
Sample records for shi fei fu

  1. Semiconductor laser with fresh aloe shi fu and nursing therapy curative effect observation of indwelling needle phlebitis in patients with cerebral apoplexy%半导体激光联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效观察

    王爱丽; 卢琦; 梅现红; 官莉


    Objective:To investigate the semiconductor laser combined fresh aloe shi fu and nursing treatment the curative effect of needle phlebitis in patients with cerebral apoplexy. Methods: 66 cases of patients with cerebral stroke with phlebitis, randomly divided into experimental group and the control group, 33 cases each. The control group was treated with fresh aloe shi fu; On the basis of the experimental group in the control group treatment using semiconduc﹣tor laser irradiation in vitro and nursing intervention in the treatment of phlebitis. On two groups before and after the treatment of phlebitis treatment efficient and subjective pain level. Results: The patients with phlebitis treatment effec﹣tive rate of 93. 94% , compared with control group effective rate was 81. 82% (P < 0. 05), the difference was statisti﹣cally significant. The experimental group patients with venous pain level compared with control group (P < 0. 05), the difference was statistically significant. Conclusion: The application of semiconductor laser with fresh aloe shi fu and nursing therapy in patients with cerebral apoplexy phlebitis, can alleviate the pain of the patients with cerebral apo﹣plexy.%探讨半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者留置针静脉炎的疗效。方法:将脑卒中并发静脉炎患者66例,随机分为实验组和对照组,各33例。对照组采用鲜芦荟湿敷方法治疗;实验组在对照组治疗的基础上采用半导体激光体外照射及护理干预治疗静脉炎。对两组治疗前后静脉炎治疗有效率及主观疼痛级别进行比较。结果:实验组患者静脉炎治疗有效率为93.94%,和对照组有效率81.82%相比(P<0.05),差别有统计学意义;实验组患者静脉疼痛级别和对照组相比(P<0.05),差别有统计学意义。结论:应用半导体激光照射联合鲜芦荟湿敷及护理治疗脑卒中患者静脉炎,能减轻脑卒中患者的痛苦。

  2. FuNNy

    Madsen, Per Printz


    language, called FuNNy language) to C. The C learning library contains the learning algorithm. The generated C code is simple standard C and therefore it can be applied to all computers with a C-compiler. The learning algorithm is either a gradient descend method based on a numerical calculation...... of the gradient or a random search method. The input fuzzyfication can be described by four different kinds of membership functions. The output fuzzyfication is based on singletons. The rule base can be written in a natural language. The result of the learning is a new version of the fuzzy system described......The purpose of this paper is to describe a tool that is easy to use for implementing self learning fuzzy systems. This tool which is called FuNNy generates fuzzy systems. The tool consists of a compiler and a C learning library. The compiler translates a fuzzy system (written in a dedicated...

  3. The FU Orionis mechanism

    Larson, R.B.


    The large but temporary increase in radius accompanying the recurrent flare-ups of the FU Ori stars can be produced only by strong transient heating of a thin outer layer of the star. Simple composite polytropic models show that the observed changes in radius and luminosity can be accounted for if the outer 0.5 per cent of the mass gains a thermal energy comparable to the kinetic energy it would have in rapid rotation. The models also imply that the masses of the FU Ori stars are near 1 solar mass. The most plausible heating mechanism is an instability due to rapid rotation, and it is suggested that the secular instability of a convective rotating star to bar-like deformations is responsible; this will produce strong shocks, turbulence, and heating of the outermost layers of the star. Matter will also be ejected, and this could account for much of the mass and angular momentum lost from young stars. The most luminous T Tauri stars may have experienced recent FU Ori flare-ups and may still be a magnitude or more brighter than normal. (author)

  4. FEI Titan 80-300 STEM

    Marc Heggen


    Full Text Available The FEI Titan 80-300 STEM is a scanning transmission electron microscope equipped with a field emission electron gun, a three-condenser lens system, a monochromator unit, and a Cs probe corrector (CEOS, a post-column energy filter system (Gatan Tridiem 865 ER as well as a Gatan 2k slow scan CCD system. Characterised by a STEM resolution of 80 pm at 300 kV, the instrument was one of the first of a small number of sub-ångström resolution scanning transmission electron microscopes in the world when commissioned in 2006.

  5. Supporting FEI through innovation strategy implementation

    Aagaard, Annabeth

    the ‘predictability’ of the discovery process/FEI ought to be an immediate priority area of investment for Pharma (Duyck, 2003). This paper explores how pharmaceutical front end innovation can be actively supported through the development and implementation of an innovation strategy. The empirical field......-year Ph.D. study the process of identifying, developing and integrating a targeted innovation corporate strategy and divisional action plans is examined and effects and results are evaluated and measured. The findings and key learnings from the study are presented as propositions of how innovation......, Steven & Burly, 2003, and Vernorn et al., 2008) and that innovation strategies play a central role in optimization of innovation (Clark & Wheelwright, 1995; Cottam et al., 2001; Morgan & Berthon, 2008). Cottam et al. (2001) stress that in order to maximize the benefits of previous innovations innovative...

  6. Women stereotypes in Shi Zhecun's short stories.

    Rosenmeier, Christopher


    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  7. National differences in FEI support and innovation management

    Aagaard, Annabeth


    This paper explores how Front End Innovation (FEI) is supported among companies of different nationality within the context of Pharmaceutical R&D. The present study is carried out in order to contribute to the development of a clearer understanding of active facilitation of innovation management...... and front end innovation in theory and practice. I aim to show how different aspects of company size, type and nationality affect the way innovation management and FEI is supported within organizations. This is examined through an in-depth case study of the Danish pharmaceutical company, H. Lundbeck A....../S, and a comparative study including seven European and American Biotech and Pharmaceutical companies. The findings from the study reveal a number of similarities and differences in innovation management and FEI support among the different companies and present propositions of important aspects to consider...

  8. FEI Titan G2 60-300 HOLO

    Chris Boothroyd


    Full Text Available The FEI Titan G2 60-300 HOLO is a unique fourth generation transmission electron microscope, which has been specifically designed for the investigation of electromagnetic fields of materials using off-axis electron holography. It has a Lorentz lens to allow magnetic field free imaging plus two electron biprisms, which in combination enable more uniform holographic fringes to be used. The instrument also has an ultra-wide objective lens pole piece gap which is ideal for in situ experiments. For these purposes, the FEI Titan G2 60-300 HOLO is equipped with a Schottky type high-brightness electron gun (FEI X-FEG, an image Cs corrector (CEOS, a post-column energy filter system (Gatan Tridiem 865 ER as well as a 4 megapixel CCD system (Gatan UltraScan 1000 XP. Typical examples of use and technical specifications for the instrument are given below.

  9. The FE-I4 pixel readout integrated circuit

    Garcia-Sciveres, M., E-mail: [Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Arutinov, D.; Barbero, M. [University of Bonn, Bonn (Germany); Beccherle, R. [Istituto Nazionale di Fisica Nucleare Sezione di Genova, Genova (Italy); Dube, S.; Elledge, D. [Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Fleury, J. [Laboratoire de l' Accelerateur Lineaire, Orsay (France); Fougeron, D.; Gensolen, F. [Centre de Physique des Particules de Marseille, Marseille (France); Gnani, D. [Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Gromov, V. [Nationaal Instituut voor Subatomaire Fysica, Amsterdam (Netherlands); Hemperek, T.; Karagounis, M. [University of Bonn, Bonn (Germany); Kluit, R. [Nationaal Instituut voor Subatomaire Fysica, Amsterdam (Netherlands); Kruth, A. [University of Bonn, Bonn (Germany); Mekkaoui, A. [Lawrence Berkeley National Laboratory, Berkeley, CA (United States); Menouni, M. [Centre de Physique des Particules de Marseille, Marseille (France); Schipper, J.-D. [Nationaal Instituut voor Subatomaire Fysica, Amsterdam (Netherlands)


    A new pixel readout integrated circuit denominated FE-I4 is being designed to meet the requirements of ATLAS experiment upgrades. It will be the largest readout IC produced to date for particle physics applications, filling the maximum allowed reticle area. This will significantly reduce the cost of future hybrid pixel detectors. In addition, FE-I4 will have smaller pixels and higher rate capability than the present generation of LHC pixel detectors. Design features are described along with simulation and test results, including low power and high rate readout architecture, mixed signal design strategy, and yield hardening.

  10. Dr. Shi Hanzhang's Experience in Treating Andropathy


    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  11. The role of effective mass and hand speed in the performance of kung fu athletes compared with nonpractitioners.

    Neto, Osmar Pinto; Magini, Marcio; Saba, Marcelo M F


    The main goal of this article is to quantify the contribution of effective mass (me) and handspeed (shi) on the palm strike performance of kung fu athletes (kung fu group) compared with nonpractitioners (control group). All subjects were asked to strike a basketball. Hand and ball speed (sbf) were determined by high-speed video analysis. The value for me was determined by an equation that does not depend upon postimpact measurement of the hand speed. The results show that kung fu athletes had greater shi (6.67 [SD 1.42] m/s), p = 0.042), higher me (2.62 [SD 0.33] kg, p = 0.004), and greater sbf (9.00 [SD 1.89] m/s), p = 0.004) than the nonpractitioners (5.04 [SD 0.57] m/s, 1.33 [SD 0.19] kg, and 5.72 [SD 0.44] m/s, respectively). Comparing the average values obtained for me and hand and forearm mass (m), it was found that for the control group me is statistically equal to m (p = 0.917), whereas for the kung fu group me is significant greater than m (p = 0.003). It is suggested that for impacts against heavier objects, the effective mass would be the main factor to distinguish a martial arts-trained from an untrained subject.

  12. - In vivo monitoring of 5-FU

    Lucas, Susanne


    The aim of the present study was to establish the in vivo-monitoring of the enrichment of 5-FU liposomes in liver and liver metastases by MRI methods. Relative signal intensities of liver and tumor tissue were determined. After sacrifying animals concentrations of 5-FU and it´s active intracellular metabolite M3 were measured by HPLC techniques. We used CC531 adenocarcinoma in the liver of WAG/Rij rats as a standardized liver tumor model in our investigatio...

  13. FuSuMaTech workshop

    Olofsson, Simon


    The goal of the FuSuMaTecH IP workshop, organised at CERN Ideaquare 19-20 April, was to educate superconductivity and magnet experts about intellectual property. About 30 participants from multiple institutes and companies worked together in this two day interactive program which was facilitated by CERN Knowledge Transfer. Great progress was made in shaping the FuSuMaTech industrial demonstrator projects as well as the R&D&I subjects.

  14. 5-FU Metabolism in Cancer and Orally-Administrable 5-FU Drugs

    Iwao Sasaki


    Full Text Available 5-Fluorouracil (5-FU is a key anticancer drug that for its broad antitumor activity, as well as for its synergism with other anticancer drugs, has been used to treat various types of malignancies. In chemotherapeutic regimens, 5-FU has been combined with oxaliplatin, irinotecan and other drugs as a continuous intravenous infusion. Recent clinical chemotherapy studies have shown that several of the regimens with oral 5-FU drugs are not inferior compared to those involving continuous 5-FU infusion chemotherapy, and it is probable that in some regimens continuous 5-FU infusion can be replaced by oral 5-FU drugs. Historically, both the pharmaceutical industry and academia in Japan have been involved in the development of oral 5-FU drugs, and this review will focus on the current knowledge of 5-FU anabolism and catabolism, and the available information about the various orally-administrable 5-FU drugs, including UFT, S-1 and capecitabine. Clinical studies comparing the efficacy and adverse events of S-1 and capecitabine have been reported, and the accumulated results should be utilized to optimize the treatment of cancer patients. On the other hand, it is essential to elucidate the pharmacokinetic mechanism of each of the newly-developed drugs, to correctly select the drugs for each patient in the clinical setting, and to further develop optimized drug derivatives.

  15. Fuels planning: science synthesis and integration; environmental consequences fact sheet 01: Fire Effects Information System (FEIS)

    Steve Sutherland


    The Fire Effects Information System (FEIS) provides accessible, up-to-date fire effects summaries, taken from current English-language literature, for almost 900 plant species, about 100 animal species, and 16 Kuchler plant communities found on the North American continent. This fact sheet discusses the development of FEIS and what is contained in the species summary....

  16. Civil Engineering for the SHiP facility

    Osborne, John Andrew


    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  17. Radiation protection studies for the SHiP facility

    Strabel, Claudia Christina; Vincke, Helmut


    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  18. The FE-I4 Pixel Readout Chip and the IBL Module

    Barbero, Marlon; Arutinov, David; Backhaus, Malte; Fang, Xiao-Chao; Gonella, Laura; Hemperek, Tomasz; Karagounis, Michael; Hans, Kruger; Kruth, Andre; Wermes, Norbert; /Bonn U.; Breugnon, Patrick; Fougeron, Denis; Gensolen, Fabrice; Menouni, Mohsine; Rozanov, Alexander; /Marseille, CPPM; Beccherle, Roberto; Darbo, Giovanni; /INFN, Genoa; Caminada, Lea; Dube, Sourabh; Fleury, Julien; Gnani, Dario; /LBL, Berkeley /NIKHEF, Amsterdam /Gottingen U. /SLAC


    FE-I4 is the new ATLAS pixel readout chip for the upgraded ATLAS pixel detector. Designed in a CMOS 130 nm feature size process, the IC is able to withstand higher radiation levels compared to the present generation of ATLAS pixel Front-End FE-I3, and can also cope with higher hit rate. It is thus suitable for intermediate radii pixel detector layers in the High Luminosity LHC environment, but also for the inserted layer at 3.3 cm known as the 'Insertable B-Layer' project (IBL), at a shorter timescale. In this paper, an introduction to the FE-I4 will be given, focusing on test results from the first full size FE-I4A prototype which has been available since fall 2010. The IBL project will be introduced, with particular emphasis on the FE-I4-based module concept.

  19. Dicty_cDB: SHI251 [Dicty_cDB

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  20. Dicty_cDB: SHI867 [Dicty_cDB

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  1. Dicty_cDB: SHI777 [Dicty_cDB

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  2. Dark matter at the SHiP experiment

    Timiryasov, Inar


    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  3. Teaching Tu Fu on the Night Shift.

    Brady, Philip


    Describes a teacher's unsuccessful attempt to introduce the poetry of Tu Fu, a wayward bureaucrat of the T'ang dynasty, to a class of part-time students. Uses his students' resistance to this poetry as an occasion to discuss the importance of personal responses to poetry, as opposed to "correct" academic responses. (TB)

  4. The FEI-TPS on the Upper Surface of the X-38

    Antonenko, Johann; Kowal, John


    The X-38 is being developed by NASA-JSC as a technology demonstrator of a future Crew Rescue Vehicle. The size of the vehicle is limited to fit into the cargo bay of the shuttle. Due to its small size and shuttle-like trajectory all surfaces will receive comparably high heat rates leading to high surface temperatures. Temperatures on the nose are calculated to reach 1750°C, which is significantly higher than on the shuttle. Due to the lifting body shape, large areas of the central fuselage will be exposed to flow of hot gases around the vehicle. Here temperatures of the upper surface are calculated to reach up to 1000°C and the application of a high temperature blanket thermal protection system (TPS) becomes mandatory. Consecutively, the temperature level of the upper surface and the base area will be significantly high. Unlike on the shuttle, where large areas of the surface are covered by flexible reusable surface insulation (FRSI), locations with temperatures below 400°C will be scarce on the X-38. During development of the European shuttle HERMES the Flexible External Insulation (FEI) was developed for the upper surface TPS. This development was continued by ESA and DLR funded programs and currently a product family is available for temperatures ranging from 450°C to 1100°C for re-usable application. For a single re- entry under ultimate conditions temperatures may reach up to 1400°C. Under funding of DLR and ESA, the FEI assembly is one of the European contributions to the X-38. Three subassemblies have been chosen: the FEI-450, FEI-650 and FEI- 1000, capable of limit temperatures of 450°C, 650°C and 1000°C, respectively. The FEI-650 and FEI-1000 were already developed in the HERMES program. The FEI- 450 was developed in the German TETRA program. The qualification for X-38 application was performed for temperatures up to 510°C for the FEI-450 and up to 1130°C for the FEI-1000. Acoustic noise loads of up to 160dB have been endured, far beyond what X

  5. Aspiration pneumonia and bronchopneumonia in progressive supranuclear palsy treated with qing fei tang: two case reports.

    Nozaki, Ichiro; Kato-Motozaki, Yuko; Ikeda, Tokuhei; Takahashi, Kazuya; Tagami, Atsuro; Ishida, Chiho; Komai, Kiyonobu


    Qing fei tang, which is used for various respiratory diseases, is useful for reducing relapse of aspiration pneumonia and bronchopneumonia in stroke, but the effect remains unknown in Parkinson's syndrome. We report two cases of Japanese patients with progressive supranuclear palsy and relapsing aspiration pneumonia and bronchopneumonia, which was successfully prevented by qing fei tang. Two Japanese men with progressive supranuclear palsy and receiving total enteral feeding (patient one (66-years-old) and patient two (76-years-old)) had experienced recurrent aspiration pneumonia and bronchopneumonia, which was unresponsive to conventional therapy. The respiratory infection developed twice at intervals of two months in patient one, and nine times at almost monthly intervals in patient two. Thereafter, they were given qing fei tang. After administration of qing fei tang, the respiratory infection reoccurred only once; after 5.5 months for patient one, and six months for patient two. Both of our patients clearly showed a reduced incidence of respiratory infection. Both of our patients clearly showed a reduced incidence of respiratory infection after the administration of qing fei tang. Qing fei tang could be useful for the prevention of recurrent aspiration pneumonia and bronchopneumonia in progressive supranuclear palsy.

  6. Navajo transmission project. Final Environmental Impact Statement (FEIS)


    Dine Power Authority, a Navajo Nation enterprise, proposes to construct a 500 kilovolt transmission line planned to deliver electrical power from the Shiprock Substation in northwestern New Mexico to the Marketplace Substation in southern Nevada. The line would relieve constraints on transmission of electricity west from the Four Corners area; improve operational flexibility and reliability of the overall system; and allow increased economical transfers, sales, and purchases in the Rocky Mountains/Four Corners/Desert Southwest region. Also, the project allows an opportunity for the Navajo Nation to participate in the electrical utility industry and promote economic development to benefit the people of the Navajo Nation. Six alternatives were considered and include (1) energy conservation and electric load management, (2) new generation facilities, (3) use of existing transmission systems, (4) alternative transmission technologies, (5) no action, and (6) the proposed action. For the proposed action, the following alternative routes and ancillary facility locations are addressed in the EIS: four alternative routes and five substations in the eastern portion of the project area; and six alternative routes, three substation sites, and a microwave communication facility in the western portion of the project area. The existing condition of the environmental resources in the project area is described, and potential impacts on those resources as a result of the proposed action are addressed. The impacts of the proposed action would be caused mainly by access roads, tower sites, and other associated facilities on soils, vegetation, wildlife, and cultural and paleontological resources; and the impact of the transmission line's presence on visual resources and land uses. Public comments on the draft EIS are addressed in this FEIS

  7. The SHiP physics program

    De Lellis, Giovanni


    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  8. Why investors shy away from coal

    Roling, D.A.


    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  9. The SHiP project at CERN

    De Lellis, G.; SHiP Collaboration


    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  10. The SHiP experiment at CERN

    Bonivento, Walter M.


    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  11. Submission of the First Full Scale Prototype Chip for Upgraded ATLAS Pixel Detector at LHC, FE-I4A

    Barbero, M; The ATLAS collaboration; Beccherle, R; Darbo, G; Dube, S; Elledge, D; Fleury, J; Fougeron, D; Garcia-Sciveres, M; Gensolen, F; Gnani, D; Gromov, V; Jensen, F; Hemperek, T; Karagounis, M; Kluit, R; Kruth, A; Mekkaoui, A; Menouni, M; Schipper, JD; Wermes, N; Zivkovic, V


    A new ATLAS pixel chip FE-I4 is being developed for use in upgraded LHC luminosity environments, including the near-term Insertable B-Layer (IBL) upgrade. FE-I4 is designed in a 130nm CMOS technology, presenting advantages in terms of radiation tolerance and digital logic density compared to the 250nm CMOS technology used for the current ATLAS pixel IC, FE-I3. The FE-I4 architecture is based on an array of 80x336 pixels, each 50x250um^2, consisting of analog and digital sections. In the summer 2010, a first full scale prototype FE-I4A was submitted for an engineering run. This IC features the full scale pixel array as well as the complex periphery of the future full-size FE-I4. The FE-I4A contains also various extra test features which should prove very useful for the chip characterization, but deviate from the needs for standard operation of the final FE-I4 for IBL. In this paper, focus will be brought to the various features implemented in the FE-I4A submission, while also underlining the main differences b...

  12. Digital Architecture of the New ATLAS Pixel Chip FE-I4

    "Barbero, M; The ATLAS collaboration


    With the high hit rate foreseen for the innermost layers at an upgraded LHC, the current ATLAS Front-End pixel chip FE-I3 would start being inefficient. The main source of inefficiency comes from the copying mechanism of the pixel hits from the pixel array to the end of column buffers. A new ATLAS pixel chip FE-I4 is being developed in a 130 nm technology for use both in the framework of the Insertable B-Layer (IBL) project and for the outer layers of Super-LHC. FE-I4 is 80×336 pixels wide and features a reduced pixel size of 50×250 μm2. In the current design, a new digital architecture is introduced in which hit memories are distributed across the entire chip and the pixels organized in regions. Additional features include neighbor hit checking which allows a timewalk-less hit recording.

