explanations for these occupational differences focus on discrimination and preferences for work hours and field of study. We examine if absent these factors gender differences in occupations may still occur. Specifically we explore whether women and men, on a leveled playing field, differ in their selection into competitive environments. Men and women in a laboratory experimen...
Do gays shy away from competition? Do lesbians compete too much?
Buser, T.; Geijtenbeek, L.; Plug, E.
It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible
Do Gays Shy Away from Competition? Do Lesbians Compete Too Much?
Buser, Thomas; Geijtenbeek, Lydia; Plug, Erik
2015-01-01
It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible explanation. We conduct an experiment on a Dutch online survey panel to measure the competitiveness of gay, lesbian and straight panel members. For differences in competitiveness to partially expla...
Shy and Ticklish Truths as Species of Scientific and Artistic Perception
African Journals Online (AJOL)
... recognize a 'gay science' (Nietzsche) not as an eccentric construction of merely poetic insights and expressions, but as a necessary part of the fundamentals of knowledge. It is a truth of the human condition that its truths are grounded in a personal embodiment of individuality, ontogeny, momentariness and situationality.
Women do not play their aces: the consequences of shying away
Claussen, J.; Czibor, E.; van Praag, M.
2015-01-01
The underrepresentation of women at the top of hierarchies is often explained by gender differences in preferences. We find support for this claim by analyzing a large dataset from an online card game community, a stylized yet natural setting characterized by self-selection into an uncertain,
SHiP: a new facility with a dedicated detector for studying $\
Buonaura, Annarita
2016-01-01
SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In five years, $2\\times 10^{20}$ protons of 400 GeV/c momentum will be dumped on a Molybdenum target. A detector downstream of the target will allow a search to made for long-lived particles with masses below O(10) GeV/c$^2$ foreseen in several extensions of the Standard Model. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion Spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electronic detectors for the time stamp of the events and the m...
International Nuclear Information System (INIS)
Nepomechie, Rafael I
2013-01-01
An inhomogeneous T-Q equation has recently been proposed by Cao, Yang, Shi and Wang for the open spin-1/2 XXX chain with general (nondiagonal) boundary terms. We argue that a simplified version of this equation describes all the eigenvalues of the transfer matrix of this model. We also propose a generating function for the inhomogeneous T-Q equations of arbitrary spin. (fast track communication)
MYC RNAi-Pt Combination Nanotherapy for Metastatic Prostate Cancer Treatment
2017-10-01
are the accomplishments for each subtask. 15. SUBJECT TERMS Nanotechnology , nanoparticle, siRNA delivery, platinum, MYC, prostate cancer, drug...determination of the efficacy of select NPs in the B13MYC/Cre|Ptenfl/fl engineered PCa mouse model. This project is directed by an interdisciplinary...JHU), and two co-investigators (Dr. Srinivasan Yegnasubramanian from JHU and Dr. Jinjun Shi from BWH/HMS). 3 2. KEYWORDS Nanotechnology
Xu, Jianping; Liu, Xiaoyan; Yang, Sheng; Zhang, Xiangru; Shi, Yuankai
2017-01-01
Jianping Xu, Xiaoyan Liu, Sheng Yang, Xiangru Zhang, Yuankai Shi Department of Medical Oncology, National Cancer Center/Cancer Hospital, Chinese Academy of Medical Sciences & Peking Union Medical College, Beijing Key Laboratory of Clinical Study on Anticancer Molecular Targeted Drugs, Beijing, People’s Republic of China Background: Treatment failure frequently occurs in patients with epidermal growth factor receptor (EGFR)-mutant non-small cell lung cancer (NSCLC) who resp...
Hiina naise lugu võitis Kuldkaru / Annika Koppel
Koppel, Annika
2007-01-01
57. Berliini filmifestivali peaauhind Kuldkaru - hiina režissööri Wang Quanani film "Tuya abielu" ("Tuya de hun shi"), parima režissööri Hõbekaru - iisraellane Joseph Cedar ("Beafort"), parim meesnäitleja - Julio Chavez (Ariel Rotteri "Teine"), parim naisnäitleja - Nina Hossa (Christian Petzoldi "Yella"), väljapaistev kunstiline saavutus - Robert De Niro lavastajatöö ("Hea karjane")
Hut, Rolf
2017-04-01
"I want to cast magic missile" As a somewhat shy 14 year old, I could never have predicted that the years of playing the role-playing game with the weird dice would perfectly train me in "getting my research into the media". In this talk I will draw parallels between the skills a young role-playing nerd learns and a media-savvy researcher now a days need.