  13. FE-I4 Chip Development for Upgraded ATLAS Pixel Detector at LHC

    Barbero, M; The ATLAS collaboration


    A new ATLAS pixel chip FE-I4 has been developed for use in upgraded LHC luminosity environments, including the near-term Insertable B-Layer upgrade. FE-I4 is designed in a 130 nm CMOS technology, presenting advantages in terms of radiation tolerance and digital logic density compared to the 0.25 μm CMOS technology used for the current ATLAS pixel IC, FE-I3. FE-I4 architecture is based on an array of 80×336 pixels, each 50×250 μm2, consisting of analog and digital sections. The analog pixel section is designed for low power consumption and compatibility to several sensor candidates. It is based on a two-stage architecture with a pre-amp AC-coupled to a second stage of amplification. It features leakage current compensation circuitry, local 4-bit pre-amp feedback tuning and a discriminator locally adjusted through 5 configuration bits. The digital architecture is based on a 4-pixel unit called Pixel Digital Region (PDR) allowing for local storage of hits in 5-deep data buffers at pixel level for the duratio...

  14. FE-I4 pixel chip characterization with USBpix3 test system

    Filimonov, Viacheslav; Gonella, Laura; Hemperek, Tomasz; Huegging, Fabian; Janssen, Jens; Krueger, Hans; Pohl, David-Leon; Wermes, Norbert [University of Bonn, Bonn (Germany)


    The USBpix readout system is a small and light weighting test system for the ATLAS pixel readout chips. It is widely used to operate and characterize FE-I4 pixel modules in lab and test beam environments. For multi-chip modules the resources on the Multi-IO board, that is the central control unit of the readout system, are coming to their limits, which makes the simultaneous readout of more than one chip at a time challenging. Therefore an upgrade of the current USBpix system has been developed. The upgraded system is called USBpix3 - the main focus of the talk. Characterization of single chip FE-I4 modules was performed with USBpix3 prototype (digital, analog, threshold and source scans; tuning). PyBAR (Bonn ATLAS Readout in Python scripting language) was used as readout software. PyBAR consists of FEI4 DAQ and Data Analysis Libraries in Python. The presentation describes the USBpix3 system, results of FE-I4 modules characterization and preparation for the multi-chip module and multi-module readout with USBpix3.

  15. Spectroscopic measurements with the ATLAS FE-I4 pixel readout chip

    Pohl, David-Leon; Janssen, Jens; Hemperek, Tomasz; Huegging, Fabian; Wermes, Norbert [Physikalisches Institut der Univeristaet Bonn (Germany)


    The ATLAS FE-I4 pixel readout chip is a large (2 x 2 cm{sup 2}) state of the art ASIC used in high energy physics experiments as well as for research and development purposes. While the FE-I4 is optimized for high hit rates it provides very limited charge resolution. Therefore two methods were developed to obtain high resolution single pixel charge spectra with the ATLAS FE-I4. The first method relies on the ability to change the detection threshold in small steps while counting hits from a particle source and has a resolution limited by electronic noise only. The other method uses a FPGA based time-to-digital-converter to digitize the analog charge signal with high precision. The feasibility, performance and challenges of these methods are discussed. First results of sensor characterizations from radioactive sources and test beams with the ATLAS FE-I4 in view of the charge collection efficiency after irradiation are presented.

  16. Brothers or Rivals? Iran and the Shi'a of Iraq

    Hunter, Robert C


    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  17. Extraction and beam transfer for the SHiP facility

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno


    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  18. Prototype ATLAS IBL Modules using the FE-I4A Front-End Readout Chip

    Albert, J; Alimonti, Gianluca; Allport, Phil; Altenheiner, Silke; Ancu, Lucian; Andreazza, Attilio; Arguin, Jean-Francois; Arutinov, David; Backhaus, Malte; Bagolini, Alvise; Ballansat, Jacques; Barbero, Marlon; Barbier, Gérard; Bates, Richard; Battistin, Michele; Baudin, Patrick; Beau, Tristan; Beccherle, Roberto; Beck, Hans Peter; Benoit, Mathieu; Bensinger, Jim; Bomben, Marco; Borri, Marcello; Boscardin, Maurizio; Botelho Direito, Jose Antonio; Bousson, Nicolas; Boyd, George Russell Jr; Breugnon, Patrick; Bruni, Graziano; Bruschi, Marco; Buchholz, Peter; Buttar, Craig; Cadoux, Franck; Calderini, Giovanni; Caminada, Leah; Capeans, Mar; Casse, Gianluigi; Catinaccio, Andrea; Cavalli-Sforza, Matteo; Chauveau, Jacques; Chu, Ming-Lee; Ciapetti, Marco; Cindro, Vladimir; Citterio, Mauro; Clark, Allan; Cobal, Marina; Coelli, Simone; Colijn, Auke-Pieter; Colin, Daly; Collot, Johann; Crespo-Lopez, Olivier; Dalla Betta, Gian-Franco; Darbo, Giovanni; DaVia, Cinzia; David, Pierre-Yves; Debieux, Stéphane; Delebecque, Pierre; Devetak, Erik; DeWilde, Burton; Di Girolamo, Beniamino; Dinu, Nicoleta; Dittus, Fridolin; Diyakov, Denis; Djama, Fares; Dobos, Daniel Adam; Doonan, Kate; Dopke, Jens; Dorholt, Ole; Dube, Sourabh; Dushkin, Andrey; Dzahini, Daniel; Egorov, Kirill; Ehrmann, Oswin; Elldge, David; Elles, Sabine; Elsing, Markus; Eraud, Ludovic; Ereditato, Antonio; Eyring, Andreas; Falchieri, Davide; Falou, Aboud; Fang, Xiaochao; Fausten, Camille; Favre, Yannick; Ferrere, Didier; Fleta, Celeste; Fleury, Julien; Flick, Tobias; Forshaw, Dean; Fougeron, Denis; Fritzsch, Thomas; Gabrielli, Alessandro; Gaglione, Renaud; Gallrapp, Christian; Gan, K; Garcia-Sciveres, Maurice; Gariano, Giuseppe; Gastaldi, Thibaut; Gemme, Claudia; Gensolen, Fabrice; George, Matthias; Ghislain, Patrick; Giacomini, Gabriele; Gibson, Stephen; Giordani, Mario Paolo; Giugni, Danilo; Gjersdal, Håvard; Glitza, Karl Walter; Gnani, Dario; Godlewski, Jan; Gonella, Laura; Gorelov, Igor; Gorišek, Andrej; Gössling, Claus; Grancagnolo, Sergio; Gray, Heather; Gregor, Ingrid-Maria; Grenier, Philippe; Grinstein, Sebastian; Gromov, Vladimir; Grondin, Denis; Grosse-Knetter, Jörn; Hansen, Thor-Erik; Hansson, Per; Harb, Ali; Hartman, Neal; Hasi, Jasmine; Hegner, Franziska; Heim, Timon; Heinemann, Beate; Hemperek, Tomasz; Hessey, Nigel; Hetmánek, Martin; Hoeferkamp, Martin; Hostachy, Jean-Yves; Hügging, Fabian; Husi, Coralie; Iacobucci, Giuseppe; Idarraga, John; Ikegami, Yoichi; Janoška, Zdenko; Jansen, Jens; Jansen, Luc; Jensen, Frank; Jentzsch, Jennifer; Joseph, John; Kagan, Harris; Karagounis, Michael; Kass, Richard; Kenney, Christopher J; Kersten, Susanne; Kind, Peter; Klingenberg, Reiner; Kluit, Ruud; Kocian, Martin; Koffeman, Els; Kok, Angela; Korchak, Oleksandr; Korolkov, Ilya; Kostyukhin, Vadim; Krieger, Nina; Krüger, Hans; Kruth, Andre; Kugel, Andreas; Kuykendall, William; La Rosa, Alessandro; Lai, Chung-Hang; Lantzsch, Kerstin; Laporte, Didier; Lapsien, Tobias; Lounis, abdenour; Lozano, Manuel; Lu, Yunpeng; Lubatti, Henry; Macchiolo, Anna; Mallik, Usha; Mandić, Igor; Marchand, Denis; Marchiori, Giovanni; Massol, Nicolas; Matthias, Wittgen; Mättig, Peter; Mekkaoui, Abderrazak; Menouni, Mohsine; Menu, Johann; Meroni, Chiara; Mesa, Javier; Micelli, Andrea; Michal, Sébastien; Miglioranzi, Silvia; Mikuž, Marko; Mitsui, Shingo; Monti, Mauro; Moore, J; Morettini, Paolo; Muenstermann, Daniel; Murray, Peyton; Nellist, Clara; Nelson, David J; Nessi, Marzio; Neumann, Manuel; Nisius, Richard; Nordberg, Markus; Nuiry, Francois-Xavier; Oppermann, Hermann; Oriunno, Marco; Padilla, Cristobal; Parker, Sherwood; Pellegrini, Giulio; Pelleriti, Gabriel; Pernegger, Heinz; Piacquadio, Nicola Giacinto; Picazio, Attilio; Pohl, David; Polini, Alessandro; Popule, Jiří; Portell Bueso, Xavier; Povoli, Marco; Puldon, David; Pylypchenko, Yuriy; Quadt, Arnulf; Quirion, David; Ragusa, Francesco; Rambure, Thibaut; Richards, Erik; Ristic, Branislav; Røhne, Ole; Rothermund, Mario; Rovani, Alessandro; Rozanov, Alexandre; Rubinskiy, Igor; Rudolph, Matthew Scott; Rummler, André; Ruscino, Ettore; Salek, David; Salzburger, Andreas; Sandaker, Heidi; Schipper, Jan-David; Schneider, Basil; Schorlemmer, Andre; Schroer, Nicolai; Schwemling, Philippe; Seidel, Sally; Seiden, Abraham; Šícho, Petr; Skubic, Patrick; Sloboda, Michal; Smith, D; Sood, Alex; Spencer, Edwin; Strang, Michael; Stugu, Bjarne; Stupak, John; Su, Dong; Takubo, Yosuke; Tassan, Jean; Teng, Ping-Kun; Terada, Susumu; Todorov, Theodore; Tomášek, Michal; Toms, Konstantin; Travaglini, Riccardo; Trischuk, William; Troncon, Clara; Troska, Georg; Tsiskaridze, Shota; Tsurin, Ilya; Tsybychev, Dmitri; Unno, Yoshinobu; Vacavant, Laurent; Verlaat, Bart; Vianello, Elisa; Vigeolas, Eric; von Kleist, Stephan; Vrba, Václav; Vuillermet, Raphaël; Wang, Rui; Watts, Stephen; Weber, Michele; Weber, Marteen; Weigell, Philipp; Weingarten, Jens; Welch, Steven David; Wenig, Siegfried; Wermes, Norbert; Wiese, Andreas; Wittig, Tobias; Yildizkaya, Tamer; Zeitnitz, Christian; Ziolkowski, Michal; Zivkovic, Vladimir; Zoccoli, Antonio; Zorzi, Nicola; Zwalinski, Lukasz


    The ATLAS Collaboration will upgrade its semiconductor pixel tracking detector with a new Insertable B-layer (IBL) between the existing pixel detector and the vacuum pipe of the Large Hadron Collider. The extreme operating conditions at this location have necessitated the development of new radiation hard pixel sensor technologies and a new front-end readout chip, called the FE-I4. Planar pixel sensors and 3D pixel sensors have been investigated to equip this new pixel layer, and prototype modules using the FE-I4A have been fabricated and characterized using 120 GeV pions at the CERN SPS and 4 GeV positrons at DESY, before and after module irradiation. Beam test results are presented, including charge collection efficiency, tracking efficiency and charge sharing.

  19. 75 FR 4791 - Availability of the Final Environmental Impact Statement (FEIS) for the Relocation of New River...


    ..., following the channel thalweg. DATES: The Public commenting period on the FEIS will end on March 1, 2010... of 85% of the new channel and/or when the thalweg migrates outside of the constructed 500-foot wide...

  20. Prototype ATLAS IBL modules using the FE-I4A front-end readout chip

    Albert, J.; Alex, M.; Alimonti, G.; Hejtmánek, Martin; Janoška, Zdenko; Korchak, Oleksandr; Popule, Jiří; Šícho, Petr; Sloboda, Michal; Tomášek, Michal; Vrba, Václav


    Roč. 7, NOV (2012), 1-45 ISSN 1748-0221 R&D Projects: GA MŠk LA08032 Institutional research plan: CEZ:AV0Z10100502 Keywords : ATLAS * upgrade * tracker * silicon * FE-I4 * planar sensors * test beam Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 1.869, year: 2011

  1. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang


    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  2. Zuordnungsprozesse bei Fußballzuschauern - Zur Salienz teambezogener Kategorien

    Roschmann, Regina


    Sport im Allgemeinen und Fußball im Besonderen erfreuen sich nicht nur unter aktiven Sportlern, sondern auch unter Zuschauern aktuell hoher Beliebtheit. Angesichts teils enormer Einschaltquoten scheint es wahrscheinlich, dass Fußballspiele nicht nur von Fans der beteiligten Mannschaften verfolgt werden. Dies kann sowohl gänzlich neutrale Zuschauer als auch Anhänger anderer Teams betreffen. Während Fans allerdings durch die Literatur bereits ausführliche Aufmerksamkeit erfahren haben und durch...

  3. Health benefits of Kung Fu: a systematic review.

    Tsang, Tracey Wai Man; Kohn, Michael; Chow, Chin Moi; Singh, Maria Fiatarone


    The Chinese martial arts (Kung Fu) have existed for centuries and are generally accepted as being beneficial for health without much empirical data. The aim of this systematic review was to assess the health effects of "hard" Kung Fu styles by performing electronic and manual searches of the literature. The aspects of health and the Kung Fu style examined varied between most studies; in some cases, the martial art group consisted of practitioners of other martial art styles also. Of 2103 references identified, only nine papers were eligible and reviewed. All were observational studies, observing a range of health aspects possibly related to Kung Fu training or performance. Our findings suggest that there is no evidence that Kung Fu practice is associated with the prevention or treatment of any health condition. However, as a moderate- to high-intensity form of aerobic exercise, it may confer benefits similar to those attributed to other aerobic training modalities. However, this hypothesis remains to be tested in clinical trials. Physiological benefits (e.g., aerobic capacity and bone density) may be associated with long-term Kung Fu practice. Future research in this area should adopt experimental designs, clearly identifying eligibility criteria, testing and training protocols, and include health-related outcomes and documentation of adverse events, to advance knowledge in this field.

  4. A SHiP to explore new routes

    Antonella Del Rosso


    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  5. Cellular response to 5-fluorouracil (5-FU in 5-FU-resistant colon cancer cell lines during treatment and recovery

    Kravik Katherine L


    Full Text Available Abstract Background Treatment of cells with the anti-cancer drug 5-fluorouracil (5-FU causes DNA damage, which in turn affects cell proliferation and survival. Two stable wild-type TP53 5-FU-resistant cell lines, ContinB and ContinD, generated from the HCT116 colon cancer cell line, demonstrate moderate and strong resistance to 5-FU, respectively, markedly-reduced levels of 5-FU-induced apoptosis, and alterations in expression levels of a number of key cell cycle- and apoptosis-regulatory genes as a result of resistance development. The aim of the present study was to determine potential differential responses to 8 and 24-hour 5-FU treatment in these resistant cell lines. We assessed levels of 5-FU uptake into DNA, cell cycle effects and apoptosis induction throughout treatment and recovery periods for each cell line, and alterations in expression levels of DNA damage response-, cell cycle- and apoptosis-regulatory genes in response to short-term drug exposure. Results 5-FU treatment for 24 hours resulted in S phase arrests, p53 accumulation, up-regulation of p53-target genes on DNA damage response (ATF3, GADD34, GADD45A, PCNA, cell cycle-regulatory (CDKN1A, and apoptosis-regulatory pathways (FAS, and apoptosis induction in the parental and resistant cell lines. Levels of 5-FU incorporation into DNA were similar for the cell lines. The pattern of cell cycle progression during recovery demonstrated consistently that the 5-FU-resistant cell lines had the smallest S phase fractions and the largest G2(/M fractions. The strongly 5-FU-resistant ContinD cell line had the smallest S phase arrests, the lowest CDKN1A levels, and the lowest levels of 5-FU-induced apoptosis throughout the treatment and recovery periods, and the fastest recovery of exponential growth (10 days compared to the other two cell lines. The moderately 5-FU-resistant ContinB cell line had comparatively lower apoptotic levels than the parental cells during treatment and recovery

  6. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    Yokogawa, N.


    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  7. $\\mu$-flux measurements for SHiP using NA61/SHINE

    Dijkstra, H; Korzenev, A; Mermod, P


    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  8. Calibrating the SHiP muon-flux using NA61/SHINE

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe


    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  9. Kritik Atas Modernitas Dalam Novel Bilangan Fu Karya Ayu Utami

    Bramantio Bramantio


    Full Text Available Artikel ini bertujuan untuk mengungkap kritik atas modernitas dalam novel Bilangan Fu karya Ayu Utami. Dengan memanfaatkan naratologi Tzvetan Todorov, dapat dipahami aspek verbal Bilangan Fu, yaitu sudut pandang, pencerita, dan tuturannya. Berdasarkan penceritaannya, novel ini merupakan novel polifonik, karnivalistik, sekaligus metafiksi. Berdasarkan kontennya, novel ini menghadirkan sejumlah kritik atas modernitas, khususnya berkaitan dengan semangat modernitas yang cenderung melihat segala sesuatu secara monodimensional, hanya ada satu kebenaran, dan liyan diabaikan. Bilangan Fu merupakan novel yang merefleksikan zamannya. Novel ini berhasil menyegarkan cara pandang masyarakat Indonesia, atau setidaknya menghadirkan sesuatu untuk dipikirkan dan dipertimbangkan kembali, berkaitan dengan diri, lingkungan, dan semesta raya. Novel ini mengembalikan manusia ke hakikatnya, yaitu kemanusiaan. Abstract: This article aims to reveal criticism on modernity in Ayu Utami’s novel Bilangan Fu. Tzvetan Todorov’s theory of narrative provided a framework to understand the novel’s verbal aspects, which are point of view, narrator, dan its voice. Based on its narrative, this novel is polyphonic, carnivalistic, and metafictional. Based on its content, it presents criticism on modernity, particularly on spirit of modernity that tends to see everything in monodimensional; there is only one truth, and the other is ignored. Bilangan Fu is a novel that reflects its time. It successfully refreshes the perspective of Indonesian society, or at least brings something to think about, related to the self, environment, and the universe. In the end, it brings back human being to their core, their humanity. Key Words: novel; point of view; narrator; criticism; modernity

  10. Fučík spectra for vector equations

    Christian Fabry


    Full Text Available Let $L:\\hbox{dom} L\\subset L^2(\\Omega;R^N\\rightarrow L^2(\\Omega;R^N$ be a linear operator, $\\Omega$ being open and bounded in $R^M$. The aim of this paper is to study the Fu\\v c\\'\\i k spectrum for vector problems of the form $Lu=\\alpha Au^+ -\\beta Au^-$, where $A$ is an $N\\times N$ matrix, $\\alpha, \\beta$ are real numbers, $u^+$ a vector defined componentwise by $(u^+_i=\\max\\{u_i,0\\}$, $u^-$ being defined similarly. With $\\lambda^*$ an eigenvalue for the problem $Lu=\\lambda Au$, we describe (locally curves in the Fučík spectrum passing through the point $(\\lambda^*,\\lambda^*$, distinguishing different cases illustrated by examples, for which Fučík curves have been computed numerically.

  11. SHI induced irradiation effect on Mo/Si interface

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh


    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  12. The FE-I4 Telescope for particle tracking in testbeam experiments



    A testbeam telescope, based on ATLAS IBL silicon pixel modules, has been built. It comprises six planes of planar silicon sensors with 250 x 50 um^2 pitch, read out by ATLAS FE-I4 chips. In the CERN SPS H8 beamline (180 GeV pi+) a resolution of better than 8 x 12 um^2 at the position of the device under test was achieved. The telescope reached a trigger rate of 6kHz with two measured devices. It is mainly designed for studies using FE-I4 based prototypes, but has also been successfully run with independent DAQ systems. Specialised trigger schemes ensure data synchronisation between these external devices and the telescope. A region-of-interest trigger can be formed by setting masks on the first and the last pixel sensor planes. The setup infrastructure provides centrally controlled and monitored high and low voltage power supplies, silicon oil cooling, temperature and humidity sensors and movable stages.

  13. Development of readout system for FE-I4 pixel module using SiTCP

    Teoh, J.J., E-mail: [Graduate School of Science, Osaka University, 1-1 Machikaneyama, Toyonaka, Osaka, 560-0043 (Japan); Hanagaki, K. [Graduate School of Science, Osaka University, 1-1 Machikaneyama, Toyonaka, Osaka, 560-0043 (Japan); Ikegami, Y.; Takubo, Y.; Terada, S.; Unno, Y. [Institute for Particle and Nuclear Studies, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba City, Ibaraki-ken 305-0801 (Japan)


    The ATLAS pixel detector will be replaced in the future High Luminosity-Large Hadron Collider (HL-LHC) upgrade to preserve or improve the detector performance at high luminosity environment. To meet the tight requirements of the upgrade, a new pixel Front-End (FE) Integrated Circuit (IC) called FE-I4 has been developed. We have then devised a readout system for the new FE IC. Our system incorporates Silicon Transmission Control Protocol (SiTCP) technology (Uchida, 2008 [1]) which utilizes the standard TCP/IP and UDP communication protocols. This technology allows direct data access and transfer between a readout hardware chain and PC via a high speed Ethernet. In addition, the communication protocols are small enough to be implemented in a single Field-Programable Gate Array (FPGA). Relying on this technology, we have been able to construct a very compact, versatile and fast readout system. We have developed a firmware and software together with the readout hardware chain. We also have established basic functionalities for reading out FE-I4.

  14. Search for New Physics in SHiP and at future colliders

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara


    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  15. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    Solovev, Vladimir


    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  16. Interaction and conflict between Sufism and Shi`ism during Safavid era

    E Naghibi


    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  17. Infection witb'l\\:fued GastrointestinafNematOde Parasites ',' .:

    Resistance of Three Strains 'of Sinall EasL~friCan 'Goats to Artificial. Infection witb'l\\:fued ... TWC and mortality among the SEA gOat strains, Gogo goats had significantly lower FEC (606 ejJg). ]WC (529) and .... Chi-square test. This involved ...

  18. X-shooter spectroscopy of FU Tauri A

    Stelzer, B.; Alcalá, J. M.; Scholz, A.; Natta, A.; Randich, S.; Covino, E.


    We have analyzed a broad-band optical and near-infrared spectrum of FU Tau A, which is a presumed young brown dwarf in the Taurus star forming region that has intrigued both theorists and observers by its overluminosity in the Hertzsprung-Russell (HR) diagram with respect to standard pre-main sequence evolutionary models. FU Tau A is brighter than any other Taurus member of the same or similar spectral type, and various phenomena (accretion, activity, binarity) have been put forth as possible explanations. The new data, obtained with the X-shooter spectrograph at the Very Large Telescope, include an unprecedented wealth of information on stellar parameters and simultaneously observed accretion and outflow indicators for FU Tau A. We present the first measurements of gravity (log g = 3.5 ± 0.5), radial velocity (RV = 22.5 ± 2.9 km s-1), rotational velocity (vsini = 20 ± 5 km s-1), and lithium equivalent width (EWLi = 430 ± 20 mÅ) for FU Tau A. From the rotational velocity and the published period we infer a disk inclination of i ≳ 50°. The lithium content is much lower than theoretically expected for such a young very low-mass object, adding another puzzling feature to this object's properties. We determine the mass accretion rate of FU Tau A from comparison of the luminosities of 20 emission lines to empirical calibrations from the literature and find a mean of log Ṁacc [M⊙/yr] = -9.9 with standard deviation σ = 0.2. The accretion rate determined independently from modeling of the excess emission in the Balmer and Paschen continua is consistent with this value. The corresponding accretion luminosity is too low to make a significant contribution to the bolometric luminosity. Strong magnetic activity affecting the stellar parameters or binarity of FU Tau A, both combined with extreme youth, may be responsible for its position in the HR diagram. The existence of an outflow in FU Tau A is demonstrated through the first detection of forbidden emission lines

  19. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Markovic, Andrea; Bowker, Julie C


    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  20. Search for hidden particles with the SHiP experiment

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)


    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  1. FE-I4 Firmware Development and Integration with FELIX for the Pixel Detector

    Yadav, Amitabh; Sharma, Abhishek; CERN. Geneva. EP Department


    CERN has planned a series of upgrades for the LHC. The last in this current series of planned upgrades is designated the HL-LHC. At the same time, the ATLAS Experiment will be extensively changed to meet the challenges of this upgrade (termed as the “Phase-II” upgrade). The Inner Detector will be completely rebuilt for the phase-II. The TRT, SCT and Pixel will be replaced by the all-silicon tracker, termed as the Inner Tracker (ITk). The read-out of this future ITk detector is an engineering challenge for the routing of services and quality of the data. This document describes the FPGA firmware development that integrates the GBT, Elink and Rx-Tx Cores for communication between the FE-I4 modules and the FELIX read-out system.

  2. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna


    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  3. First Results from the AKARI FU-HYU Mission Program

    Pearson, C.; Serjeant, S.; Takagi, T.; Jeong, W.-S.; Negrello, M.; Matsuhara, H.; Wada, T.; Oyabu, S.; Lee, H. M.; Im, M.


    The AKARI FU-HYU mission program has carried out mid-infrared imaging of several well studied Spitzer fields. This imaging fills in the wavelength coverage lacking from the Spitzer surveys and gives an extremely high scientific return for minimal input for AKARI. We select fields already rich in multi-wavelength data from radio to X-ray wavelengths and present the results from our initial analysis in the GOODS-N field. We utilize the comprehansive multiwavelength coverage in the GOODS-N field to produce a multiwavelength catalogue from infrared to ultraviolet wavelengths including photometric redshifts. Using the FU-HYU catalogue we present colour-colour diagrams that map the passage of PAH features through our observation bands. These colour-colours diagrams are used as tools to extract anomalous colour populations, in particular a population of Silicate Break galaxies from the GOODS-N field.

  4. Ring-shaped nebulae around FU Orionis stars

    Goodrich, R.W.


    Observational data on the morphology and spectra of the nebulae surrounding V1057 Cyg, V1515 Cyg, and V1735 Cyg stars are presented and studied. The data reveal that V1735 Cyg is more highly reddened than the nebula and the spectra of all three nebulae are from reflection. A simple model for the dust shell is proposed and it is argued that the shells may indicate a relatively advanced evolutionary state for the FU Orionis star. The relation between the shells and the evolution of the stars is examined. The models of Herbig (1977), Mould et al. (1978), Larson (1980), and Hartmann and Kenyon (1985), which are utilized to analyze the FU Orionis outburst phenomenon, are tested. 23 references

  5. Visuospatial attention and motor skills in kung fu athletes.

    Muiños, Mónica; Ballesteros, Soledad


    The present study compared the performance of a group of sixteen kung fu athletes with that of a control group of fourteen nonathletes on a speeded visuospatial task and a hand-tapping motor task. In the visuospatial task the results showed that athletes were faster than the control participants when stimuli were presented at the periphery of the visual field at a middle and high presentation speed with short interstimulus intervals. Athletes were also significantly faster than nonathlete participants when performing motor actions such as hand-tapping with their dominant hand but groups did not differ with the nondominant hand. These results support the view that athletes perform some speeded visuospatial and motor tasks faster than nonathletes under certain conditions. The findings suggest that, after several years of practice, kung fu athletes develop certain skills that allow them to perform motor speed maneuvers under time pressure conditions.

  6. En procesorienteret miljøvurdering af F&U

    Lyhne, Ivar

    Miljøperformance af fremtidens energiteknologier defineres i høj grad i de tidlige F&U aktiviteter. har i flere år miljøvurderet ForskEL-programmet og i dette projekt forbedres systemets nytte ved at muliggøre øgede krav til programmets samlede performance og følge op på projekternes...

  7. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Leichtman, Mara A


    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.


    Green, Joel D.; Jones, Olivia C.; Poteet, Charles A.; Sargent, Benjamin A. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Keller, Luke D. [Department of Physics and Astronomy, Ithaca College, Ithaca, NY (United States); Yang, Yao-Lun; Evans II, Neal J. [Department of Astronomy, The University of Texas at Austin, Austin, TX 78712 (United States); Fischer, William J. [Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Rebull, Luisa M. [IPAC, Pasadena, CA 91125 (United States)


    We present new SOFIA-FORCAST observations obtained in 2016 February of the archetypal outbursting low-mass young stellar object FU Orionis, and we compare the continuum, solid-state, and gas properties with mid-infrared data obtained at the same wavelengths in 2004 with Spitzer -IRS. In this study, we conduct the first mid-infrared spectroscopic comparison of an FUor over a long time period. Over a 12-year period, UBVR monitoring indicates that FU Orionis has continued its steady decrease in overall brightness by ∼14%. We find that this decrease in luminosity occurs only at wavelengths ≲20 μ m. In particular, the continuum shortward of the silicate emission complex at 10 μ m exhibits a ∼12% (∼3 σ ) drop in flux density but no apparent change in slope; both the Spitzer and SOFIA spectra are consistent with a 7200 K blackbody. Additionally, the detection of water absorption is consistent with the Spitzer spectrum. The silicate emission feature at 10 μ m continues to be consistent with unprocessed grains, unchanged over 12 years. We conclude that either the accretion rate in FU Orionis has decreased by ∼12–14% over this time baseline or the inner disk has cooled, but the accretion disk remains in a superheated state outside the innermost region.

  9. Chemoradiotherapy using platinum analogs/5-FU for advanced esophageal cancer

    Shibata, Shigeru; Kawasaki, Hitoshi; Nakai, Makoto; Morohashi, Hajime; Matsuya, Hideki; Yamada, Kyougo; Morita, Takayuki; Sasaki, Mutsuo


    We evaluated the efficacy of concurrent chemoradiotherapy (CRT) using cisplatin/nedaplatin and 5-fluorouracil (5-FU) for advanced esophageal cancer. Thirteen patients with locally advanced esophageal cancer (T4 cases) and 3 with recurrence of esophageal cancer were treated with radiotherapy (40-70 Gy) and 5-FU combined and cisplatin/nedaplatin concurrently. T4 patients who obtained down-staging by CRT also underwent esophagectomy. A complete response was obtained in one case, partial response in 8 cases, and no change in 7 cases. The overall response rate was 56.3%. A pathological complete response was obtained in one case in which curative resection was performed after CRT. Bone marrow suppression was observed in 68.8% and grade 3 and 4 bone marrow suppression was observed in 43.8%. Concurrent CRT using cisplatin/nedaplatin and 5-FU for advanced esophageal cancer has a high response rate and patients obtaining down-staging by CRT as a neoadjuvant therapy have a chance for long survival after curative resection in locally advanced cases. (author)

  10. Muon-flux measurements for SHiP at H4

    van Herwijnen, E


    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  11. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.


    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  12. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Marcos Gabriel Frank


    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  13. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    Lanfranchi, Gaia


    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  14. Neutrino scattering physics with the SHiP Experiment



    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  15. The SHiP experiment at CERN SPS

    Di Crescenzoon, A


    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  16. Neutrino scattering physics with the SHiP Experiment

    Di Crescenzo, Antonia


    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  17. Neutrino physics with the SHiP experiment



    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  18. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Shiuan-Pey Lin


    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  19. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee


    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  20. Weekly infusional high-dose fluorouracil (HD-FU), HD-FU plus folinic acid (HD-FU/FA), or HD-FU/FA plus biweekly cisplatin in advanced gastric cancer: randomized phase II trial 40953 of the European Organisation for Research and Treatment of Cancer Gastrointestinal Group and the Arbeitsgemeinschaft Internistische Onkologie.

    Lutz, Manfred P; Wilke, Hansjochen; Wagener, D J Theo; Vanhoefer, Udo; Jeziorski, Krzysztof; Hegewisch-Becker, Susanna; Balleisen, Leopold; Joossens, Eric; Jansen, Rob L; Debois, Muriel; Bethe, Ullrich; Praet, Michel; Wils, Jacques; Van Cutsem, Eric


    This multicentric, randomized, two-stage phase II trial evaluated three simplified weekly infusional regimens of fluorouracil (FU) or FU plus folinic acid (FA) and cisplatin (Cis) with the aim to select a regimen for future phase III trials. A total of 145 patients with advanced gastric cancer where randomly assigned to weekly FU 3,000 mg/m2/24 hours (HD-FU), FU 2,600 mg/m2/24 hours plus dl-FA 500 mg/m2 or l-FA 250 mg/m2 (HD-FU/FA), or FU 2000 mg/m2/24 hours plus FA plus biweekly Cis 50 mg/m2, each administered for 6 weeks with a 1-week rest. The primary end point was the response rate. Confirmed responses were observed in 6.1% (two of 33) of the eligible patients treated with HD-FU, in 25% (12 of 48, including one complete remission [CR]) with HD-FU/FA, and in 45.7% (21 of 46, including four CRs) with HD-FU/FA/Cis. The HD-FU arm was closed after stage 1 because the required minimum number of responses was not met. The median progression-free survival of all patients in the HD-FU, HD-FU/FA, and HD-FU/FA/Cis arm was 1.9, 4.0, and 6.1 months, respectively. The median overall survival was 7.1, 8.9, and 9.7 months, and the survival rate at 1 year was 24.3%, 30.3%, and 45.3%, respectively. Grade 4 toxicities were rare. The most relevant grade 3/4 toxicities were neutropenia in 1.9%, 5.4%, and 19.6%, and diarrhea in 2.7%, 1.9%, and 3.9% of the cycles in the HD-FU, HD-FU/FA, and HD-/FU/Cis arms, respectively. Weekly infusional FU/FA plus biweekly Cis is effective and safe in patients with gastric cancer.

  1. Wavelet transform analysis of electromyography kung fu strikes data.

    Neto, Osmar Pinto; Marzullo, Ana Carolina de Miranda


    In martial arts and contact sports strikes are performed at near maximum speeds. For that reason, electromyography (EMG) analysis of such movements is non-trivial. This paper has three main goals: firstly, to investigate the differences in the EMG activity of muscles during strikes performed with and without impacts; secondly, to assess the advantages of using Sum of Significant Power (SSP) values instead of root mean square (rms) values when analyzing EMG data; and lastly to introduce a new method of calculating median frequency values using wavelet transforms (WMDF). EMG data of the deltoid anterior (DA), triceps brachii (TB) and brachioradialis (BR) muscles were collected from eight Kung Fu practitioners during strikes performed with and without impacts. SSP results indicated significant higher muscle activity (p = 0.023) for the strikes with impact. WMDF results, on the other hand, indicated significant lower values (p = 0. 007) for the strikes with impact. SSP results presented higher sensitivity than rms to quantify important signal differences and, at the same time, presented lower inter-subject coefficient of variations. The result of increase in SSP values and decrease in WMDF may suggest better synchronization of motor units for the strikes with impact performed by the experienced Kung Fu practitioners. Key PointsThe results show higher muscle activity and lower electromyography median frequencies for strikes with impact compared to strikes without.SSP results presented higher sensitivity and lower inter-subject coefficient of variations than rms results.Kung Fu palm strikes with impact may present better motor units' synchronization than strikes without.

  2. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-142- KeelerOregon City #2)

    Barndt, Shawn L. [Bonneville Power Administration, Portland, OR (United States)


    Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-142- KeelerOregon #2). Bonneville Power Administration proposes to remove vegetation alongside Transmission Right-of-Ways

  3. Implementation of configurable FEI4 trigger plane for the AIDA telescope

    Obermann, T; Hügging, F; Krüger, H; Lütticke, F; Marinas, C; Wermes, N


    Tracking detectors in particle physics experiments allow a precise reconstruction of particle tracks close to the interaction point and the identification of primary and secondary decay vertices. In order to evaluate the performance of detector prototypes for future particle physics experiments — at hadron colliders (e.g. HL-LHC), flavour factories (e.g. SuperKEKB) or a future lepton collider (e.g. ILC) — under realistic conditions, a fast readout reference device, a telescope, with excellent resolution and modular configuration, is required. The successful development of a telescope with these characteristics was part of the EU-project EUDET, which is continued within the framework of the AIDA activity. One key addition to the telescope within AIDA is the implementation of at least one new reference plane dedicated to provide an adjustable geometry. This plane is realized with a hybrid pixel detector consisting of a sensor bump bonded to the ATLAS pixel readout chip FE-I4. Its masking capability allows t...

  4. Force, reaction time, and precision of Kung Fu strikes.

    Neto, Osmar Pinto; Bolander, Richard; Pacheco, Marcos Tadeu Tavares; Bir, Cynthia


    The goal was to compare values of force, precision, and reaction time of several martial arts punches and palm strikes performed by advanced and intermediate Kung Fu practitioners, both men and women. 13 Kung Fu practitioners, 10 men and three women, participated. Only the men, three advanced and seven intermediate, were considered for comparisons between levels. Reaction time values were obtained using two high speed cameras that recorded each strike at 2500 Hz. Force of impact was measured by a load cell. For comparisons of groups, force data were normalized by participant's body mass and height. Precision of the strikes was determined by a high speed pressure sensor. The results show that palm strikes were stronger than punches. Women in the study presented, on average, lower values of reaction time and force but higher values of precision than men. Advanced participants presented higher forces than intermediate participants. Significant negative correlations between the values of force and precision and the values of force and reaction time were also found.


    Ana Carolina de Miranda Marzullo


    Full Text Available In martial arts and contact sports strikes are performed at near maximum speeds. For that reason, electromyography (EMG analysis of such movements is non-trivial. This paper has three main goals: firstly, to investigate the differences in the EMG activity of muscles during strikes performed with and without impacts; secondly, to assess the advantages of using Sum of Significant Power (SSP values instead of root mean square (rms values when analyzing EMG data; and lastly to introduce a new method of calculating median frequency values using wavelet transforms (WMDF. EMG data of the deltoid anterior (DA, triceps brachii (TB and brachioradialis (BR muscles were collected from eight Kung Fu practitioners during strikes performed with and without impacts. SSP results indicated significant higher muscle activity (p = 0.023 for the strikes with impact. WMDF results, on the other hand, indicated significant lower values (p = 0. 007 for the strikes with impact. SSP results presented higher sensitivity than rms to quantify important signal differences and, at the same time, presented lower inter-subject coefficient of variations. The result of increase in SSP values and decrease in WMDF may suggest better synchronization of motor units for the strikes with impact performed by the experienced Kung Fu practitioners

  6. Adoption, Cynical Detachment, and New Age Beliefs in Juno and Kung Fu Panda

    Chen, Fu-jen


    In his article "Adoption, Cynical Detachment, and New Age Beliefs in Juno and Kung Fu Panda" Fu-Jen Chen situates his study within today's prevailing climate of global consumption to argue that the 2007 film Juno—featuring an unconventional portrayal of the adoption triad and a cynical detachment from public values—not only trivializes and depoliticizes the practice of adoption but also serves as an ideological supplement to today's global capitalism. Furthermore, Kung Fu Panda 1 & 2 (2008; 2...

  7. Andrographolide reversed 5-FU resistance in human colorectal cancer by elevating BAX expression.

    Wang, Weicheng; Guo, Wenjie; Li, Lele; Fu, Zan; Liu, Wen; Gao, Jian; Shu, Yongqian; Xu, Qiang; Sun, Yang; Gu, Yanhong


    5-FU is the first line therapy for colorectal cancer, however, treatment effect is often hampered by the development of drug resistance or toxicity at high doses. Andrographolide is a natural diterpenoid from Andrographis paniculata which has anti-bacterial, anti-antiviral and anti-inflammation activities. In the current study, we test the hypothesis that Andrographolide reverses 5-FU resistance in colorectal cancer and examine the underlying mechanism. In vitro and vivo studies indicated that Andrographolide treatment significantly re-sensitizes HCT116/5-FUR cells (HCT116 cells which are 5-FU resistant) to cytotoxicity of 5-FU. Mechanism analysis showed that Andrographolide/5-FU co-treatment elevated apoptosis level of HCT116/5-FUR cells with highly increased level of BAX. By using biotin-Andrographolide pull down and cellular thermal shift assay, we found out that Andrographolide can directly target to BAX. Andrographolide-BAX interaction prevented BAX degradation, enhancing mitochondria-mediated apoptosis thus reversed 5-FU resistance while BAX silence diminished this effect. Further, by analyzing patient samples who received 5-FU involved chemotherapy, we found that expression level of BAX is correlated with PFS. Our results here provide a novel combination treatment strategy, especially for patients with 5-FU-resistant tumors expressing low level of BAX. Meanwhile, we also proposed that BAX expression may be a predicted and prognosis marker of 5-FU involved chemotherapy. Copyright © 2016 Elsevier Inc. All rights reserved.