Sone, Yasuko; Ueta, Etsuko; Kodama, Satoru; Sannoumaru, Yasuko; Miyake, Noriko; Sone, Hirohito; Fujiwara, Yoko; Otsuka, Yuzuru; Kondo, Kazuo; Inagaki, Masahiro; Namba, Eiji; Kurata, Tadao; Suzuki, Emiko
2011-01-01
We investigated the effects of vitamin C administration on vitamin C-specific transporters in ODS/ShiJcl-od/od rat livers. The vitamin C-specific transporter levels increased in the livers of the rats not administered vitamin C and decreased in the livers of those administered vitamin C at 100 mg/d, indicating that these transporter levels can be influenced by the amount of vitamin C administered.
Institute of Scientific and Technical Information of China (English)
刘笑蓉; 李硕夫; 周日宝; 刘湘丹; 赵慧君; 刘平安
2017-01-01
Objective To observe the clinical efficacy of Rhododendron molle G.Don (YangZhiZhu) combined with A-corus tatarinowii Schott (ShiChangPu) on treatment of ankle sprains. Methods A total of 232 patients with acute ankle sprains were divided into two groups, 116 cases in each group. The treatment group was given external application with YangZhizhu combined with ShiChangPu. The control group was treated with external application diclofenac diethylamine emulgel (Voltaren). After treatment for 10 days, the clinical efficacy of the two groups were compared. Results The overall effective rate of the treatment group was for 93.1%, the control group was for 78.4%, the curative effect of treatment group was better than that of the control group (P<0.05). Conclusion The YangZhiZhu combined with ShiChangPu on treatment of acute ankle sprains is a safe and effective method.%目的:观察羊踯躅联合石菖蒲治疗踝关节扭伤的临床疗效。方法将232例急性踝关节扭伤的患者随机分为2组各116例,治疗组运用羊踯躅联合石菖蒲外敷治疗,对照组采用扶他林乳胶剂外敷治疗,治疗10天后比较2组的临床疗效。结果治疗组总有效率为93.1%,对照组为78.4%,治疗组疗效明显优于对照组(P<0.05)。结论羊踯躅联合石菖蒲外敷治疗急性踝关节扭伤为安全有效的方法。
HADIS DI KALANGAN SUNNI (SHAHIH BUKHORI DAN SYI’AH (AL-KAFI Al- KULAINI
Directory of Open Access Journals (Sweden)
Khoirul Mudawinun Nisa'
2017-07-01
Full Text Available Sunnah or hadith has a unique and long history. He had experienced the transition from oral tradition to written tradition. The compilation also requires a fairly long time. Political competition among Muslims groups is also coloring in the context of the power struggle. Until the end of the 9th century, the codification effort can produce some great collections (hadith which is considered to be authentic, in addition to a large number of other hadith collections. There is an assumption, that the belief differences in Islam streams impacted or even become the source of hadith differences that recognized by each group. For example Sunni groups just hold on a history of Sunni only, while Shi’ites only recognize the traditions of the history of Shi'ite only and so on. Study hadith among Sunni use the book of Saheeh Bukhari by Imam Bukhari and among Shi'ites use the book of al-kafi by al Kulaini, because both of books are famous books in the both of groups. Comparison of the two hadiths in both of them is assessed through: (1 systematic of the book contents; (2 method of the book preparation; (3 characteristics and features of the books; (4 quality of the book; (5 authentic level of the book; (6 criticisms and comments of the scholars. The results study showed that Al Kafi in the Shi’ite side is unequal footing with Sahih Bukhari on the Sunni side. Al Kafi has become a reference by Shi'ite cleric but no Shia scholar can prove that all of Al-Kafi history is Saheeh. In taking hadith as a reference, the Shia scholars would assess the position of hadith then set the fatwa. This is clearly different with Shahih Bukhari where Bukhari himself said that all of the hadiths are authentic, and has become the consensus of scholars (Sunni that Sahih Bukhari is the most authentic book after the Qur'an.