  8. FuGEFlow: data model and markup language for flow cytometry

    Manion Frank J


    Full Text Available Abstract Background Flow cytometry technology is widely used in both health care and research. The rapid expansion of flow cytometry applications has outpaced the development of data storage and analysis tools. Collaborative efforts being taken to eliminate this gap include building common vocabularies and ontologies, designing generic data models, and defining data exchange formats. The Minimum Information about a Flow Cytometry Experiment (MIFlowCyt standard was recently adopted by the International Society for Advancement of Cytometry. This standard guides researchers on the information that should be included in peer reviewed publications, but it is insufficient for data exchange and integration between computational systems. The Functional Genomics Experiment (FuGE formalizes common aspects of comprehensive and high throughput experiments across different biological technologies. We have extended FuGE object model to accommodate flow cytometry data and metadata. Methods We used the MagicDraw modelling tool to design a UML model (Flow-OM according to the FuGE extension guidelines and the AndroMDA toolkit to transform the model to a markup language (Flow-ML. We mapped each MIFlowCyt term to either an existing FuGE class or to a new FuGEFlow class. The development environment was validated by comparing the official FuGE XSD to the schema we generated from the FuGE object model using our configuration. After the Flow-OM model was completed, the final version of the Flow-ML was generated and validated against an example MIFlowCyt compliant experiment description. Results The extension of FuGE for flow cytometry has resulted in a generic FuGE-compliant data model (FuGEFlow, which accommodates and links together all information required by MIFlowCyt. The FuGEFlow model can be used to build software and databases using FuGE software toolkits to facilitate automated exchange and manipulation of potentially large flow cytometry experimental data sets

  9. FuGEFlow: data model and markup language for flow cytometry.

    Qian, Yu; Tchuvatkina, Olga; Spidlen, Josef; Wilkinson, Peter; Gasparetto, Maura; Jones, Andrew R; Manion, Frank J; Scheuermann, Richard H; Sekaly, Rafick-Pierre; Brinkman, Ryan R


    Flow cytometry technology is widely used in both health care and research. The rapid expansion of flow cytometry applications has outpaced the development of data storage and analysis tools. Collaborative efforts being taken to eliminate this gap include building common vocabularies and ontologies, designing generic data models, and defining data exchange formats. The Minimum Information about a Flow Cytometry Experiment (MIFlowCyt) standard was recently adopted by the International Society for Advancement of Cytometry. This standard guides researchers on the information that should be included in peer reviewed publications, but it is insufficient for data exchange and integration between computational systems. The Functional Genomics Experiment (FuGE) formalizes common aspects of comprehensive and high throughput experiments across different biological technologies. We have extended FuGE object model to accommodate flow cytometry data and metadata. We used the MagicDraw modelling tool to design a UML model (Flow-OM) according to the FuGE extension guidelines and the AndroMDA toolkit to transform the model to a markup language (Flow-ML). We mapped each MIFlowCyt term to either an existing FuGE class or to a new FuGEFlow class. The development environment was validated by comparing the official FuGE XSD to the schema we generated from the FuGE object model using our configuration. After the Flow-OM model was completed, the final version of the Flow-ML was generated and validated against an example MIFlowCyt compliant experiment description. The extension of FuGE for flow cytometry has resulted in a generic FuGE-compliant data model (FuGEFlow), which accommodates and links together all information required by MIFlowCyt. The FuGEFlow model can be used to build software and databases using FuGE software toolkits to facilitate automated exchange and manipulation of potentially large flow cytometry experimental data sets. Additional project documentation, including

  10. Inhibition effects of a negative electret 5-FU patch on the growth of a hypertrophic scar

    Wang, YUAN; Lili, XU; Ping, HUANG; Xiaoqiang, AN; Lili, CUI; Jian, JIANG


    In this study, the hypertrophic scar (HS) model in rats was established. 5-fluorouracil (5-FU) patch, ‑1000 V and ‑2000 V polypropylene (PP) electret 5-FU patches were prepared and applied onto the wound. The in vitro permeation experiment was performed using the Franz diffusion cell system to determine the permeation cumulative amount and retention amount of 5-FU through/in scar skin. The inhibition effect of negative electret on growth of HS was studied by hematoxylin-eosin (HE) staining, Masson staining and the immunohistologicall methods. The permeation study indicated that a negative electret could enhance the permeation and retention of 5-FU through and in scar skin respectively. HE staining and Masson staining indicated a better effect for ‑1000 V and ‑2000 V electret 5-FU patches on HS inhibition after 28 d post-wounding compared with 5-FU patch. The immunohistological study showed much more reduced expressions of collegan type I, collegan type III, TGF-β1 and HSP47 in scar tissue after application of negative electret 5-FU patches than those of 5-FU patch. A negative electret 5-FU patch may be advantageous for HS treatment.

  11. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu


    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  12. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel


    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  13. TianShuiShi space breeding current situation and developing trend

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang


    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  14. Weekly infusional high-dose fluorouracil (HD-FU), HD-FU plus folinic acid (HD-FU/FA), or HD-FU/FA plus biweekly cisplatin in advanced gastric cancer: randomized phase II trial 40953 of the European Organisation for Research and Treatment of Cancer Gastrointestinal Group and the Arbeitsgemeinschaft Internistische Onkologie.

    Lutz, M.P.; Wilke, H.; Wagener, D.J.T.; Vanhoefer, U.; Jeziorski, K.; Hegewisch-Becker, S.; Balleisen, L.; Joossens, E.; Jansen, R.L.; Debois, M.; Bethe, U.; Praet, M.; Wils, J.; Cutsem, E. van


    PURPOSE: This multicentric, randomized, two-stage phase II trial evaluated three simplified weekly infusional regimens of fluorouracil (FU) or FU plus folinic acid (FA) and cisplatin (Cis) with the aim to select a regimen for future phase III trials. PATIENTS AND METHODS: A total of 145 patients

  15. 5FU and oxaliplatin-containing chemotherapy in two dihydropyrimidine dehydrogenase-deficient patients

    Reerink, O; Mulder, NH; Szabo, BG; Hospers, GAP


    Patients with a germline mutation leading to a deficiency of the dihydropyrimidine dehydrogenase (DPD) enzyme are at risk from developing severe toxicity on the administration of 5FU-containing chemotherapy. We report on the implications of this inborn genetic error in two patients who received 5FU

  16. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja


    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  17. Kung-fu versus swimming training and the effects on balance abilities in young adolescents.

    Baccouch, Rym; Rebai, Haithem; Sahli, Sonia


    Our purpose is to investigate the static balance control of young adolescents practicing kung-fu and swimming in order to find out which of these physical activities is the most effective in developing specific balance abilities in young adolescents. Comparative experimental study. University laboratory research. Three groups of 11-13-year-old boys (12 practicing Kung-Fu, 12 practicing swimming and 12 controls). Center of pressure (CoP) excursions were registered in upright bipedal and unipedal stances on a stabilometric force platform in eyes open (EO) and eyes closed (EC) conditions. Kung-fu practitioners control their balance (P Kung-fu training improved (P kung-fu practitioners. Both of these physical activities could be recommended for young adolescents as recreational or rehabilitation programs as they develop specific balance abilities that could be important for improving and maintaining optimal health. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui


    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…


    Beck, Tracy L. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Aspin, C., E-mail:, E-mail: [Institute for Astronomy, University of Hawaii, 640 North Aohoku Place, Hilo, HI 96720 (United States)


    In this paper, we present the results of our adaptive optics fed three-dimensional imaging spectroscopy study of the FU Orionis binary system. Although the 0.''5 separation companion to FU Ori is {approx}4 mag fainter, we have easily spatially resolved it in the J, H, and K infrared bands and extract high signal-to-noise spectra of the two stellar components from 1.15 to 2.4 {mu}m. We derive a spectral type of K5{sup +2}{sub -1} for FU Ori S based on the stellar photospheric absorption features and find that it is an actively accreting young star (M-dot{sub acc}{approx} (2-3) Multiplication-Sign 10{sup -8} M{sub Sun} yr{sup -1}) that is likely gravitationally bound to FU Ori. We have found that the continuum shape of FU Ori S is not well fit by our spectral modeling process, and this results in a large uncertainty in the line-of-sight extinction to the star. Yet, by placing FU Ori S on the Hertzsprung-Russell diagram and comparing its estimated location with evolutionary models, we find that it is best fit as a {approx}1.2 M{sub Sun} star with a likely age of less than {approx}2 Myr. If we assume coevality of the stellar components, we have thus placed an estimated age on the FU Ori system. Moreover, assuming the canonical model for the nature of FU Ori in that its optical and infrared absorption features arise primarily from the inner circumstellar disk around a {approx}0.3 M{sub Sun} star, we find that the fainter FU Ori S component is actually the more massive star in the system. Future monitoring of FU Ori S to investigate flux variability and orbital motion should further clarify the nature of this curious young binary.

  20. Irradiation induced effects in the FE-I4 front-end chip of the ATLAS IBL detector

    La Rosa, Alessandro; The ATLAS collaboration


    The ATLAS Insertable B-Layer (IBL) detector was installed into the ATLAS experiment in 2014 and has been in operation since 2015. During the first year of IBL data taking an increase of the low voltage currents produced by the FE-I4 front-end chip was observed and this increase was traced back to the radiation damage in the chip. The dependence of the current on the total-ionising dose and temperature has been tested with Xray and proton irradiations and will be presented in this paper together with the detector operation guidelines.

  1. γ-Tocotrienol prevents 5-FU-induced reactive oxygen species production in human oral keratinocytes through the stabilization of 5-FU-induced activation of Nrf2.

    Takano, Hideyuki; Momota, Yukihiro; Kani, Kouichi; Aota, Keiko; Yamamura, Yoshiko; Yamanoi, Tomoko; Azuma, Masayuki


    Chemotherapy-induced oral mucositis is a common adverse event in patients with oral squamous cell carcinoma, and is initiated through a variety of mechanisms, including the generation of reactive oxygen species (ROS). In this study, we examined the preventive effect of γ-tocotrienol on the 5-FU-induced ROS production in human oral keratinocytes (RT7). We treated RT7 cells with 5-FU and γ-tocotrienol at concentrations of 10 µg/ml and 10 nM, respectively. When cells were treated with 5-FU alone, significant growth inhibition was observed as compared to untreated cells. This inhibition was, in part, due to the ROS gene-rated by 5-FU treatment, because N-acetyl cysteine (NAC), a ROS scavenger, significantly ameliorated the growth of RT7 cells. γ-tocotrienol showed no cytotoxic effect on the growth of RT7 cells. Simultaneous treatment of cells with these agents resulted in the significant recovery of cell growth, owing to the suppression of ROS generation by γ-tocotrienol. Whereas 5-FU stimulated the expression of NF-E2-related factor 2 (Nrf2) protein in the nucleus up to 12 h after treatment of RT7 cells, γ-tocotrienol had no obvious effect on the expression of nuclear Nrf2 protein. Of note, the combined treatment with both agents stabilized the 5-FU-induced nuclear Nrf2 protein expression until 24 h after treatment. In addition, expression of Nrf2-dependent antioxidant genes, such as heme oxygenase-1 (HO-1) and quinone oxidoreductase-1 (NQO-1), was significantly augmented by treatment of cells with both agents. These findings suggest that γ-tocotrienol could prevent 5-FU-induced ROS generation by stabilizing Nrf2 activation, thereby leading to ROS detoxification and cell survival in human oral keratinocytes.

  2. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Lu, Yi; Xu, Yuan


    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  3. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.


    Pueyo, Laurent; Hillenbrand, Lynne; Hinkley, Sasha; Dekany, Richard; Roberts, Jenny; Vasisht, Gautam; Roberts, Lewis C. Jr.; Shao, Mike; Burruss, Rick; Cady, Eric; Oppenheimer, Ben R.; Brenner, Douglas; Zimmerman, Neil; Monnier, John D.; Crepp, Justin; Parry, Ian; Beichman, Charles; Soummer, Rémi


    We report low-resolution near-infrared spectroscopic observations of the eruptive star FU Orionis using the Integral Field Spectrograph (IFS) Project 1640 installed at the Palomar Hale telescope. This work focuses on elucidating the nature of the faint source, located 0.''5 south of FU Ori, and identified in 2003 as FU Ori S. We first use our observations in conjunction with published data to demonstrate that the two stars are indeed physically associated and form a true binary pair. We then proceed to extract J- and H-band spectro-photometry using the damped LOCI algorithm, a reduction method tailored for high contrast science with IFS. This is the first communication reporting the high accuracy of this technique, pioneered by the Project 1640 team, on a faint astronomical source. We use our low-resolution near-infrared spectrum in conjunction with 10.2 μm interferometric data to constrain the infrared excess of FU Ori S. We then focus on estimating the bulk physical properties of FU Ori S. Our models lead to estimates of an object heavily reddened, A V = 8-12, with an effective temperature of ∼4000-6500 K. Finally, we put these results in the context of the FU Ori N-S system and argue that our analysis provides evidence that FU Ori S might be the more massive component of this binary system.


    Pueyo, Laurent [Johns Hopkins University, Department of Physics and Astronomy, 366 Bloomberg Center 3400 N. Charles Street, Baltimore, MD 21218 (United States); Hillenbrand, Lynne; Hinkley, Sasha; Dekany, Richard; Roberts, Jenny [Department of Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Vasisht, Gautam; Roberts, Lewis C. Jr.; Shao, Mike; Burruss, Rick; Cady, Eric [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Oppenheimer, Ben R.; Brenner, Douglas; Zimmerman, Neil [American Museum of Natural History, Central Park West at 79th Street, New York, NY 10024 (United States); Monnier, John D. [Department of Astronomy, University of Michigan, 941 Dennison Building, 500 Church Street, Ann Arbor, MI 48109-1090 (United States); Crepp, Justin [Department of Physics, 225 Nieuwland Science Hall, University of Notre Dame, Notre Dame, IN 46556 (United States); Parry, Ian [University of Cambridge, Institute of Astronomy, Madingley Road, Cambridge, CB3, OHA (United Kingdom); Beichman, Charles [NASA Exoplanet Science Institute, 770 South Wilson Avenue, Pasadena, CA 91225 (United States); Soummer, Remi [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)


    We report low-resolution near-infrared spectroscopic observations of the eruptive star FU Orionis using the Integral Field Spectrograph (IFS) Project 1640 installed at the Palomar Hale telescope. This work focuses on elucidating the nature of the faint source, located 0.''5 south of FU Ori, and identified in 2003 as FU Ori S. We first use our observations in conjunction with published data to demonstrate that the two stars are indeed physically associated and form a true binary pair. We then proceed to extract J- and H-band spectro-photometry using the damped LOCI algorithm, a reduction method tailored for high contrast science with IFS. This is the first communication reporting the high accuracy of this technique, pioneered by the Project 1640 team, on a faint astronomical source. We use our low-resolution near-infrared spectrum in conjunction with 10.2 {mu}m interferometric data to constrain the infrared excess of FU Ori S. We then focus on estimating the bulk physical properties of FU Ori S. Our models lead to estimates of an object heavily reddened, A{sub V} = 8-12, with an effective temperature of {approx}4000-6500 K. Finally, we put these results in the context of the FU Ori N-S system and argue that our analysis provides evidence that FU Ori S might be the more massive component of this binary system.

  6. 5-FU-hydrogel inhibits colorectal peritoneal carcinomatosis and tumor growth in mice

    Wang, Yongsheng; Gong, Changyang; Yang, Li; Wu, Qinjie; Shi, Shuai; Shi, Huashan; Qian, Zhiyong; Wei, Yuquan


    Colorectal peritoneal carcinomatosis (CRPC) is a common form of systemic metastasis of intra-abdominal cancers. Intraperitoneal chemotherapy is a preferable option for colorectal cancer. Here we reported that a new system, 5-FU-loaded hydrogel system, can improve the therapeutic effects of intraperitoneal chemotherapy. A biodegradable PEG-PCL-PEG (PECE) triblock copolymer was successfully synthesized. The biodegradable and temperature sensitive hydrogel was developed to load 5-FU. Methylene blue-loaded hydrogel were also developed for visible observation of the drug release. The effects and toxicity of the 5-FU-hydrogel system were evaluated in a murine CRPC model. The hydrogel system is an injectable flowing solution at ambient temperature and forms a non-flowing gel depot at physiological temperature. 5-FU-hydrogel was subsequently injected into abdominal cavity in mice with CT26 cancer cells peritoneal dissemination. The results showed that the hydrogel delivery system prolonged the release of methylene blue; the 5-FU-hydrogel significantly inhibited the peritoneal dissemination and growth of CT26 cells. Furthermore, intraperitoneal administration of the 5-FU-hydrogel was well tolerated and showed less hematologic toxicity. Our data indicate that the 5-FU-hydrogel system can be considered as a new strategy for peritoneal carcinomatosis, and the hydrogel may provide a potential delivery system to load different chemotherapeutic drugs for peritoneal carcinomatosis of cancers

  7. Ezra Pound and Du Fu: Gazing at Mt. Tai

    Kent Su


    Full Text Available Confined to a six-by-six-foot outdoor steel cage, Ezra Pound saw a series of mountain hills from a few miles to the east of Pisa. The poet compared one of these small 800-metre hills to the sacred Chinese Mt. Tai, which becomes the most common geographical name in The Pisan Cantos. Pound’s poetic summoning of this particular mountain is related to the fact that Mt. Tai is historically and culturally connected to the philosophy of Confucius, who personally ascended the mountain several times. Pound, as a devout Confucian disciple, closely follows the philosophical doctrines and attempts to mentally trace the footsteps of Confucius. This paper will argue how Pound’s poetic evocation of the mountain shares a striking similarity to an eighth-century Chinese poem called “Gazing at Mt. Tai,” which was written by the famous literatus - Du Fu 杜甫(712 – 770 . In spite of living in two completely different eras and countries, Pound’s and Du Fu’s reference to Mt. Tai demonstrates the confluence of their poetic spirits. Neither of them ascended mountain personally. They instead made use of their poetic imagination to follow the paths of Confucius and perceived the mountain as an earthly paradise, one which represents tranquillity and serenity away from the moral and physical corruption of the external world.

  8. The Effect of 5-FU and Radiation on A549 Cells In Vitro

    Lee, Myung Za [Hanyang University College of Medicine, Seoul (Korea, Republic of); Chun, Ha Chong [Medical College of Virgina, Richmond (United States); Lee, Won Young [Yonsei University College of Medicine, Seoul (Korea, Republic of)


    Effects of ionizing radiation alone and combined with chemotherapy on tumor growth and it clonal specificity Monitored by changes in distribution of chromosome number were studies in A549 cell line originated from human adenocarcinoma of the lung. Radiation (300 rad, 600 rad and 900 rad) were delivered with or without 5-FU. Forty eight hours later, 57.5% of growth inhibition of cell was Seen in cells treated with 5-FU concentration of 0.47g/ml for 24 hr exposure. Cell survival carves after radiation with and without 5-FU were made. Chromosomal analysis of cells in metaphase in control, and in cells treated with 300 rad of radiation, or 0.47g/ml of 5-FU treatment, and combined treatment of cloth were 77ne to examine the changes in ploidy and number of chromosome. Radiation combined with 5-FU enhanced growth inhibition of A549 cells. However, no evidence of synergetic effects in growth inhibition was observed in the cells treated with the combination therapy. Pattern of chromosomal distribution of survived cells were shifted from hyperploidy to hypoploidy by single dose of radiation(300 rad). As radiation dose increased a large number of hypoploidy cells were observed. Following treatment of cells with 5-FU, chomosomal distribution of survived cells were also shifted to hypodiploidy, which were seen in cells treated with radiation. The cell treated with 5-FU and followed by radiation within 24 hrs had cell with increased number of hypodiploidy cells. Almost same type of chromosomal changes were reproduced in cells treated with combined treatment with radiation and 5-FU. Minor differences were that cells with fewer number of chromosome were more frequent in cells treated with combined therapy. Further increase in cells of hypoploidy(93%) having 1-10 chromosome were induced by additional radiation. Therefore, the enhanced therapeutic effect of 5-FU combined with radiation of A549 cells appeared to be additive rather than synergistic.

  9. Near fatal 5-FU gut toxicity post surgery--remarkable effect of high-dose sucralfate.

    Toh, James Wei Tatt; Morris, David; Chen, Zhuoran; Chen, Cindy


    The objective of this review article and case report was to investigate the effectiveness of high-dose sucralfate on severe life-threatening 5-fluorouracil (5-FU) gut toxicity, with reference to, but not limited to dihydropyrimidine dehydrogenase (DPD) deficiency. A search was conducted on PubMed from 1950 to July 2013 for original studies on 5-FU gut toxicity and sucralfate. Studies were limited to human trials and English language and all articles included in this study were assessed with the application of predetermined selection criteria. Each article was then reviewed independently by two reviewers. A case report from our own centre was included in this review. From 33 results, 6 manuscripts were identified including 4 randomized controlled trial. One trial evaluated the use of sucralfate to alleviate stomatitis in patients with 5-FU-based chemotherapy. The other three trials evaluated the role of sucralfate in radiation toxicity. There was one case report which showed gastroscopy confirmed normalization of severe dysplastic erosive gastroduodenitis attributed to hepatic arterial infusion of 5-FU following a 2-month course of sucralfate and cimetidine and one case series showing clinical and sigmoidoscopically demonstrated improvement in ulcerative colitis in majority of patients receiving sucralfate enemas. There was no current literature specifically focussed on the role of sucralfate in 5-FU gut toxicity. Our case report describes the clinical course and successful treatment with sucralfate of a patient with Pseudomyxoma peritonei (PMP) who experienced 5-FU gut toxicity resulting in life-threatening bleeding due to presumed DPD deficiency post intraperitoneal 5-FU administration. This review article showed a lack of literature concerning the use of sucralfate in 5-FU gut toxicity. In our patient's case, sucralfate had a crucial role in the management of near fatal 5-FU gut toxicity, and further evaluation is required.