Guo, P P; Li, P L; Li, Z C; Stein, H H; Liu, L; Xia, T; Yang, Y Y; Ma, Y X
2015-10-01
This study was conducted to investigate the effects of post-harvest storage duration and wheat variety on the digestibility and energy content of new season wheat fed to finishing pigs. Two wheat varieties (Shi and Zhong) were harvested in 2013 and stored in the warehouse of the Fengning Pig Experimental Base at China Agricultural University for 3, 6, 9, or 12 mo. For each storage period, 12 barrows were placed in metabolism crates and allotted to diets containing 1 of the 2 wheat varieties in a randomized complete block design. The experimental diets contained 97.34% wheat and 2.66% of a vitamin and trace mineral premix. With an extension of storage duration from 3 mo to 12 mo, the gross energy (GE) and crude protein (CP) of the wheat decreased by 2.0% and 12.01%, respectively, while the concentration of neutral detergent fiber (NDF), acid detergent fiber (ADF) and starch content increased by 30.26%, 19.08%, and 2.46%, respectively. Total non-starch polysaccharide, total arabinose, total xylose and total mannose contents decreased by 46.27%, 45.80%, 41.71%, and 75.66%, respectively. However, there were no significant differences in the chemical composition between the two wheat varieties with the exception of ADF which was approximately 13.37% lower in Shi. With an extension of storage duration from 3 mo to 12 mo, the digestible energy (DE), metabolizable energy (ME) content and the apparent total tract digestibility of GE, CP, dry matter, organic matter, ether extract, ADF and metabolizability of energy in wheat decreased linearly (pdigestibility of NDF changed quadratically (pdigestibility (pdigestibility of variety Zhong was stable during 9 mo of storage, while the CP digestibility of variety Shi decreased (p<0.05). In conclusion, the GE, DE, and ME of wheat was stable during the first 3 to 6 mo of post-harvest storage, and decreased during the following 6 to 12 mo of storage under the conditions of this study.
The Future of Design: Unframed Problem Solving in Design Education
DEFF Research Database (Denmark)
Friis, Silje Alberthe Kamille; Gelting, Anne Katrine Gøtzsche
2016-01-01
The present paper sets out to investigate the impact and significance of a 3rd semester course in design methods, complex problem solving, and cross-disciplinary collaboration to the students within six design disciplines as experienced by the students three years later. The course reflects a shi......, society, and technology influencing the future disciplines and practices of design and thus the professional roles that they themselves might take....
Hayes, Alexander G.
2018-06-01
Before NASA's New Horizons mission, the surface of Pluto was shrouded in mystery. No one knew what to expect from its surface and most scientists shied away from detailed speculation, except to say that the one thing we should expect is to be surprised (1). On page 992 of this issue, Telfer et al. (2) present such a surprise by describing features interpreted as dunes on Pluto's surface.
Difet: Distributed Feature Extraction Tool for High Spatial Resolution Remote Sensing Images
Eken, S.; Aydın, E.; Sayar, A.
2017-11-01
In this paper, we propose distributed feature extraction tool from high spatial resolution remote sensing images. Tool is based on Apache Hadoop framework and Hadoop Image Processing Interface. Two corner detection (Harris and Shi-Tomasi) algorithms and five feature descriptors (SIFT, SURF, FAST, BRIEF, and ORB) are considered. Robustness of the tool in the task of feature extraction from LandSat-8 imageries are evaluated in terms of horizontal scalability.
CTC Sentinel. Volume 2, Issue 5, May 2009
2009-05-01
in Gaza and criticism of Arab leaders, including Egyptian President Hosni Mubarak, Hizb Allah leader Hassan Nasrallah, and Saudi Interior Minister...alleged al-Qa`ida media coordinator formerly affiliated with Egyptian Jama`a al-Islamiyya. Saudi documents charge him with holding a senior...community in February and March 2009, after a handful of Shi`a were manhandled by religious police during a pilgrimage to the tombs of their imams at the
The Future of Computerized Decision Making
2014-12-01
professionals will be becoming more adept at scripting, modeling, graphical and statistical displays. Decision makers may, similarly, be less likely to shy...elsewhere in this proceedings (Sanchez 2014) simulation can be the core for model-driven big data and inferential decision-making. We need to stake... descriptive , not prescriptive.” In our field, we deal with prospective decision making. We have an advantage in this area: since our output data are
Kowert, Rachel; Domahidi, Emese; Quandt, Thorsten
2014-01-01
Some researchers believe that online gaming spaces can be socially accommodating environments for socially inhibited individuals, such as the socially inept, socially anxious, or shy. While previous research has examined, and found, significant links between these populations and online video game play, it remains unknown to what extent these spaces are contributing to tangible social benefits for the socially inhibited. The current study addresses this question by evaluating the link between...
Hezbollah’s Passport: Religion, Culture, and the Lebanese Diaspora
2015-05-23
the physical needs of its Shi’ a constituency. 26 Hezbollah evolved into more than a terrorist outfit when it began building hospitals and schools in...present. The practice ofzakat charity -and jihad-struggle-are deeply rooted in the traditions and practices of Islam. These 48 Mul)ammad I:Iusayn...with them characteristics that encouraged communal involvement based around Islamic concepts of charity and identity. The diaspora communities in
Chemical Genetic Screens for TDP-43 Modifiers and ALS Drug Discovery
2013-10-01
red. Chlo= Chlorprothixene hydrochloride; Amo= Amoxapine; Mians = Mianserine hydrochloride; Pizo= Pizotifen malate; Pimet= Pimethixene maleate; Cloz...lobar degeneration in transgenic mice produced with TDP-43 genomic fragments. Brain. 32. Li Y, Ray P, Rao EJ, Shi C, Guo W, et al. (2010) A Drosophila...2008) Sirtuin Inhibition Protects from the Polyalanine Muscular Dystrophy Protein PABPN1. Hum Mol Genet. 36. Wang J, Farr GW, Hall DH, Li F, Furtak
Linear Quantum Systems: Non-Classical States and Robust Stability
2016-06-29
has a history going back some 50 years, to the birth of modern control theory with Kalman’s foundational work on filtering and LQG optimal control...realizability conditions. DISTRIBUTION A. Approved for public release: distribution unlimited. 8 Shi Wang, Matthew R James H- Infinity control of...physical model for a quantum measurement-based feedback control system with time delay is presented for the H- infinity control. Luis Augusto
Effect of swift heavy ion irradiation on bare and coated ZnS quantum dots
International Nuclear Information System (INIS)
Chowdhury, S.; Hussain, A.M.P.; Ahmed, G.A.; Singh, F.; Avasthi, D.K.; Choudhury, A.
2008-01-01
The present study compares structural and optical modifications of bare and silica (SiO 2 ) coated ZnS quantum dots under swift heavy ion (SHI) irradiation. Bare and silica coated ZnS quantum dots were prepared following an inexpensive chemical route using polyvinyl alcohol (PVA) as the dielectric host matrix. X-ray diffraction (XRD) and transmission electron microscopy (TEM) study of the samples show the formation of almost spherical ZnS quantum dots. The UV-Vis absorption spectra reveal blue shift relative to bulk material in absorption energy while photoluminescence (PL) spectra suggests that surface state and near band edge emissions are dominating in case of bare and coated samples, respectively. Swift heavy ion irradiation of the samples was carried out with 160 MeV Ni 12+ ion beam with fluences 10 12 to 10 13 ions/cm 2 . Size enhancement of bare quantum dots after irradiation has been indicated in XRD and TEM analysis of the samples which has also been supported by optical absorption spectra. However similar investigations on irradiated coated quantum dots revealed little change in quantum dot size and emission. The present study thus shows that the coated ZnS quantum dots are stable upon SHI irradiation compared to the bare one
Personality and the collective: bold homing pigeons occupy higher leadership ranks in flocks.