  10. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Njoroge, E.G., E-mail: [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)


    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  11. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  12. Production test engineering in FE-I4 system-on-chip to boost the reliability and high-quality demands in IBL applications

    Zivkovic, V A; Porret, D


    The article addresses production test development effort of the ATLAS FE-I4 integrated circuit. This particular production test targets manufacturing faults in the ICs and has been taken as a supplementary approach, besides standard functional test, to further decrease the risk of potential application failures. The Design-for-Test structures inside the digital part of the chip, together with the specially devised top-level simulations enabled straightforward test development and debug in the production test environment. The production test itself has been commissioned to the external test company, with the supervision of the FE-I4 team at the test floor.

  13. Design of a detector to study associated charm production in the SHiP beam dump facility

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  14. [Professor Xu Fu-song's traditional Chinese medicine protocols for male diseases: A descriptive analysis].

    Liu, Cheng-yong; Xu, Fu-song


    To analyze the efficacy and medication principles of Professor Xu Fu-songs traditional Chinese medicine (TCM) protocols for male diseases. We reviewed and descriptively analyzed the unpublished complete medical records of 100 male cases treated by Professor Xu Fu-song with his TCM protocols from 1978 to 1992. The 100 cases involved 32 male diseases, most of which were difficult and complicated cases. The drug compliance was 95%. Each prescription was made up of 14 traditional Chinese drugs on average. The cure rate was 32% , and the effective rate was 85%. Professor Xu Fu-song advanced and proved some new theories and therapeutic methods. Professor Xu Fu-song's TCM protocols can be applied to a wide range of male diseases, mostly complicated, and are characterized by accurate differentiation of symptoms and signs, high drug compliance, and excellent therapeutic efficacy.

  15. Asynchronous Sensor fuSion for Improved Safety of air Traffic (ASSIST), Phase I

    National Aeronautics and Space Administration — SSCI proposes to develop, implement and test a collision detection system for unmanned aerial vehicles (UAV), referred to as the Asynchronous Sensor fuSion for...

  16. Identification of ALV-J associated acutely transforming virus Fu-J carrying complete v-fps oncogene.

    Wang, Yixin; Li, Jianliang; Li, Yang; Fang, Lichun; Sun, Xiaolong; Chang, Shuang; Zhao, Peng; Cui, Zhizhong


    Transduction of oncogenes by ALVs and generation of acute transforming viruses is common in natural viral infections. In order to understand the molecular basis for the rapid oncogenicity of Fu-J, an acutely transforming avian leukosis virus isolated from fibrosarcomas in crossbreed broilers infected with subgroup J avian leukosis virus (ALV-J) in China, complete genomic structure of Fu-J virus was determined by PCR amplification and compared with those of Fu-J1, Fu-J2, Fu-J3, Fu-J4, and Fu-J5 reported previously. The results showed that the genome of Fu-J was defective, with parts of gag gene replaced by the complete v-fps oncogene and encoded a 137 kDa Gag-fps fusion protein. Sequence analysis revealed that Fu-J and Fu-J1 to Fu-J5 were related quasi-species variants carrying different lengths of v-fps oncogenes generated from recombination between helper virus and c-fps gene. Comparison of virus carrying v-fps oncogene also gave us a glimpse of the molecular characterization and evolution process of the acutely transforming ALV.

  17. Tegafur Substitution for 5-Fu in Combination with Actinomycin D to Treat Gestational Trophoblastic Neoplasm.

    Mei Peng

    Full Text Available Although 5-fluorouracil (5-Fu combination chemotherapy provides a satisfactory therapeutic response in patients with gestational trophoblastic neoplasms (GTNs, it has severe side effects. The current study analyzed the therapeutic effects and side effects of tegafur plus actinomycin D (Act-D vs. 5-Fu plus Act-D for the treatment of GTNs based on controlled historical records. A total of 427 GTN cases that received tegafur and Act-D combination chemotherapy at the Second Xiangya Hospital of XiangYa Medical School between August 2003 and July 2013 were analyzed based on historical data. A total of 393 GTN cases that received 5-Fu plus Act-D between August 1993 and July 2003 at the same hospital were also analyzed, which constituted the control group. The therapeutic effects, toxicity and side effects after chemotherapy were compared between the groups. The overall response rate was 90.63% in the tegafur+Act-D group (tegafur group and 92.37% in the 5-Fu+Act-D group (5-Fu group; these rates were not significantly different (P > 0.05. However, the incidence rates of myelosuppression (white blood cell decline, gastrointestinal reactions (nausea, vomiting, dental ulcer, and diarrhea, skin lesions and phlebitis were lower in the tegafur group than in the 5-Fu group (P < 0.05. The results of this study may provide useful data for the clinical application of tegafur in GTN treatment.

  18. Characteristic patients with oral mucositis receiving 5-FU chemotherapy at Hasan Sadikin Hospital Bandung

    Syarifah Fatimah


    Full Text Available Introduction: Oral mucositis is an inflammatory reaction of oral mucous membrane that often appears in cancer patients due to the chemotherapeutic agents, such as 5-fluorouracil (5-FU. The aim of this study was to describe the characteristic patients who receive 5-FU and had oral mucositis. Methods: This study was conducted on 41 patients with cancer receiving 5-FU chemotherapy at Dr Hasan Sadikin Hospital Bandung. The data was retrieved through interviews to find out patient’s characteristic; nutritional status examination by using body mass index measurement; and oral examination. Severity level was determined by using National Cancer Institute’s Common Toxicity Criteria scale, and the level of pain was measured by Numeric Pain Intensity Rating scale. Results: This research have shown 60,98% patient with cancer had received 5-FU chemotherapy treatment, and 44% with poor nutritional status (underweight. Oral mucositis was only found at non-keratinised mucous. The finding of this study was patients that receiving 5-FU chemotherapy treatment diagnosed with oral mucositis was on the 1st stadium (52% and the 2nd stadium (44% with the level of pain was on the mild level (48% and moderate level (32%.Conclusion: Oral mucositis was found on patients with cancer that received 5-FU chemotherapy with a variety of characteristics, nutritional statuses, locations, levels of severity and pain.

  19. ν{sub τ}-physics with the SHiP experiment

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)


    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  20. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel


    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  1. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    SHiP Collaboration


    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  2. Study of nu-tau properties with the SHiP experiment


    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  3. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  4. Feições Oceanográficas em Imagens MODIS na Condição de Sunglint: Exemplos para a Costa Sudeste Brasileira

    Lucas Barbedo de Freitas

    Full Text Available Resumo Imagens ópticas e no infravermelho-próximo adquiridas por sensores remotos em condição de reflexão especular bidirecional entre o sol, a superfície do mar e o sensor (condição de sunglint podem ser utilizadas para identificar filmes, feições, processos oceanográficos e meteorológicos atuantes sobre a superfície marinha. Imagens do sensor orbital Moderate Resolution Imaging Spectroradiometer (MODIS em condição de sunglint na plataforma continental sudeste brasileira foram processadas e analisadas, permitindo identificar feições como a borda Oeste da Corrente do Brasil, meandramentos e vórtices de mesoescala, ondas internas solitárias, rolos atmosféricos e filmes superficiais de origem biogênica e mineral. Uma correção atmosférica mais apropriada para detecção de feições no sunglint é aprensentada, assim como, detalhes sobre a geometria de aquisição. A dependência geométrica do sunglint torna sua ocorrência mais favorável entre outubro e fevereiro na região de estudo quando ocorrem zênites solares mais propícios. Os mecanismos e processos que permitem identificar estas feições no sunglint foram descritos e ilustrados. A partir deste entendimento, as complexas feições identificadas podem ser interpretadas e aplicadas na oceanografia operacional e detecção de vazamentos de óleo na superfície do mar, bem como, para melhorar nosso entendimento sobre os processos físicos e biológicos do meio marinho.

  5. Galactosylated nanostructured lipid carriers for delivery of 5-FU to hepatocellular carcinoma.

    Varshosaz, Jaleh; Hassanzadeh, Farshid; Sadeghi, Hojjat; Khadem, Mostafa


    The aim of the present study was to design a targeted delivery system of 5-fluorouracil (5-FU) for hepatocellular carcinoma (HCC). Lactobionic acid (LB) was conjugated to stearyl amine (SA) by a chemical reaction. The nanostructured lipid carriers (NLCs), containing LB conjugate, lecithin, glyceryl monostearate, oil [oleic acid (OA) or Labrafac 5 or 10%], and 5-FU, were dissolved in alcohol/acetone, the oil phase was added to the aqueous phase containing Tween 80 or Solutol(®) HS15 (0.25 or 0.5%), and NLCs were prepared by an emulsification-solvent diffusion method. Physical properties and drug release were studied in NLCs. The thiazolyl blue tetrazolium bromide assay was used to study the cytotoxicity of NLCs on HepG(2) cells, and the cellular uptake of NLCs was determined by flow cytometry. Fourier transform infrared spectroscopy and (1)H-NMR spectra confirmed the successful conjugation of LB and SA. The optimized NLCs consisted of 0.5% Solutol HS15 and 10% OA oil. The particle size of these nanoparticles was 139.2 nm, with a zeta potential of -18 mV, loading efficiency of 34.2%, release efficiency after 2 hours of the release test was 72.6%, and crystallinity was 0.63%. The galactosylated NLCs of 5-FU were cytotoxic on the HepG(2) cell line in a half concentration of 5-FU and seems promising in reducing 5-FU dose in HCC.

  6. Overview of the Fusion Z-Pinch Experiment FuZE

    Weber, T. R.; Shumlak, U.; Nelson, B. A.; Golingo, R. P.; Claveau, E. L.; McLean, H. S.; Tummel, K. K.; Higginson, D. P.; Schmidt, A. E.; UW/LLNL Team


    Previously, the ZaP device, at the University of Washington, demonstrated sheared flow stabilized (SFS) Z-pinch plasmas. Instabilities that have historically plagued Z-pinch plasma confinement were mitigated using sheared flows generated from a coaxial plasma gun of the Marshall type. Based on these results, a new SFS Z-pinch experiment, the Fusion Z-pinch Experiment (FuZE), has been constructed. FuZE is designed to investigate the scaling of SFS Z-pinch plasmas towards fusion conditions. The experiment will be supported by high fidelity physics modeling using kinetic and fluid simulations. Initial plans are in place for a pulsed fusion reactor following the results of FuZE. Notably, the design relies on proven commercial technologies, including a modest discharge current (1.5 MA) and voltage (40 kV), and liquid metal electrodes. Supported by DoE FES, NNSA, and ARPA-E ALPHA.

  7. Treating malfunction filtering bleb with repeated needling combined with adjunctive 5-FU after glaucoma filtration surgery

    Yi Liu


    Full Text Available AIM: To evaluate the therapeutic efficacy of a repeated bleb needling technique combined with subconjunctival injection of 5-FU in eyes with previous glaucoma surgery that had malfunctional filtering blebs. METHODS: A retrospective review of 34 consecutive patients(34 eyesof repeated bleb needling combined with subconjunctival injection of 5-FU in eyes, which had malfunctional filtering blebs after previous glaucoma surgery in our hospital from March 2009 to February 2013 was performed. The intraocular pressures(IOP, shapes of filtering blebs and complications after surgery were analyzed. RESULTS: There was significant reduction of mean IOP from 35.51mmHg to 14.43mmHg(PCONCLUSION: Repeated needling with adjunctive 5-FU proved a highly effective, safe alternative to treat malfunctional filtering blebs after previous glaucoma surgery.

  8. Evolutionism through Chinese Eyes: Yan Fu, Ma Junwu and Their translations of Darwinian Evolutionism

    Tsing-song Vincent Shen


    Full Text Available The huge impact that Darwinian Evolutionism has effected over Chinese intellectuals through Yan Fu's translation of Huxley's "Evolution and Ethics" into the Tianyanlun, is in fact based on Chinese traditional worldview on the one hand and the novel ideas it brings to the Chinese mind facing the challenge of transition. However, Yan Fu's translation is not as scientific as it should be when dealing with Huxley's discourse. Ma Junwu's translation of Darwin's "On the Origin of Species" attempts to be more scientific, in an effort to supply exact scientific terms and discourse in Chinese. However, at the end it is social Darwinism that has won the mind of the Chinese people. This paper analyses the ideas in Chinese past that leads to Chinese perception of Darwimism evolutionism and examines the ways it has been translated by Yan Fu and Ma Junwu.  

  9. Network pharmacology-based identification of key pharmacological pathways of Yin–Huang–Qing–Fei capsule acting on chronic bronchitis

    Yu GH


    Full Text Available Guohua Yu,1,2,* Yanqiong Zhang,2,* Weiqiong Ren,3 Ling Dong,1 Junfang Li,2,4 Ya Geng,2,5 Yi Zhang,2 Defeng Li,2 Haiyu Xu,2 Hongjun Yang2 1School of Chinese Materia Medica, Beijing University of Chinese Medicine, 2Institute of Chinese Materia Medica, China Academy of Chinese Medical Sciences, Beijing, 3The First Affiliated Hospital of Hunan University of Traditional Chinese Medicine, Changsha, 4School of Chinese Materia Medica, Tianjin University of Traditional Chinese Medicine, Tianjin, 5School of Basic Medicine, Shandong University of Chinese Medicine, Jinan, China *These authors contributed equally to this work Abstract: For decades in China, the Yin–Huang–Qing–Fei capsule (YHQFC has been widely used in the treatment of chronic bronchitis, with good curative effects. Owing to the complexity of traditional Chinese herbal formulas, the pharmacological mechanism of YHQFC remains unclear. To address this problem, a network pharmacology-based strategy was proposed in this study. At first, the putative target profile of YHQFC was predicted using MedChem Studio, based on structural and functional similarities of all available YHQFC components to the known drugs obtained from the DrugBank database. Then, an interaction network was constructed using links between putative YHQFC targets and known therapeutic targets of chronic bronchitis. Following the calculation of four topological features (degree, betweenness, closeness, and coreness of each node in the network, 475 major putative targets of YHQFC and their topological importance were identified. In addition, a pathway enrichment analysis based on the Kyoto Encyclopedia of Genes and Genomes pathway database indicated that the major putative targets of YHQFC are significantly associated with various pathways involved in anti-inflammation processes, immune responses, and pathological changes caused by asthma. More interestingly, eight major putative targets of YHQFC (interleukin [IL]-3, IL-4, IL

  10. High response rates following paclitaxel/5-FU and simultaneous radiotherapy in advanced head and neck carcinoma

    Schroeder, M.; Westerhausen, M.; Makoski, H.B.; Sesterhenn, K.; Schroeder, R.


    The main stay of treatment for head and neck cancer patients with advanced disease has been chemotherapy with Cisplatin/5-FU and simultaneous applied radiotherapy. With this multimodality treatment including radical surgery after two cycles of neoadjuvant chemotherapy and 40 Gy radiotherapy we reported 60% complete remission after 5 years for patients with stage III/IV of head and neck cancer. Paclitaxel, a new plant product, has demonstrated significant antineoplastic activity in head and neck tumors (ECOG-Study: 40% RR). Therefore we performed a trial with Taxol/5-FU and simultaneous radiation in a neoadjuvant and postoperative adjuvant setting of stage III/IV squamous cell carcinoma of the head and neck with pre-existent contraindication against Cisplatin. Patients and Methods: 30 patients with a primarily inoperable stage III/IV of SCC of the head and neck were enrolled to receive day 1 and 29 Taxol 175 mg/m 2 as a 3-hour-infusion, followed by 120-hour-cvi of 1000 mg/m 2 /d 5-FU. Locally irradiation was given ad 40 Gy (2 Gy/d/day 1-26). Radical surgery followed about day 56. Postoperatively patients received again 2 cycles of Taxol/5-FU and simultaneous irradiation with 30 Gy. Results: So far 30 patients were treated and all patients reached a CR after complete treatment, ongoing for 23/30 patients for 6 till 34 months: 4 patients developed a second neoplasia, and 3 patients gloved a local relapse. The principal toxicity was moderate (neutropenia, peripheral neuropathy, arthralgia/myalgia) and sensible with supportive care (e.g. PEG). Conclusions: The results suggest that the treatment of SCC of the head and neck with Taxol/5-FU and simultaneous radiation and radical surgery is a highly effective schedule and comparable with the treatment with Cisplatin/5-FU. (orig.) [de

  11. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Xiao, Mei-Hua; Sun, Wen-Zhong


    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  12. SHiP: a new facility to search for heavy neutrinos and study $\

    De Serio, Marilisa


    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  13. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Liu, F W


    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  14. Etude linguistique chez les Baráshi/Banyaambo du Rwanda


    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  15. Development of n+-in-p planar pixel quadsensor flip-chipped with FE-I4 readout ASICs

    Unno, Y.; Hanagaki, K.; Hori, R.; Ikegami, Y.; Nakamura, K.; Takubo, Y.; Kamada, S.; Yamamura, K.; Yamamoto, H.; Takashima, R.; Tojo, J.; Kono, T.; Nagai, R.; Saito, S.; Sugibayashi, K.; Hirose, M.; Jinnouchi, O.; Sato, S.; Sawai, H.; Hara, K.


    We have developed flip-chip modules applicable to the pixel detector for the HL-LHC. New radiation-tolerant n + -in-p planar pixel sensors of a size of four FE-I4 application-specific integrated circuits (ASICs) are laid out in a 6-in wafer. Variation in readout connection for the pixels at the boundary of ASICs is implemented in the design of quadsensors. Bump bonding technology is developed for four ASICs onto one quadsensor. Both sensors and ASICs are thinned to 150 μm before bump bonding, and are held flat with vacuum chucks. Using lead-free SnAg solder bumps, we encounter deficiency with large areas of disconnected bumps after thermal stress treatment, including irradiation. Surface oxidation of the solder bumps is identified as a critical source of this deficiency after bump bonding trials, using SnAg bumps with solder flux, indium bumps, and SnAg bumps with a newly-introduced hydrogen-reflow process. With hydrogen-reflow, we establish flux-less bump bonding technology with SnAg bumps, appropriate for mass production of the flip-chip modules with thin sensors and thin ASICs.

  16. Evaluation of 5-FU pharmacokinetics in cancer patients with DPD deficiency using a Bayesian limited sampling strategy

    Van Kuilenburg, A.; Hausler, P.; Schalhorn, A.; Tanck, M.; Proost, J.H.; Terborg, C.; Behnke, D.; Schwabe, W.; Jabschinsky, K.; Maring, J.G.

    Aims: Dihydropyrimidine dehydrogenase (DPD) is the initial enzyme in the catabolism of 5-fluorouracil (5FU) and DPD deficiency is an important pharmacogenetic syndrome. The main purpose of this study was to develop a limited sampling strategy to evaluate the pharmacokinetics of 5FU and to detect

  17. Relationship between pharmacokinetics of 5-FU in plasma and in saliva, and toxicity of 5-fluorouracil/folinic acid

    Jansman, FGA; Coenen, JLLM; De Graaf, JC; Tobi, H; Sleijfer, DT; Brouwers, JRBJ


    Background: Dose adaptation based on pharmacokinetic parameters has been shown to decrease toxicity of some 5-fluorouracil(5-FU)-based continuous infusion regimens. Patients and Methods: In the present study the relationship between 5-FU pharmacokinetics in plasma and in saliva, and toxicity was

  18. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Theall-Honey, Laura A; Schmidt, Louis A


    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  19. MTHFR polymorphisms and 5-FU-based adjuvant chemotherapy in colorectal cancer

    Afzal, Shoaib; Jensen, S; Vainer, B


    Methylenetetrahydrofolate reductase is a pivotal enzyme in folate metabolism and 5-fluorouracil (5-FU) cytotoxicity. Two common single-nucleotide polymorphisms (SNPs), MTHFR 677C>T (rs1801133) and 1298A>C (rs1801131), reduce enzyme activity. Initially, these SNPs were claimed to predict clinical...

  20. [Mining analysis on composition and medication of menstruation prescriptions in Fu Qingzhu's Obstetrics and Gynecology].

    Zhu, Jia-qing; Che, Yu-xia


    In this paper, menstruation prescriptions were selected from "Fu Qingzhu's Obstetrics and Gynecology" and analyzed by using GRI algorithm, correlation analysis, hierarchical clustering method through SPSS, Clementine and traditional Chinese medicine (TCM) inheritance auxiliary systems, in order to screen out 15 menopathy prescriptions, which involve 45 traditional Chinese medicine herbs. In the study, blood-tonifying and qi-tonifying herbs were found to be frequent in the prescriptions. The most frequent single herb was white paeony root, accounting for 9.6% in the total number of prescriptions; The most frequent herb pairs were white paeony root-radix rehmanniae preparata and paeony root-angelica sinensis. Among Fu Shan's menopathy prescriptions, 61 herbal pairs showed a correlation coefficient exceeding 0.05, which evolved into 16 pairs of core combinations. The analysis showed that menopathy prescriptions in volume 1 of "Fu Qingzhu's Obstetrics and Gynecology" focused on tonic traditional Chinese medicines involving liver, spleen and kidney and were adjusted according to changes in qi, blood, cold, hot and wet, which could provide a specific reference for further studies on Fu Shan's academic thoughts and traditional Chinese medicine clinical treatment of menopathy.

  1. The FU Orionis outburst as a thermal accretion event: Observational constraints for protostellar disk models

    Bell, K. R.; Lin, D. N. C.; Hartmann, L. W.; Kenyon, S. J.


    The results of the time-dependent disk models developed in Bell & Lin are compared with observed properties of FU Orionis variables. Specific models are fit to the light curves of Fu Ori, V1515 Cyg, and V1057 Cyg. The slow risetime of V1515 Cyg can be matched by a self-regulated outburst model. The rapid risetimes of FU Ori and V1057 Cyg can be fitted with the application of modest perturbations to the disk surface density. Model disks display spectral features characteristic of observed objects. The color evolution of V1057 Cyg is naturally explained if mass flux drops in the inner disk (r less than 1/4 AU) while remaining steady in the outer disk. The decrease in optical line width (rotational velocity) observed during the decay of V1057 Cyg may be accounted for by an outward-propagating ionization front. We predict that before final decay to the quiescent phase, short-wavelength line widths (lambda less than 1.5 microns) will again increase. It is suggested that FU Orionis outbursts primarily occur to systems during the embedded phase with ages less than several times 10(exp 5) yr.

  2. The cardiovascular responses of male subjects to kung fu techniques. Expert/novice paradigm.

    Jones, M A; Unnithan, V B


    The primary aim was to assess cardiovascular responses of expert and novice subjects to kung fu techniques. It was hypothesised that experienced subjects would demonstrate improved economy of movement during the techniques, evidenced by reduced exercise intensity. a comparative design was established utilising two groups; experienced (group E), and novice (group N). the experimentation took place under laboratory conditions, but was designed to maximise external validity. the only preselection variables were regular attendance at training and experience. Nine experienced males (group E, exp 9.5 +/- 5.2 yrs) and nine novice males (group N, exp 1.2 +/- 0.1 yrs) participated. The only exclusion guidelines were contraindications to participate within a maximal test, no subjects were excluded upon this basis. N/A. each subject participated in three kung fu protocols (forms, kicking and punching). Each protocol, randomly allocated, consisted of ten work (30 sec) and ten rest periods (30 sec). MEASURES taken during the protocols were heart rate (HR) and oxygen consumption (VO2). These were expressed as a percentage of maximal values to reflect exercise intensity. During both the form protocol and punching protocol group E were found to be working at a significantly (p kung fu techniques differ depending upon experience level. It is difficult to directly relate this to improved economy since work output could not be accurately quantified. It was also found that kung fu protocols elicited exercise intensity into the cardiovascular training zone.

  3. FuGeF: A Resource Bound Secure Forwarding Protocol for Wireless Sensor Networks.

    Umar, Idris Abubakar; Mohd Hanapi, Zurina; Sali, A; Zulkarnain, Zuriati A


    Resource bound security solutions have facilitated the mitigation of spatio-temporal attacks by altering protocol semantics to provide minimal security while maintaining an acceptable level of performance. The Dynamic Window Secured Implicit Geographic Forwarding (DWSIGF) routing protocol for Wireless Sensor Network (WSN) has been proposed to achieve a minimal selection of malicious nodes by introducing a dynamic collection window period to the protocol's semantics. However, its selection scheme suffers substantial packet losses due to the utilization of a single distance based parameter for node selection. In this paper, we propose a Fuzzy-based Geographic Forwarding protocol (FuGeF) to minimize packet loss, while maintaining performance. The FuGeF utilizes a new form of dynamism and introduces three selection parameters: remaining energy, connectivity cost, and progressive distance, as well as a Fuzzy Logic System (FLS) for node selection. These introduced mechanisms ensure the appropriate selection of a non-malicious node. Extensive simulation experiments have been conducted to evaluate the performance of the proposed FuGeF protocol as compared to DWSIGF variants. The simulation results show that the proposed FuGeF outperforms the two DWSIGF variants (DWSIGF-P and DWSIGF-R) in terms of packet delivery.

  4. "Welch Schauspiel! Aber ach! ein Schauspiel : Fußball und Theater

    Thiergen, Peter


    Der Essay zeigt, wie eng Fußball und Schauspiel/Theater/Drama zusammenhängen. Dabei wird nicht nur einer Vielzahl von sprachlichen und insbesondere metaphorischen Entsprechungen nachgespürt, in denen sich die beiden Publikumsereignisse wechselseitig interpretieren, sondern auch gezeigt, auf welchen medialen Grundlagen, Erfahrungen und Rezeptionsdispositionen diese Entsprechungen beruhen.

  5. Wheat germ agglutinin-functionalised crosslinked polyelectrolyte microparticles for local colon delivery of 5-FU

    Glavas-Dodov,, Marija; Steffansen, Bente; Srcarevska, Maja


    We have previously reported the development and characterisation of wheat germ agglutinin (WGA)-functionalised chitosan-Ca-alginate (CTS-Ca-ALG) microparticles (MPs) loaded with acid-resistant particles of 5-fluorouracil (5-FU). In the present work, our goal was to evaluate the potential of these......We have previously reported the development and characterisation of wheat germ agglutinin (WGA)-functionalised chitosan-Ca-alginate (CTS-Ca-ALG) microparticles (MPs) loaded with acid-resistant particles of 5-fluorouracil (5-FU). In the present work, our goal was to evaluate the potential......-Ca-ALG MPs and WGA conjugates. The concentration of 5-FU associated with Caco-2 cells was significantly greater when delivered from MPs. By incorporation of 5-FU into MPs and further decoration with WGA, an increased [methyl-³H]thymidine uptake was observed few hours after continuous drug treatment followed...... by significantly reduced uptake after 6 h. Gastrointestinal distribution was in favour of increased localisation and concentration of the particles in colon region....

  6. SHiP: a new multipurpose beam-dump experiment at the SPS.



    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  7. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J


    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  8. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong


    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  9. Protective effect of dexamethasone on 5-FU-induced oral mucositis in hamsters.

    Ribeiro, Susana Barbosa; de Araújo, Aurigena Antunes; Araújo Júnior, Raimundo Fernandes de; Brito, Gerly Anne de Castro; Leitão, Renata Carvalho; Barbosa, Maisie Mitchele; Garcia, Vinicius Barreto; Medeiros, Aldo Cunha; Medeiros, Caroline Addison Carvalho Xavier de


    Oral mucositis (OM) is an important side effect of cancer treatment, characterized by ulcerative lesions in the mucosa of patients undergoing radiotherapy or chemotherapy, which has marked effects on patient quality of life and cancer therapy continuity. Considering that few protocols have demonstrated efficacy in preventing this side effect, the aim of this study was to examine the effect of dexamethasone (DEX) on OM induced by 5-fluorouracil (5-FU) in hamsters by studying signaling pathways. OM was induced in hamsters by 5-FU followed by mechanical trauma (MT) on day 4. On day 10, the animals were euthanized. The experimental groups included saline, MT, 5-FU, and DEX (0.25, 0.5, or 1 mg/kg). Macroscopic, histopathological, and immunohistochemical analyses as well as immunofluorescence experiments were performed on the oral mucosa of the animals. The oral mucosal samples were analyzed by enzyme-linked immunosorbent assays, and quantitative real-time polymerase chain reaction (qPCR). DEX (0.5 or 1 mg/kg) reduced inflammation and ulceration of the oral mucosa of hamsters. In addition, DEX (1 mg/kg) reduced the cytokine levels of tumor necrosis factor (TNF)-α, interleukin (IL)-1β, and macrophage migration inhibitory factor (MIF). DEX (1 mg/kg) also reduced the immunoexpression of cyclooxygenase (COX)-2, matrix metalloproteinase (MMP)-2, transforming growth factor (TGF)-β, MIF, Smad 2/3, Smad 2/3 phosphorylated and NFκB p65 in the jugal mucosa. Finally, DEX (1 mg/kg) increased interleukin-1 receptor-associated kinase 3 (IRAK-M), glucocorticoid-induced leucine zipper (GILZ), and mitogen-activated protein kinase (MKP1) gene expression and reduced NFκB p65 and serine threonine kinase (AKt) gene expression, relative to the 5-FU group. Thus, DEX improved OM induced by 5-FU in hamsters.

  10. Protective effect of dexamethasone on 5-FU-induced oral mucositis in hamsters.

    Susana Barbosa Ribeiro

    Full Text Available Oral mucositis (OM is an important side effect of cancer treatment, characterized by ulcerative lesions in the mucosa of patients undergoing radiotherapy or chemotherapy, which has marked effects on patient quality of life and cancer therapy continuity. Considering that few protocols have demonstrated efficacy in preventing this side effect, the aim of this study was to examine the effect of dexamethasone (DEX on OM induced by 5-fluorouracil (5-FU in hamsters by studying signaling pathways. OM was induced in hamsters by 5-FU followed by mechanical trauma (MT on day 4. On day 10, the animals were euthanized. The experimental groups included saline, MT, 5-FU, and DEX (0.25, 0.5, or 1 mg/kg. Macroscopic, histopathological, and immunohistochemical analyses as well as immunofluorescence experiments were performed on the oral mucosa of the animals. The oral mucosal samples were analyzed by enzyme-linked immunosorbent assays, and quantitative real-time polymerase chain reaction (qPCR. DEX (0.5 or 1 mg/kg reduced inflammation and ulceration of the oral mucosa of hamsters. In addition, DEX (1 mg/kg reduced the cytokine levels of tumor necrosis factor (TNF-α, interleukin (IL-1β, and macrophage migration inhibitory factor (MIF. DEX (1 mg/kg also reduced the immunoexpression of cyclooxygenase (COX-2, matrix metalloproteinase (MMP-2, transforming growth factor (TGF-β, MIF, Smad 2/3, Smad 2/3 phosphorylated and NFκB p65 in the jugal mucosa. Finally, DEX (1 mg/kg increased interleukin-1 receptor-associated kinase 3 (IRAK-M, glucocorticoid-induced leucine zipper (GILZ, and mitogen-activated protein kinase (MKP1 gene expression and reduced NFκB p65 and serine threonine kinase (AKt gene expression, relative to the 5-FU group. Thus, DEX improved OM induced by 5-FU in hamsters.

  11. Network pharmacology-based identification of key pharmacological pathways of Yin-Huang-Qing-Fei capsule acting on chronic bronchitis.

    Yu, Guohua; Zhang, Yanqiong; Ren, Weiqiong; Dong, Ling; Li, Junfang; Geng, Ya; Zhang, Yi; Li, Defeng; Xu, Haiyu; Yang, Hongjun


    For decades in China, the Yin-Huang-Qing-Fei capsule (YHQFC) has been widely used in the treatment of chronic bronchitis, with good curative effects. Owing to the complexity of traditional Chinese herbal formulas, the pharmacological mechanism of YHQFC remains unclear. To address this problem, a network pharmacology-based strategy was proposed in this study. At first, the putative target profile of YHQFC was predicted using MedChem Studio, based on structural and functional similarities of all available YHQFC components to the known drugs obtained from the DrugBank database. Then, an interaction network was constructed using links between putative YHQFC targets and known therapeutic targets of chronic bronchitis. Following the calculation of four topological features (degree, betweenness, closeness, and coreness) of each node in the network, 475 major putative targets of YHQFC and their topological importance were identified. In addition, a pathway enrichment analysis based on the Kyoto Encyclopedia of Genes and Genomes pathway database indicated that the major putative targets of YHQFC are significantly associated with various pathways involved in anti-inflammation processes, immune responses, and pathological changes caused by asthma. More interestingly, eight major putative targets of YHQFC (interleukin [IL]-3, IL-4, IL-5, IL-10, IL-13, FCER1G, CCL11, and EPX) were demonstrated to be associated with the inflammatory process that occurs during the progression of asthma. Finally, a molecular docking simulation was performed and the results exhibited that 17 pairs of chemical components and candidate YHQFC targets involved in asthma pathway had strong binding efficiencies. In conclusion, this network pharmacology-based investigation revealed that YHQFC may attenuate the inflammatory reaction of chronic bronchitis by regulating its candidate targets, which may be implicated in the major pathological processes of the asthma pathway.

  12. Anti-virus effect of traditional Chinese medicine Yi-Fu-Qing granule on acute respiratory tract infections.

    Li, Anyuan; Xie, Yanying; Qi, Fanghua; Li, Jie; Wang, Peng; Xu, Shulan; Zhao, Lin


    Yi-Fu-Qing granule is a traditional Chinese medicine for the treatment of acute respiratory tract infections. The present study sought to investigate the anti-virus effects of Yi-Fu-Qing granule on acute respiratory infections with respiratory syncytial virus (RSV) and human adenoviruses type 3 (Ad3). The cytotoxicity of Yi-Fu-Qing granule was evaluated by the neutral red assay on HeLa cells. The antiviral effect of Yi-Fu-Qing granule was tested by observing the cytopathogenic effect (CPE) with a compound mixture of Isatis leaf as the positive control drug. The results indicated that the highest non-toxicity concentration of Yi-Fu-Qing granule on Hela cells was 1:100. The CPE reduction assay showed that Yi-Fu-Qing granule inhibited RSV and Ad3 replication at a concentration of 1:100. Thus, Yi-Fu-Qing granule may have a significant antivirus effect on acute respiratory tract infections with RSV and Ad3 infections and this could prove useful for further antivirus research on acute respiratory tract infections.

  13. A mechanism for vertebrate Hedgehog signaling: recruitment to cilia and dissociation of SuFu-Gli protein complexes.

    Tukachinsky, Hanna; Lopez, Lyle V; Salic, Adrian


    In vertebrates, Hedgehog (Hh) signaling initiated in primary cilia activates the membrane protein Smoothened (Smo) and leads to activation of Gli proteins, the transcriptional effectors of the pathway. In the absence of signaling, Gli proteins are inhibited by the cytoplasmic protein Suppressor of Fused (SuFu). It is unclear how Hh activates Gli and whether it directly regulates SuFu. We find that Hh stimulation quickly recruits endogenous SuFu-Gli complexes to cilia, suggesting a model in which Smo activates Gli by relieving inhibition by SuFu. In support of this model, we find that Hh causes rapid dissociation of the SuFu-Gli complex, thus allowing Gli to enter the nucleus and activate transcription. Activation of protein kinase A (PKA), an inhibitor of Hh signaling, blocks ciliary localization of SuFu-Gli complexes, which in turn prevents their dissociation by signaling. Our results support a simple mechanism in which Hh signals at vertebrate cilia cause dissociation of inactive SuFu-Gli complexes, a process inhibited by PKA.

  14. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M


    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  15. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.


    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  16. Pre-operative combined 5-FU, low dose leucovorin, and sequential radiation therapy for unresectable rectal cancer

    Minsky, B.D.; Cohen, A.M.; Kemeny, N.; Enker, W.E.; Kelsen, D.P.; Schwartz, G.; Saltz, L.; Dougherty, J.; Frankel, J.; Wiseberg, J.


    The authors performed a Phase 1 trial to determine the maximum tolerated dose of combined pre-operative radiation (5040 cGy) and 2 cycles (bolus daily x 5) of 5-FU and low dose LV (20 mg/m2), followed by surgery and 10 cycles of post-operative LV/5-FU in patients with unresectable primary or recurrent rectal cancer. Twelve patients were entered. The initial dose of 5-FU was 325 mg/m2. 5-FU was to be escalated while the LV remained constant at 20 mg/m2. Chemotherapy began on day 1 and radiation on day 8. The post-operative chemotherapy was not dose escalated; 5-FU: 425 mg/m2 and LV: 20 mg/m2. The median follow-up was 14 months (7--16 months). Following pre-operative therapy, the resectability rate with negative margins was 91% and the pathologic complete response rate was 9%. For the combined modality segment (preoperative) the incidence of any grade 3+ toxicity was diarrhea: 17%, dysuria: 8%, mucositis: 8%, and erythema: 8%. The median nadir counts were WBC: 3.1, HGB: 8.8, and PLT: 153000. The maximum tolerated dose of 5-FU for pre-operative combined LV/5-FU/RT was 325 mg/m2 with no escalation possible. Therefore, the recommended dose was less than 325 mg/m2. Since adequate doses of 5-FU to treat systemic disease could not be delivered until at least 3 months (cycle 3) following the start of therapy, the authors do not recommend that this 5-FU, low dose LV, and sequential radiation therapy regimen be used as presently designed. However, given the 91% resectability rate they remain encouraged with this approach. 31 refs., 1 fig., 2 tabs

  17. First reliability test of a surface micromachined microengine using SHiMMeR

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others


    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  18. Tai Chi and Kung-Fu practice maintains physical performance but not vascular health in young versus old participants.

    McAnulty, Steven; McAnulty, Lisa; Collier, Scott; Souza-Junior, Tacito P; McBride, Jeffrey


    Kung-Fu and Tai Chi along with other martial arts are gaining popularity but studies examining the benefits of martial arts on physical fitness, vascular health, nutrition, and psychological wellness are limited. Aging is associated with declines in these health components. The objectives of this study were to examine whether Tai Chi and Kung-Fu training would maintain physical fitness, vascular health, and psychological wellness components on older versus younger practitioners. Seventeen subjects were recruited and divided into Young (age Kung-Fu maintains physical fitness in older compared to younger practitioners. However, age associated changes in cardiovascular stiffness, systolic blood pressure, and pain were not prevented.

  19. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J


    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  20. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  1. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti


    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  2. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)


    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  3. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Leandro H. Estornell


    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  4. The AKARI FU-HYU galaxy evolution program: first results from the GOODS-N field

    Pearson, C. P.; Serjeant, S.; Negrello, M.; Takagi, T.; Jeong, W.-S.; Matsuhara, H.; Wada, T.; Oyabu, S.; Lee, H. M.; Im, M. S.


    The AKARI FU-HYU mission program carried out mid-infrared imaging of several well studied Spitzer fields preferentially selecting fields already rich in multi-wavelength data from radio to X-ray wavelengths filling in the wavelength desert between the Spitzer IRAC and MIPS bands. We present the initial results for the FU-HYU survey in the GOODS-N field. We utilize the supreme multiwavelength coverage in the GOODS-N field to produce a multiwavelength catalogue from infrared to ultraviolet wavelengths, containing more than 4393 sources, including photometric redshifts. Using the FU-HYU catalogue we present colour-colour diagrams that map the passage of PAH features through our observation bands. We find that the longer mid-infrared bands from AKARI (IRC-L18W 18 micron band) and Spitzer (MIPS24 24 micron band) provide an accurate measure of the total MIR emission of the sources and therefore their probable total mid-infrared luminosity. We also find that colours incorporating the AKARI IRC-S11 11 micron band produce a bimodal distribution where an excess at 11 microns preferentially selects moderate redshift star-forming galaxies. These powerful colour-colour diagnostics are further used as tools to extract anomalous colour populations, in particular a population of Silicate Break galaxies from the GOODS-N field showing that dusty starbursts can be selected of specific redshift ranges (z = 1.2-1.6) by mid-infrared drop-out techniques. The FU-HYU catalogue will be made publically available to the astronomical community.

  5. How Can Asian Snack FuLoi Plan Successful Entering to Greater Helsinki Area? : Market research

    Nguyen, Loc


    This thesis introduces the significant factors of market research and its importance when considering doing international business. Furthermore, it could be useful for investors who have same favour to enter Finnish market. The case company is Asian Snack FuLoi- a German food industry company looking for new market. The goal of this study was to investigate the possibility for a company to enter Finland in general and Greater Helsinki in particular. The thesis was structured with theor...


    Green, Joel D.; Evans, Neal J. II; Merello, Manuel [Department of Astronomy, The University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, TX 78712-1205 (United States); Kospal, Agnes [European Space Agency (ESA/ESTEC), Keplerlaan 1, 2200-AG Noordwijk (Netherlands); Herczeg, Gregory [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Quanz, Sascha P. [Institute for Astronomy, ETH Zurich, Wolfgang-Pauli-Strasse 27, CH-8093 Zurich (Switzerland); Henning, Thomas; Bouwman, Jeroen [Max Planck Institute for Astronomy, Koenigstuhl 17, D-69117 Heidelberg (Germany); Van Kempen, Tim A. [Leiden Observatory, Leiden University, P.O. Box 9513, 2300-RA Leiden (Netherlands); Lee, Jeong-Eun [Department of Astronomy and Space Science, Kyung Hee University, Gyeonggi 446-701 (Korea, Republic of); Dunham, Michael M. [Department of Astronomy, Yale University, New Haven, CT (United States); Meeus, Gwendolyn [Departamento de Fisica Teorica, Universidad Autonoma de Madrid, Campus Cantoblanco (Spain); Chen, Jo-hsin [Jet Propulsion Laboratory, Pasadena, CA (United States); Guedel, Manuel; Liebhart, Armin [Department of Astrophysics, University of Vienna (Austria); Skinner, Stephen L., E-mail: [Center for Astrophysics and Space Astronomy (CASA), University of Colorado, Boulder, CO 80309-0389 (United States)


    We present Herschel-HIFI, SPIRE, and PACS 50-670 {mu}m imaging and spectroscopy of six FU Orionis-type objects and candidates (FU Orionis, V1735 Cyg, V1515 Cyg, V1057 Cyg, V1331 Cyg, and HBC 722), ranging in outburst date from 1936 to 2010, from the 'FOOSH' (FU Orionis Objects Surveyed with Herschel) program, as well as ancillary results from Spitzer Infrared Spectrograph and the Caltech Submillimeter Observatory. In their system properties (L{sub bol}, T{sub bol}, and line emission), we find that FUors are in a variety of evolutionary states. Additionally, some FUors have features of both Class I and II sources: warm continuum consistent with Class II sources, but rotational line emission typical of Class I, far higher than Class II sources of similar mass/luminosity. Combining several classification techniques, we find an evolutionary sequence consistent with previous mid-IR indicators. We detect [O I] in every source at luminosities consistent with Class 0/I protostars, much greater than in Class II disks. We detect transitions of {sup 13}CO (J{sub up} of 5-8) around two sources (V1735 Cyg and HBC 722) but attribute them to nearby protostars. Of the remaining sources, three (FU Ori, V1515 Cyg, and V1331 Cyg) exhibit only low-lying CO, but one (V1057 Cyg) shows CO up to J = 23 {yields} 22 and evidence for H{sub 2}O and OH emission, at strengths typical of protostars rather than T Tauri stars. Rotational temperatures for 'cool' CO components range from 20 to 81 K, for {approx} 10{sup 50} total CO molecules. We detect [C I] and [N II] primarily as diffuse emission.