Sasaki, Takao; Mann, Richard P; Warren, Katherine N; Herbert, Tristian; Wilson, Tara; Biro, Dora
2018-05-19
While collective movement is ecologically widespread and conveys numerous benefits on individuals, it also poses a coordination problem: who controls the group's movements? The role that animal 'personalities' play in this question has recently become a focus of research interest. Although many animal groups have distributed leadership (i.e. multiple individuals influence collective decisions), studies linking personality and leadership have focused predominantly on the group's single most influential individual. In this study, we investigate the relationship between personality and the influence of multiple leaders on collective movement using homing pigeons, Columba livia , a species known to display complex multilevel leadership hierarchies during flock flights. Our results show that more exploratory (i.e. 'bold') birds are more likely to occupy higher ranks in the leadership hierarchy and thus have more influence on the direction of collective movement than less exploratory (i.e. 'shy') birds during both free flights around their lofts and homing flights from a distant site. Our data also show that bold pigeons fly faster than shy birds during solo flights. We discuss our results in light of theories about the evolution of personality, with specific reference to the adaptive value of heterogeneity in animal groups.This article is part of the theme issue 'Collective movement ecology'. © 2018 The Author(s).
Rapee, Ronald M; Kim, Jinkwan; Wang, Jianping; Liu, Xinghua; Hofmann, Stefan G; Chen, Junwen; Oh, Kyung Ya; Bögels, Susan M; Arman, Soroor; Heinrichs, Nina; Alden, Lynn E
2011-09-01
The current study compared the predicted social and career impact of socially withdrawn and reticent behaviors among participants from Western and East Asian countries. Three hundred sixty-one college students from 5 Western countries and 455 students from 3 East Asian countries read hypothetical vignettes describing socially withdrawn and shy behaviors versus socially outgoing and confident behaviors. Participants then answered questions following each vignette indicating the extent to which they would expect the subject of the vignette to be socially liked and to succeed in their career. Participants also completed measures of their own social anxiety and quality of life. The results indicated significant vignette-by-country interactions in that the difference in perceived social and career impact between shy and outgoing vignettes was smaller among participants from East Asian countries than from Western countries. In addition, significant negative correlations were shown between personal level of shyness and experienced quality of life for participants from both groups of countries, but the size of this relationship was greater for participants from Western than East Asian countries. The results point to the more negative impact of withdrawn and socially reticent behaviors for people from Western countries relative to those from East Asia. Copyright © 2011. Published by Elsevier Ltd.
The Effects of Self-Disclosure on Male and Female Perceptions of Individuals Who Stutter.
Byrd, Courtney T; McGill, Megann; Gkalitsiou, Zoi; Cappellini, Colleen
2017-02-01
The purpose of this study was to examine the influence of self-disclosure on observers' perceptions of persons who stutter. Participants (N = 173) were randomly assigned to view 2 of 4 possible videos (i.e., male self-disclosure, male no self-disclosure, female self-disclosure, and female no self-disclosure). After viewing both videos, participants completed a survey assessing their perceptions of the speakers. Controlling for observer and speaker gender, listeners were more likely to select speakers who self-disclosed their stuttering as more friendly, outgoing, and confident compared with speakers who did not self-disclose. Observers were more likely to select speakers who did not self-disclose as unfriendly and shy compared with speakers who used a self-disclosure statement. Controlling for self-disclosure and observer gender, observers were less likely to choose the female speaker as friendlier, outgoing, and confident compared with the male speaker. Observers also were more likely to select the female speaker as unfriendly, shy, unintelligent, and insecure compared with the male speaker and were more likely to report that they were more distracted when viewing the videos. Results lend support to the effectiveness of self-disclosure as a technique that persons who stutter can use to positively influence the perceptions of listeners.
Energy Technology Data Exchange (ETDEWEB)
Mistry, Bhaumik V.; Joshi, U.S. [Gujarat University, Department of Physics, School of Sciences, Ahmedabad (India); Avasthi, D.K. [Inter University Accelerator Centre, New Delhi (India)
2016-12-15
Electrical and optical properties of pristine and swift heavy ion (SHI) irradiated p-n junction diode have been investigated for advanced electronics application. Fe:SnO{sub 2}/Li:NiO p-n junction was fabricated by using pulsed laser deposition on c-sapphire substrate. The optical band gaps of Fe:SnO{sub 2} and Li:NiO films were obtained to be 3.88 and 3.37 eV, respectively. The current-voltage characteristics of the oxide-based p-n junction showed a rectifying behaviour with turn-on voltage of 0.95 V. The oxide-based p-n junction diode was irradiated to 80 MeV O{sup +6} ions with 1 x 10{sup 12} ions/cm{sup 2} fluence. Decrease in grain size due to SHI irradiation is confirmed by the grazing angle X-ray diffraction and atomic force microscopy. In comparison with the pristine p-n junction diode, O{sup +6} ion irradiated p-n junction diode shows the increase of surface roughness and decrease of percentage transmittance in visible region. For irradiated p-n junction diode, current-voltage curve has still rectifying behaviour but exhibits lower turn-on voltage than that of virgin p-n junction diode. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Patel, Shiv P., E-mail: shivpoojanbhola@gmail.com [Physics Department, University of Allahabad, Allahabad 211002 (India); Pivin, J.C. [CSNSM, IN2P3-CNRS, Batiment 108, F-91405 Orsay Campus (France); Patel, M.K; Won, Jonghan [Materials Science and Technology Division, MST-8, P.O.Box 1663, Mail Stop G755, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Chandra, Ramesh [Nanoscience Laboratory, IIC, Indian Institute of Technology, Roorkee 247667 (India); Kanjilal, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India); Kumar, Lokendra [Physics Department, University of Allahabad, Allahabad 211002 (India)
2012-07-15
The effect of swift heavy ions (SHI) on magnetic ordering in ZnS thin films with Co ions substituted on Zn sites is investigated. The materials have been synthesized by pulsed laser deposition on substrates held at 600 Degree-Sign C for obtaining films with wurtzite crystal structure and it showed ferromagnetic ordering up to room temperature with a paramagnetic component. 120 MeV Ag ions have been used at different fluences of 1 Multiplication-Sign 10{sup 11} ions/cm{sup 2} and 1 Multiplication-Sign 10{sup 12} ions/cm{sup 2} for SHI induced modifications. The long range correlation between paramagnetic spins on Co ions was destroyed by irradiation and the material became purely paramagnetic. The effect is ascribed to the formation of cylindrical ion tracks due to the thermal spikes resulting from electron-phonon coupling. - Highlights: Black-Right-Pointing-Pointer Effect of swift heavy ions on magnetic ordering in Co doped ZnS thin films are presented. Black-Right-Pointing-Pointer Magnetization in the pristine films is composed of ferromagnetic and paramagnetic components. Black-Right-Pointing-Pointer The films become purely paramagnetic after swift heavy ions irradiation. Black-Right-Pointing-Pointer The magnetic transition is ascribed to the formation of ion track (or cylindrical defects) due to the thermal spikes.
High density Gd-substituted yttrium iron garnets by coprecipitation
International Nuclear Information System (INIS)
Lamastra, Francesca Romana; Bianco, Alessandra; Leonardi, Federica; Montesperelli, Giampiero; Nanni, Francesca; Gusmano, Gualtiero
2008-01-01
Gadolinium-substituted yttrium iron garnets are ferrite materials of primary importance in microwave engineering. Stoichiometric powders of nominal composition Y 2.6 Gd 0.4 Fe 5 O 12 (i.e. Fe/(Y + Gd) = 1.67) were prepared by reverse strike coprecipitation of metal nitrates. In order to investigate the influence of composition on phase formation, non-stoichiometric powders were also synthesised. On the basis of DTA/TGA analysis, dried coprecipitates were calcined between 600 deg. C and 1200 deg. C and then characterised by ICP, XRD and HT-XRD. Amorphous coprecipitates crystallise around 700 deg. C in cubic garnet phase along with small amounts of YFeO 3 and/or α-Fe 2 O 3 . Only iron-rich garnets, either pure or Gd-substituted, calcined at 1200 deg. C or above display a single-phase cubic garnet. According to thermal dilatometry results, calcined powders were sintered in air up to 1470 deg. C. The microstructure of sintered ceramics is made up of fine grains, the average size ranging between 3 μm and 13 μm. Density of sintered bodies ranged from 88% to 98%. Ferromagnetic resonance linewidth (ΔH -3dB ) ranged between 4352.9 A m -1 and 4392.7 A m -1 , depending on composition and microstructure
Study of iron exchanged zeolites by Moessbauer effect and electron spin resonance spectroscopy
International Nuclear Information System (INIS)
Aguirre Campuzano, C.E.