  7. Translation Methods Used In Writing Indonesian Subtitles Of “Kung Fu Panda Holiday”



    In Indonesia, western movies that are spoken in English make the need for Indonesian subtitles increase. To make subtitles in different language, translation has an important role. The translator must use appropriate methods to produce good translation. This study aims to find out the kinds of translation methods used in writing Indonesian subtitles of the movie “Kung Fu Panda Holiday” by using Newmark's theory (1988). This study uses descriptive qualitative approach with document analysis. T...

  8. Translasi Pencak Silat Kedalam Film Animasi (Studi Kasus Film Kung Fu Panda)

    Riyo Ramadhan; Hafiz Aziz Ahmad; Alvanov Z. Mansoor


    Sebagai tradisi yang telah membudaya dari sejak zaman dahulu kala, pencak silat lahir sebagai benteng kekuatan pertahanan diri sekaligus menjadi seni yang memperkaya khazanah kebudayaan bangsa Indonesia. Namun, kuatnya terpaan kebudayaan seni bela diri impor yang masuk (karate, kung fu, tae kwon do, muay thai, capoeira, dll), yang selalu didukung dengan berbagai kemasan media entertainment modern, membuat silat menjadi kalah populer bahkan di mata dan persepsi masyarakat Indonesia sendiri. Ha...

  9. Posmodernisme Dalam Novel Generation X: Tales For Accelerated Culture Dan Bilangan Fu

    Azmi, Nurul Nayla


    This research is entitled Postmodernism in Novel Generation X: Tale of Accelerated Culture and Bilangan Fu which analyze postmodernism as the concept in both novel. As generally known, that the fast growing of recent life has effecting the human’s life that change continuity started from traditional, modern and then to the latest which postmodernism. In the changing of each stage, human life also encounters the changing which may seen from happening social phenomenon. In the stage of postmo...

  10. Treatment results of chemoradiotherapy with 5-FU/CDGP for head and neck cancer

    Himei, Kengo; Katayama, Norihisa; Takemoto, Mitsuhiro; Kuroda, Masahiro; Nomiya, Shigenobu; Onoda, Tomoo; Tominaga, Susumu; Kanazawa, Susumu


    We investigated the safety and efficacy of alternative and concurrent chemoradiotherapy with 5-fluorouracil (FU)/nedaplatin (CDGP) for head and neck cancer. From January 2003 to August 2005, 19 patients with head and neck squamous cell carcinoma were treated in our institution. Alternative chemoradiotherapy (ACRT) was performed for 8 cases of nasopharyngeal cancer. Concurrent chemoradiotherapy (CCRT) was performed for 11 cases of other head and neck cancer. Median total dose of radiotherapy was 63 Gy. ACRT consisted of 5-FU at a dose of 500 mg/m 2 on days 1-5 and 28-32 and CDGP at a dose of 60 mg/m 2 on days 6 and 33. CCRT consisted of 5-FU at a dose of 500 mg/m 2 on days 1-4 and 28-31 and CDGP at a dose of 60 mg/m 2 on days 5 and 32. Median follow-up period was 13 months. CR+PR was admitted in five cases (63%) with ACRT, and in 9 cases (82%) with CCRT. Non-hematological adverse effects of grade 3 were admitted in eight cases (100%) of ACRT, and in 9 cases (82%) of CCRT. Chemoradiotherapy attained good results and non-hematological adverse effects were able to be managed by preserved treatment. (author)

  11. The Akt inhibitor ISC-4 synergizes with cetuximab in 5-FU-resistant colon cancer.

    Joshua E Allen

    Full Text Available Phenylbutyl isoselenocyanate (ISC-4 is an Akt inhibitor with demonstrated preclinical efficacy against melanoma and colon cancer. In this study, we sought to improve the clinical utility of ISC-4 by identifying a synergistic combination with FDA-approved anti-cancer therapies, a relevant and appropriate disease setting for testing, and biomarkers of response. We tested the activity of ISC-4 and 19 FDA-approved anticancer agents, alone or in combination, against the SW480 and RKO human colon cancer cell lines. A synergistic interaction with cetuximab was identified and validated in a panel of additional colon cancer cell lines, as well as the kinetics of synergy. ISC-4 in combination with cetuximab synergistically reduced the viability of human colon cancer cells with wild-type but not mutant KRAS genes. Further analysis revealed that the combination therapy cooperatively decreased cell cycle progression, increased caspase-dependent apoptosis, and decreased phospho-Akt in responsive tumor cells. The synergism between ISC-4 and cetuximab was retained independently of acquired resistance to 5-FU in human colon cancer cells. The combination demonstrated synergistic anti-tumor effects in vivo without toxicity and in the face of resistance to 5-FU. These results suggest that combining ISC-4 and cetuximab should be explored in patients with 5-FU-resistant colon cancer harboring wild-type KRAS.

  12. Fluorescence and computational studies of thymidine phosphorylase affinity toward lipidated 5-FU derivatives

    Lettieri, R.; D'Abramo, M.; Stella, L.; La Bella, A.; Leonelli, F.; Giansanti, L.; Venanzi, M.; Gatto, E.


    Thymidine phosphorylase (TP) is an enzyme that is up-regulated in a wide variety of solid tumors, including breast and colorectal cancers. It is involved in tumor growth and metastasis, for this reason it is one of the key enzyme to be inhibited, in an attempt to prevent tumor proliferation. However, it also plays an active role in cancer treatment, through its contribution in the conversion of the anti-cancer drug 5-fluorouracil (5-FU) to an irreversible inhibitor of thymidylate synthase (TS), responsible of the inhibition of the DNA synthesis. In this work, the intrinsic TP fluorescence has been investigated for the first time and exploited to study TP binding affinity for the unsubstituted 5-FU and for two 5-FU derivatives, designed to expose this molecule on liposomal membranes. These molecules were obtained by functionalizing the nitrogen atom with a chain consisting of six (1) or seven (2) units of glycol, linked to an alkyl moiety of 12 carbon atoms. Derivatives (1) and (2) exhibited an affinity for TP in the micromolar range, 10 times higher than the parent compound, irrespective of the length of the polyoxyethylenic spacer. This high affinity was maintained also when the compounds were anchored in liposomal membranes. Experimental results were supported by molecular dynamics simulations and docking calculations, supporting a feasible application of the designed supramolecular lipid structure in selective targeting of TP, to be potentially used as a drug delivery system or sensor device.

  13. Development of FuGO: An Ontology for Functional Genomics Investigations

    Whetzel, Patricia L.; Brinkman, Ryan R.; Causton, Helen C.; Fan, Liju; Field, Dawn; Fostel, Jennifer; Fragoso, Gilberto; Gray, Tanya; Heiskanen, Mervi; Hernandez-Boussard, Tina; Morrison, Norman; Parkinson, Helen; Rocca-Serra, Philippe; Sansone, Susanna-Assunta; Schober, Daniel; Smith, Barry; Stevens, Robert; Stoeckert, Christian J.; Taylor, Chris; White, Joe; Wood, Andrew


    The development of the Functional Genomics Investigation Ontology (FuGO) is a collaborative, international effort that will provide a resource for annotating functional genomics investigations, including the study design, protocols and instrumentation used, the data generated and the types of analysis performed on the data. FuGO will contain both terms that are universal to all functional genomics investigations and those that are domain specific. In this way, the ontology will serve as the “semantic glue” to provide a common understanding of data from across these disparate data sources. In addition, FuGO will reference out to existing mature ontologies to avoid the need to duplicate these resources, and will do so in such a way as to enable their ease of use in annotation. This project is in the early stages of development; the paper will describe efforts to initiate the project, the scope and organization of the project, the work accomplished to date, and the challenges encountered, as well as future plans. PMID:16901226

  14. The process of dissemination of kung fu in west – between sense of loss and inevitability loss of sense

    Fernando Dandoro Castilho Ferreira


    Full Text Available In this paper, we discuss aspects of the development process of Kung Fu in China and its subsequent spread to the West in the light of sociological theory of Norbert Elias. To meet this goal, we have structured the text into three parts. In the first, we present some elements of theory of Elias that are useful to study Kung Fu. In the second part of the article, in turn, bring some evidence about the Kung Fu diffusion process to the West, taking as a reading aid work “Shaolin Monastery” of Meir Shahar. The third and final part of the text, we suggest that the reception of Kung Fu in the West engenders a social process that combines elements of Chinese tradition and capitalist modernity, giving the practice a hybrid and ambiguous character.

  15. Cell Line Derived 5-FU and Irinotecan Drug-Sensitivity Profiles Evaluated in Adjuvant Colon Cancer Trial Data

    Buhl, Ida Kappel; Gerster, Sarah; Delorenzi, Mauro


    patients who benefitted from the addition of irinotecan to 5-FU, we used gene expression profiles based on cell lines and clinical tumor material. These profiles were applied to expression data obtained from pretreatment formalin fixed paraffin embedded (FFPE) tumor tissue from 636 stage III colon cancer...... patients enrolled in the PETACC-3 prospective randomized clinical trial. A 5-FU profile developed similarly was assessed by comparing the PETACC-3 cohort with a cohort of 359 stage II colon cancer patients who underwent surgery but received no adjuvant therapy. RESULTS: There was no statistically...... to identify colon cancer patients who may benefit from 5-FU, however, any biomarker predicting benefit for adjuvant 5-FU must be rigorously evaluated in independent cohorts. Given differences between the two study cohorts, the present results should be further validated....


    Miller, Adam A.; Poznanski, Dovi; Silverman, Jeffrey M.; Kleiser, Io K. W.; Cenko, S. Bradley; Bloom, Joshua S.; Filippenko, Alexei V.; Hillenbrand, Lynne A.; Kasliwal, Mansi M.; Ofek, Eran O.; Quimby, Robert M.; Covey, Kevin R.; Rojas-Ayala, Barbara; Muirhead, Philip S.; Law, Nicholas M.; Dekany, Richard G.; Rahmer, Gustavo; Hale, David; Smith, Roger; Nugent, Peter


    We present pre- and post-outburst observations of the new FU Orionis-like young stellar object PTF 10qpf (also known as LkHα 188-G4 and HBC 722). Prior to this outburst, LkHα 188-G4 was classified as a classical T Tauri star (CTTS) on the basis of its optical emission-line spectrum superposed on a K8-type photosphere and its photometric variability. The mid-infrared spectral index of LkHα 188-G4 indicates a Class II-type object. LkHα 188-G4 exhibited a steady rise by ∼1 mag over ∼11 months starting in August 2009, before a subsequent more abrupt rise of >3 mag on a timescale of ∼2 months. Observations taken during the eruption exhibit the defining characteristics of FU Orionis variables: (1) an increase in brightness by ∼>4 mag, (2) a bright optical/near-infrared reflection nebula appeared, (3) optical spectra are consistent with a G supergiant and dominated by absorption lines, the only exception being Hα which is characterized by a P Cygni profile, (4) near-infrared spectra resemble those of late K-M giants/supergiants with enhanced absorption seen in the molecular bands of CO and H 2 O, and (5) outflow signatures in H and He are seen in the form of blueshifted absorption profiles. LkHα 188-G4 is the first member of the FU Orionis-like class with a well-sampled optical to mid-infrared spectral energy distribution in the pre-outburst phase. The association of the PTF 10qpf outburst with the previously identified CTTS LkHα 188-G4 (HBC 722) provides strong evidence that FU Orionis-like eruptions represent periods of enhanced disk accretion and outflow, likely triggered by instabilities in the disk. The early identification of PTF 10qpf as an FU Orionis-like variable will enable detailed photometric and spectroscopic observations during its post-outburst evolution for comparison with other known outbursting objects.

  17. High-Resolution Near-Infrared Spectroscopy of FU Orionis Objects

    Hartmann, Lee; Hinkle, Kenneth; Calvet, Nuria


    We present an analysis of recent near-infrared, high-resolution spectra of the variable FU Ori objects. During a phase of rapid fading in optical brightness during 1997, V1057 Cyg exhibited shell absorption in first-overtone (v''-v'=2-0) CO lines, blueshifted by about 50 km s-1 from the system velocity. This shell component had not been seen previously, nor was it present in 1999, although some blueshifted absorption asymmetry is seen at the latter epoch. The appearance of this CO absorption shell is connected with the roughly contemporaneous appearance of blueshifted, low-excitation optical absorption lines with comparable low velocities; we suggest that this shell was also responsible for some of the peculiar emission features seen in red-optical spectra of V1057 Cyg. FU Ori continues to exhibit broad CO lines, with some evidence for the double-peaked profiles characteristic of an accretion disk; the line profiles are consistent with previous observations. Both FU Ori and V1057 Cyg continue to exhibit lower rotational broadening at 2.3 μm than at optical wavelengths, in agreement with the prediction of differentially rotating disk models; we have a marginal detection of the same effect in V1515 Cyg. The relative population of the first-overtone CO rotational levels in the FU Ori objects suggests low excitation temperatures. We compare disk models to the observations and find agreement with overall line strengths and rotational broadening, but the observed line profiles are generally less double-peaked than predicted. We suggest that the discrepancy in line profiles is due to turbulent motions in FU Ori disks, an effect qualitatively predicted by recent simulations of the magnetorotational instability in vertically stratified accretion disks. Based on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy (AURA), Inc., under a cooperative agreement with the NSF, on behalf of the Gemini

  18. [Anti-tumor effect of 5-FU-PLLA-CNTs on human gastric carcinoma cell lines in vitro].

    Gu, Jun; Li, Maolan; Wu, Xiangsong; Wu, Wenguang; Zhang, Lin; Ding, Qichen; Yang, Jiahua; Weng, Hao; Ding, Qian; Bao, Runfa; Shu, Yijun; Liu, Yingbin


    To prepare cisPLLAtin-loaded polylactic acid/cnts, and to study the anti-tumor effect of 5-FU-PLLA-CNTs on human gastric carcinoma cell lines(MGC803 and MNK45). 5-FU-PLLA-CNTs were prepared with ultrasound emulsification. The morphology of 5-FU-PLLA-CNTs was determined by scanning electron microscope(SEM), and its drug loading and drug release curve in vitro were detected by UV-Vis-NIR spectrophotometer. Cells were divided into experiment, positive control and negative control groups. CCK8 method was used to test the cytotoxic effect of 5-FU-PLLA-CNTs in different concentrations on MGC803 and MNK45 cell proliferation. Flow cytometry was employed to measure the apoptotic rate of MGC803 and MNK45 cells before and after the intervention of 5-FU-PLLA-CNTs. Deep layer film of 5-FU-PLLA-CNTs was successfully established, whose drug-load rate was(4.54±0.43)%, entrapment rate was(21.56±2.36)%. In vitro release test showed release rate within 24 h of 5-FU-PLLA-CNTs was 23.9% in a as lowly increasing manner, and accumulating release rate was 85.3% at day 31. CCk8 experiment revealed, as compared to control group, 5-FU-PLLA-CNTs significantly inhibited the proliferation of two cell lines in dose-dependent and time-dependent manner. The best 5-FU-PLLA-CNTs concentration of inhibition for human gastric cancer cell lines was 1 mg/well. Flow cytometry indicated the apoptotic rate of MGC803 and MNK45 cells in experiment group treated by 1 mg/well 5-FU-PLLA-CNTs significantly increased as compared to negative control group (P0.05). The 5-FU-PLLA-CNTs has good drug sustained-release capacity, and can significantly kill and inhibit the proliferation of MGC803 and MNK45 cell lines.

  19. Drucken Images und mediale Diskurse über afrikanischen Fußball: Paternalismus, Rassismus und neoliberale Bewunderung

    Kurt Wachter


    Full Text Available Die Wahrnehmung des afrikanischen Fußballs und seiner Spieler war und ist sowohl in den Stadien wie in den medialen Darstellungen von rassistischen Images aus der Zeit Kolonialismus geprägt. Der speziell in Europa konstatierbare Aufstieg des afrikanischen Fußballs im Zuge der Ökonomisierung und Globalisierung des Spiels brachte zwar neue Superstars hervor, alte Stereotype leben aber vor Ort wie im medialen Diskurs in transformierter Weise fort.

  20. Feições Cársticas em Rochas Siliciclásticas no Oeste do Estado do Rio Grande do Sul – Brasil

    Luis Eduardo de Souza Robaina


    Full Text Available Na Bacia Hidrográfica do Ibicuí, localizada na região oeste-sudoeste do estado do Rio Grande do Sul, Brasil, ocorrem formas do terreno e mesmo associação de formas semelhantes àquelas de relevo cárstico, entretanto são produzidas por diferentes processos. Este artigo apresenta estudos desenvolvidos em feições de cavernas, típicas de relevo cárstico que se desenvolvem em rochas siliciclásticas da Bacia Sedimentar do Paraná. A origem morfogenética está relacionada com a evolução e aceleração de processos erosivos associado ao fluxo subterrâneo controlados por lineamentos estruturais e estratificação da rocha sedimentar. O mapeamento e estudo destas feições podem demonstrar a extensão e diversidade das formas tipo cársticas na área e contribuir para entender o modelo evolutivo das vertentes na área de estudo.

  1. Radio-chemo-therapy with 5FU and cisplatin for bladder cancer after TUR-bladder

    Schuchardt, U.; Birkenhake, S.; Leykam, S.; Martus, P.; Sauer, R.


    Purpose/Objective: To determine toxicity and efficacy of radio-chemo-therapy (RCT) with 5FU and cisplatin in patients with bladder cancer. Endpoints are initial response, cystectomy-rates and overall-survival. Materials and Methods: From 11/93 to 1/95 13 patients suffering from bladder cancer were first treated with TUR-bladder (TURB). Patient characteristics were as follows: Within 6 weeks after operation the pelvis was irradiated with 54.0 Gy (median) in conventional fractionation (10 MV photons 4-field-box). The bladder was boosted up to 59.4 Gy (median) in isocentric rotation technique. 7 patients were treated with 45 Gy paraaortal. During the first and 5th treatment week chemotherapy (CT) was simultaneously given: 800 mg/m 2* d CISPLATIN as bolus-infusion 30 min prior to RT. 2 months later a further TURB was performed for restaging. Cystectomy was recommended, if invasive cancer was found at this time. Acute hematological and gastrointestinal toxicity was recorded according to the WHO-criteria. Results: At least 81% (e.g. 75% of 2nd course) of CT was applied in 10/13 patients. Median doses were 3500 mg/m 2 5FU and 200 mg/m 2 CISPLATIN. Acute toxicity to bladder and bowel reached grade 2 WHO only. Hematotoxicity (median values) and results ar shown in the following table. Conclusion: Concomitant RCT with 5FU and CISPLATIN seems to be a promising modality for organ-preserving therapy of bladder cancer. Preliminary results show sufficient effect and acceptable toxicity. Since patient number is still low, further investigation is recommended

  2. A inserção do kung fu no Brasil na perspectiva dos mestres pioneiros

    Ferreira, Fernando Dandoro Castilho


    Resumo: Discutir atualmente a China e sua cultura parece algo bastante útil, principalmente em decorrência da sua posição econômica, que exerce uma impactante influência mundial. Para buscar trazer alguma luz sobre a China, fizemos uso de um marcante e elucidativo elemento de sua cultura, a sua arte marcial. Mais ainda, buscamos avançar neste processo tratando não do Kung Fu em seu berço de origem, mas sim, olhando-o em sua vertente contemporânea, oriunda do processo de disseminação deste em ...

  3. Electrochemical degradation of 5-FU using a flow reactor with BDD electrode: Comparison of two electrochemical systems.

    Ochoa-Chavez, A S; Pieczyńska, A; Fiszka Borzyszkowska, A; Espinoza-Montero, P J; Siedlecka, E M


    In this study, the electrochemical degradation process of 5-fluorouracil (5-FU) in aqueous media was performed using a continuous flow reactor in an undivided cell (system I), and in a divided cell with a cationic membrane (Nafion ® 424) (system II). In system I, 75% of 5-FU degradation was achieved (50 mg L -1 ) with a applied current density j app  = 150 A m -2 , volumetric flow rate qv = 13 L h -1 , after 6 h of electrolysis (k app  = 0.004 min -1 ). The removal efficiency of 5-FU was higher (95%) when the concentration was 5 mg L -1 under the same conditions. Nitrates (22% of initial amount of N), fluorides (27%) and ammonium (10%) were quantified after 6 h of electrolysis. System II, 77% of 5-FU degradation was achieved (50 mg L -1 ) after 6 h of electrolysis (k app  = 0.004 min -1 ). The degradation rate of 5-FU was complete when the concentration was 5 mg L -1 under the same conditions. Nitrates (29% of initial amount of N), fluorides (25%) and ammonium (5%) were quantified after 6 h of electrolysis. In addition, the main organic byproducts identified by mass spectroscopy were aliphatic compound with carbonyl and carboxyl functionalities. Due to, the mineralization of 5-FU with acceptable efficiency of 88% found in system II (j app of 200 A m -2 ), this system seems to be more promising in the cytostatic drug removal. Moreover the efficiency of 5-FU removal in diluted solutions is better in system II than in system I. Copyright © 2018 Elsevier Ltd. All rights reserved.