1993-01-01
Crystalline iron exchanged NaY zeolites, prepared from aqueous solutions and calcined at atmospheric conditions, have been studied and characterized by XRD, Moessbauer and EPR spectroscopies and TGA analysis. Three iron sites are clearly distinguished from Moessbauer and EPR measurements. Firstly, characteristic Moessbauer and EPR spectra may arise from framework sites, suggesting that Fe has substituted Al. It is also found that their spectroscopic signals are not intensity affected by thermal treatments. Secondly, a Moessbauer doublet which may arise from octahedral sites in the large cavity of the zeolite, shows however, that this doublet and its EPR signal are intensity temperature affected. An additional line broadening is observed on the low velocity line of this doublet, Thirdly, characteristic Moessbauer and EPR signals, which are also intensity temperature dependent have been associated to accluded material, where the Moessbauer doublet presents the line broadening effect before mentioned. Such line broadening effect may be due to perturbing signals from iron ions in tetrahedral sites. Finally, it has been observed that during calcination of the FeY zeolites, the three characteristic EPR signals for the three iron sites, do not increase at the expenses of the other. A result that may suggest a strong bonding between Fe-site of the Y zeolite, irrespective of the iron source. (Author)
Shi,Chen; Zhang,Mi; Cheng,An-Yuan; Huang,Zi-Feng
2018-01-01
Chen Shi,1,* Mi Zhang,2,* An-Yuan Cheng,1 Zi-Feng Huang1 1Department of Trauma Surgery, Wuhan No 1 Hospital, Wuhan, China; 2Department of Orthopedics, Wuhan No 5 Hospital, Wuhan, China *These authors contributed equally to this work Objective: We studied the efficacy of zoledronic acid (ZOL) infusion on radiographic and clinical outcomes after percutaneous kyphoplasty (PKP) for elderly patients with osteoporotic thoracolumbar fractures (osteoporotic vertebral compression fractures...
Shi C; Zhang M; Cheng AY; Huang ZF
2018-01-01
Chen Shi,1,* Mi Zhang,2,* An-Yuan Cheng,1 Zi-Feng Huang1 1Department of Trauma Surgery, Wuhan No 1 Hospital, Wuhan, China; 2Department of Orthopedics, Wuhan No 5 Hospital, Wuhan, China *These authors contributed equally to this work Objective: We studied the efficacy of zoledronic acid (ZOL) infusion on radiographic and clinical outcomes after percutaneous kyphoplasty (PKP) for elderly patients with osteoporotic thoracolumbar fractures (osteoporotic vertebral compression fractures [OV...
Chang, Suchi; Shi, Jindong; Fu, Cuiping; Wu, Xu; Li, Shanqun
2016-01-01
Suchi Chang,1 Jindong Shi,2 Cuiping Fu,1 Xu Wu,1 Shanqun Li1 1Department of Respiratory Medicine, Zhongshan Hospital, Fudan University, Shanghai, 2Department of Respiratory Medicine, The Fifth People’s Hospital of Shanghai, Fudan University, Shanghai, People’s Republic of China Background: COPD is the third leading cause of death worldwide. Acute exacerbations of COPD may cause respiratory failure, requiring intensive care unit admission and mechanical ventilation. Inten...
China Debates the Future Security Environment
2000-01-01
Bike, Zhot~uo da qushi (China megatrends )( Belling: Hualing chubanshe, 1996). For warnings on the need to conceal increasing national power, see Ma...became Japan’s prime minister in 1957. Troop 731, which had engaged in biological warfare experiments, was exempted from trial. In March 1950, all...gongye chubanshe, 1998. Lu Hui. He hua sheng wuqi de h’shi yu weilai CFhe history and future of nuclear, chemical, and biological weapons). Beijing
Schulz, Jeremy Markham
2010-01-01
The idea that work-shy Western Europeans and work-crazed Americans differ fundamentally in their orientations to working life and private life has gained wide currency on both sides of the Atlantic within the social science community, spawning rafts of studies charting differences in aggregate time use patterns and work value orientations. Taking an experiential perspective on the behaviors and orientations constitutive of working life and private life, my dissertation approaches the question...