  4. CTGF enhances resistance to 5-FU-mediating cell apoptosis through FAK/MEK/ERK signal pathway in colorectal cancer

    Yang K


    Full Text Available Kai Yang, Kai Gao, Gui Hu, Yanguang Wen, Changwei Lin, Xiaorong Li Department of General Surgery, The Third Affiliated Hospital of Central South University, Central South University, Changsha, Hunan, People’s Republic of China Abstract: Colorectal cancer (CRC is one of the most commonly diagnosed cancers among both males and females; the chemotherapy drug 5-fluorouracil (5-FU is one of a doctors’ first lines of defense against CRC. However, therapeutic failures are common because of the emergence of drug resistance. Connective tissue growth factor (CTGF is a secreted protein that binds to integrins, and regulates the invasiveness and metastasis of certain carcinoma cells. Here, we found that CTGF was upregulated in drug-resistant phenotype of human CRC cells. Overexpression of CTGF enhanced the resistance to 5-FU-induced cell apoptosis. Moreover, downregulating the expression of CTGF promoted the curative effect of chemotherapy and blocked the cell cycle in the G1 phase. We also found that CTGF facilitated resistance to 5-FU-induced apoptosis by increasing the expression of B-cell lymphoma-extra large (Bcl-xL and survivin. Then we pharmacologically blocked MEK/ERK signal pathway and assessed 5-FU response by MTT assays. Our current results indicate that the expression of phosphorylated forms of MEK/ERK increased in high CTGF expression cells and MEK inhibited increases in 5-FU-mediated apoptosis of resistant CRC cells. Therefore, our data suggest that MEK/ERK signaling contributes to 5-FU resistance through upstream of CTGF, and supports CRC cell growth. Comprehending the molecular mechanism underlying 5-FU resistance may ultimately aid the fight against CRC. Keywords: connective tissue growth factor, 5-fluorouracil, mitogen-activated protein kinase/extracellular regulated protein kinases, phosphatidyl inositol 3-kinase/serine/threonine kinase Akt, colorectal cancer

  5. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC


    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....


    Alexander A. Kuznetsov


    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  7. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Alexander A. Kuznetsov


    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  8. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)


    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  9. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Stefania Travagnin


    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  10. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Chin-Ping Lin


    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  11. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo


    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  12. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.


    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  13. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    El-Kheshen, Ghadir; Saadat, Mostafa


    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  14. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Brouwer, Albert; Brown, David; Tomuta, Elena


    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  15. arXiv Search for new physics with the SHiP experiment at CERN

    Lantwin, Oliver


    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  16. Nedaplatin and 5-FU combined with radiation in the treatment for esophageal cancer

    Yamanaka, Hideharu; Motohiro, Takayuki; Michiura, Taku; Asai, Akira; Mori, Tsuyoshi; Hioki, Koshiro


    A series of patients with esophageal cancer was treated with chemotherapeutic regimens of the new antitumor platinum preparation nedaplatin plus 5-FU in combination with radiation therapy, and the therapeutic responses, side effects, and complications were clinically assessed. There were 2 patients with a complete response and 11 patients with a partial response, hence, a response rate of 76.5%. Major adverse reactions were those of hematological toxicity and included leukopenia (13 patients, 76.5%), thrombocytopenia (8 patients, 47.1%), and lowered serum hemoglobin concentration (9 patients, 52.9%). The leukopenia and thrombocytopenia, though of a grade 3 severity in 3 and 2 patients, respectively, subsided spontaneously in all affected cases. Gastrointestinal adverse reactions were mild and included appetite loss in 7 patients (41.2%) and nausea in 2 patients (11.8%). The only abnormality in renal function observed was a slight elevation of serum creatinine in one patient. The combined therapy of chemotherapy with nedaplatin and 5-FU plus radiation produced a high response rate in the treatment of carcinoma of the esophagus and was associated with reduced gastrointestinal and renal toxicity. The results indicate the combined therapy with nedaplatin to be clinically useful. (author)

  17. Translasi Pencak Silat Kedalam Film Animasi (Studi Kasus Film Kung Fu Panda

    Riyo Ramadhan


    Full Text Available Sebagai tradisi yang telah membudaya dari sejak zaman dahulu kala, pencak silat lahir sebagai benteng kekuatan pertahanan diri sekaligus menjadi seni yang memperkaya khazanah kebudayaan bangsa Indonesia. Namun, kuatnya terpaan kebudayaan seni bela diri impor yang masuk (karate, kung fu, tae kwon do, muay thai, capoeira, dll, yang selalu didukung dengan berbagai kemasan media entertainment modern, membuat silat menjadi kalah populer bahkan di mata dan persepsi masyarakat Indonesia sendiri. Hal ini mengakibatkan para generasi muda memandang seni bela diri impor menjadi lebih superior ketimbang pencak silat. Jika hal ini terus berlangsung tanpa ada usaha untuk mengembangkan pencak silat melalui media modern, maka akan sangat sulit untuk mempertahankan dan mengembangkan tradisi ini di masa depan. Tujuan dari makalah ini ialah untuk membuktikan dan menggali potensi animasi sebagai media alternatif yang efektif untuk memvisualisasikan adegan dan cerita bertemakan pencak silat. Adapun studi kasus yang menjadi acuan dalam penelitian ialah film animasi “Kung Fu Panda”. Penelitian ini mengkaji studi kasus dengan menggunakan metode kualitatif deskriptif, lalu dianalisis dengan pendekatan analisis deskriptif untuk mengkaji dan mengidentifikasi pemasalahan dan solusi. Pembahasan dari makalah lebih ditekankan pada kekuatan penyampaikan cerita melalui gambar (visual storytelling yang efektif terkait dengan pencak silat. Hasil dari penelitian ialah cara penyampaian pesan yang efektif mengenai elemen dan esensi pencak silat sebagai bentuk translasinya kedalam film animasi. Pesan tersebut dapat disampaikan dengan menggunakan aspek narasi, gesture, dan simbol yang diakomodasi dengan aspek visual storytelling. Translating Pencak Silat Into An Animation Film (Case Study The Film Kung Fu Panda Abstract. A tradition that has been part of Indonesian culture since ancient times, pencak silat was born as a form of self-defense and at the same time has grown into an

  18. 5-FU resistant EMT-like pancreatic cancer cells are hypersensitive to photochemical internalization of the novel endoglin-targeting immunotoxin CD105-saporin

    Lund, Kaja; Olsen, Cathrine Elisabeth; Wong, Judith Jing Wen; Olsen, Petter Angell; Solberg, Nina Therese; Høgset, Anders; Krauss, Stefan; Selbo, Pål Kristian


    Background Development of resistance to 5-fluorouracil (5-FU) is a major problem in treatment of various cancers including pancreatic cancer. In this study, we reveal important resistance mechanisms and photochemical strategies to overcome 5-FU resistance in pancreatic adenocarcinoma. Methods 5-FU resistant (5-FUR), epithelial-to-mesenchymal-like sub-clones of the wild type pancreatic cancer cell line Panc03.27 were previously generated in our lab. We investigated the cytotoxic effect of the ...

  19. Entwicklung einer Methode zur monetären Bewertung des Wassers für ein Unternehmen unter Einbeziehung des Wasser-Fußabdrucks

    Hentschel, Nora


    Wassernutzung und Abbau der Frischwasser-Ressourcen sind heutzutage ein Thema, das als so wichtig wahrgenommen wird wie der Klimawandel. Wasser wird somit zunehmend Auswirkungen auf den ökonomischen Wert von Unternehmen haben. Ziel der vorliegenden Arbeit ist es, den monetären Wert des Wassers mithilfe des Wasser-Fußabdrucks zu bestimmen. Hierfür werden nach einer kurzen Einführung in Kapitel 2 der ökologische Fußabdruck, der CO2-Fußabdruck und der Wasser-Fußabdruck kurz vorgestellt und in...

  20. Optical spectroscopy of Z Canis Majoris, V1057 Cygni, and FU Orionis - Accretion disks and signatures of disk winds

    Welty, Alan D.; Strom, Stephen E.; Edwards, Suzan; Kenyon, Scott J.; Hartmann, Lee W.


    High resolution, high SNR optical spectra have been used to investigate the hypothesis that in outburst, FU Ori objects are self-luminous accretion disks whose light dominates at optical and near-IR wavelengths. Strong evidence has been found for linewidth versus wavelength correlation in good agreement with model predictions for Z CMa and V1057 Cyg, but not for FU Ori itself. Linewidth varies continuously with wavelength at optical wavelengths in the former two objects, In the case of FU Ori, it is argued that a combination of strong wind components to spectral lines, and surface gravity possibly being lower than that of supergiants, conceals the underlying linewidth versus wavelength relationship. A marginal correlation is found between linewidth and lower excitation potential in all three objects. Synthetic disk spectra are subtracted from observed spectral, and remarkably good fits are found for all three objects for wavelengths longer than about 5000 A.

  1. Estudo do centro de massa e estabilidade de quatro posturas básicas do Kung-fu Pak Hok

    Miranda,Pedro Jeferson; Brinatti,André Maurício; Silva,Silvio Luiz Rutz da; Godoy,Marino Luiz Michelin


    Este trabalho trata da análise dos centros de massa e do cálculo da estabilidade das quatro posturas básicas do Kung Fu Pak Hok. Embora a biomecânica tenha surgido em 1960, a sua aplicação em artes marciais, como no Kung Fu ainda é pouco frequente. Apesar de haver estudos de movimentos do Kung Fu, não há trabalhos sobre o centro de massa e a estabilidade para as posturas mais básicas. Este trabalho como objetivo descrever o centro de massa e a estabilidade das quatro posturas mais básicas do ...

  2. NSC30049 inhibits Chk1 pathway in 5-FU-resistant CRC bulk and stem cell populations.

    Narayan, Satya; Jaiswal, Aruna S; Sharma, Ritika; Nawab, Akbar; Duckworth, Lizette Vila; Law, Brian K; Zajac-Kaye, Maria; George, Thomas J; Sharma, Jay; Sharma, Arun K; Hromas, Robert A


    The 5-fluorouracil (5-FU) treatment induces DNA damage and stalling of DNA replication forks. These stalled replication forks then collapse to form one sided double-strand breaks, leading to apoptosis. However, colorectal cancer (CRC) stem cells rapidly repair the stalled/collapsed replication forks and overcome treatment effects. Recent evidence suggests a critical role of checkpoint kinase 1 (Chk1) in preventing the replicative stress. Therefore, Chk1 kinase has been a target for developing mono or combination therapeutic agents. In the present study, we have identified a novel orphan molecule NSC30049 (NSC49L) that is effective alone, and in combination potentiates 5-FU-mediated growth inhibition of CRC heterogeneous bulk and FOLFOX-resistant cell lines in culture with minimal effect on normal colonic epithelial cells. It also inhibits the sphere forming activity of CRC stem cells, and decreases the expression levels of mRNAs of CRC stem cell marker genes. Results showed that NSC49L induces 5-FU-mediated S-phase cell cycle arrest due to increased load of DNA damage and increased γ-H2AX staining as a mechanism of cytotoxicity. The pharmacokinetic analysis showed a higher bioavailability of this compound, however, with a short plasma half-life. The drug is highly tolerated by animals with no pathological aberrations. Furthermore, NSC49L showed very potent activity in a HDTX model of CRC stem cell tumors either alone or in combination with 5-FU. Thus, NSC49L as a single agent or combined with 5-FU can be developed as a therapeutic agent by targeting the Chk1 pathway in 5-FU-resistant CRC heterogeneous bulk and CRC stem cell populations.

  3. Potentially functional SNPs (pfSNPs as novel genomic predictors of 5-FU response in metastatic colorectal cancer patients.

    Jingbo Wang

    Full Text Available 5-Fluorouracil (5-FU and its pro-drug Capecitabine have been widely used in treating colorectal cancer. However, not all patients will respond to the drug, hence there is a need to develop reliable early predictive biomarkers for 5-FU response. Here, we report a novel potentially functional Single Nucleotide Polymorphism (pfSNP approach to identify SNPs that may serve as predictive biomarkers of response to 5-FU in Chinese metastatic colorectal cancer (CRC patients. 1547 pfSNPs and one variable number tandem repeat (VNTR in 139 genes in 5-FU drug (both PK and PD pathway and colorectal cancer disease pathways were examined in 2 groups of CRC patients. Shrinkage of liver metastasis measured by RECIST criteria was used as the clinical end point. Four non-responder-specific pfSNPs were found to account for 37.5% of all non-responders (P<0.0003. Five additional pfSNPs were identified from a multivariate model (AUC under ROC = 0.875 that was applied for all other pfSNPs, excluding the non-responder-specific pfSNPs. These pfSNPs, which can differentiate the other non-responders from responders, mainly reside in tumor suppressor genes or genes implicated in colorectal cancer risk. Hence, a total of 9 novel SNPs with potential functional significance may be able to distinguish non-responders from responders to 5-FU. These pfSNPs may be useful biomarkers for predicting response to 5-FU.

  4. Chemoresistance to 5-FU inhibited by 635 nm LED irradiation in CD133+ KB cell line.

    Kim, Donghwi; Park, Mineon; Jang, Hyunwoong; Hyun, Hoon; Lim, Wonbong


    Consistent with cancer stem cell theory, a small fraction of cancer cells, described as cancer stem cells (CSCs), may promote tumor recurrence and anti-cancer drug resistance. Therefore, much effort has been devoted to the development of CSC targeted therapy to vanquish drug resistance. In this study, we have investigated the effect of multiple light-emitting diode (LED) irradiation treatments with conventional anti-cancer drugs on CSC-like oral cancer cells that acquired stemness by ectopic over expression of CD133. To evaluate combined LED irradiation anti-cancer drug effects, we investigated the chemosensitizing effect of 635 nm irradiation on 5-fluorouracil (5FU)-treated KB CD133+ and KB Vec cells, interrogating the underlying molecular mechanisms associated with stemness and apoptosis that are responsible for chemopreventive activity. In addition, combination therapy with LED irradiation and 5-FU treatment was carried out in KB CD133+ and KB Vec cell-inoculated mouse models. LED irradiation of 635 nm inhibited CSC-like properties consistent with a decrease in OCT4 and NANOG protein expression, reducing colony-forming ability. In addition, LED irradiation enhanced 5-FU-induced cytotoxicity and improved 5-FU chemosensitivity in KB CD133+ via enhancement of apoptosis. These findings were validated in vivo, wherein LED irradiation combined with 5-FU treatment inhibited tumor growth in KB CD133+ -inoculated mice. Collectively, our results provide novel evidence for 635 nm irradiation-induced 5-FU chemosensitization of CSC in oral cancer. In addition, this research highlights that 635 nm LED irradiation may serve as an adjunct treatment to conventional chemotherapeutic drugs in patients with oral cancer.

  5. High response rates following paclitaxel/5-FU and simultaneous radiotherapy in advanced head and neck carcinoma; Hohe Remissionsraten unter simultaner Radio- und Chemotherapie mit Paclitaxel/5-FU in der Behandlung fortgeschrittener Kopf-Hals-Tumoren

    Schroeder, M.; Westerhausen, M. [St.-Johannes-Hospital, Duisburg (Germany). Medizinische Klinik II; Makoski, H.B. [Staedtische Kliniken, Duisburg (Germany). Radioonkologie; Sesterhenn, K. [St. Anna-Krankenhaus, Duisburg (Germany). HNO-Klinik; Schroeder, R. [Bristol Myers Squibb, Muenchen (Germany). Dept. of Oncology


    The main stay of treatment for head and neck cancer patients with advanced disease has been chemotherapy with Cisplatin/5-FU and simultaneous applied radiotherapy. With this multimodality treatment including radical surgery after two cycles of neoadjuvant chemotherapy and 40 Gy radiotherapy we reported 60% complete remission after 5 years for patients with stage III/IV of head and neck cancer. Paclitaxel, a new plant product, has demonstrated significant antineoplastic activity in head and neck tumors (ECOG-Study: 40% RR). Therefore we performed a trial with Taxol/5-FU and simultaneous radiation in a neoadjuvant and postoperative adjuvant setting of stage III/IV squamous cell carcinoma of the head and neck with pre-existent contraindication against Cisplatin. Patients and Methods: 30 patients with a primarily inoperable stage III/IV of SCC of the head and neck were enrolled to receive day 1 and 29 Taxol 175 mg/m{sup 2} as a 3-hour-infusion, followed by 120-hour-cvi of 1000 mg/m{sup 2}/d 5-FU. Locally irradiation was given ad 40 Gy (2 Gy/d/day 1-26). Radical surgery followed about day 56. Postoperatively patients received again 2 cycles of Taxol/5-FU and simultaneous irradiation with 30 Gy. Results: So far 30 patients were treated and all patients reached a CR after complete treatment, ongoing for 23/30 patients for 6 till 34 months: 4 patients developed a second neoplasia, and 3 patients gloved a local relapse. The principal toxicity was moderate (neutropenia, peripheral neuropathy, arthralgia/myalgia) and sensible with supportive care (e.g. PEG). Conclusions: The results suggest that the treatment of SCC of the head and neck with Taxol/5-FU and simultaneous radiation and radical surgery is a highly effective schedule and comparable with the treatment with Cisplatin/5-FU. (orig.) [Deutsch] Der Standard in der Behandlung weit forgeschrittener, primaer inoperabler Kopf-Hals-Tumoren stellte die Cisplatinhaltige Chemotherapiekombination mit 5-FU dar mit simultan

  6. Clinical research on disciplinarian and character of treatment of zang-fu in syndrome differentiation on insomnia

    凌丽; 薛金伟; 东贵荣


    Objective To investigate the therapeutic effect of insomnia with zang-fu in syndrome differentiation. Methods Seventy patients with insomnia according to the diagnostic sequence were randomly divided into two groups, the treatment group and the control group. Two groups received the therapeutic methods of acupuncture in syndrome differentiation and general acupuncture separately. After two courses of treatment and one month's follow-up, therapeutic effect was evaluated through statistical analysis. Resulds The therapeutic effects of the treatment group and the control group have significant differences which have statistical significance. Conclusion Zang-fu in syndrome differentiation may enhance the clinical therapeutic effect of insomnia.

  7. Comparison of force, power, and striking efficiency for a Kung Fu strike performed by novice and experienced practitioners: preliminary analysis.

    Neto, Osmar Pinto; Magini, Marcio; Saba, Marcelo M F; Pacheco, Marcos Tadeu Tavares


    This paper presents a comparison of force, power, and efficiency values calculated from Kung Fu Yau-Man palm strikes, when performed by 7 experienced and 6 novice men. They performed 5 palm strikes to a freestanding basketball, recorded by high-speed camera at 1000 Hz. Nonparametric comparisons and correlations showed experienced practitioners presented larger values of mean muscle force, mean impact force, mean muscle power, mean impact power, and mean striking efficiency, as is noted in evidence obtained for other martial arts. Also, an interesting result was that for experienced Kung Fu practitioners, muscle power was linearly correlated with impact power (p = .98) but not for the novice practitioners (p = .46).

  8. Overcoming acquired drug resistance in colorectal cancer cells by targeted delivery of 5-FU with EGF grafted hollow mesoporous silica nanoparticles

    Chen, Lijue; She, Xiaodong; Wang, Tao; He, Li; Shigdar, Sarah; Duan, Wei; Kong, Lingxue


    Acquired drug resistance (ADR) can be developed in colorectal cancer cells after 5-fluorouracil (5-FU) treatment and diminish the effectiveness of chemotherapy. In this work, acquired 5-FU resistance in the colorectal cancer cell line SW480 was obtained with the up-regulation of dihydropyrimidine dehydrogenase (DPYD) gene expression which can convert 5-FU to its inactive metabolite. To overcome ADR in colorectal cancer, hollow mesoporous silica nanoparticles (HMSNs) grafted with epidermal growth factor (EGF) were used as nanocarriers to deliver 5-FU to colorectal cancer cells with acquired drug resistance. The effect and mechanism of 5-FU loaded EGF grafted HMSNs (EGF-HMSNs-5-FU) in overcoming acquired drug resistance in SW480/ADR cells were studied. The EGF-HMSNs were demonstrated to be specifically internalized in EGFR overexpressed SW480/ADR cells via a receptor-mediated endocytosis and can escape from endo-lysosomes. The EGF-HMSNs-5-FU exhibited much higher cytotoxicity on SW480/ADR cells than HMSNs-5-FU and free 5-FU while the plain HMSNs did not show significant cytotoxicity. The mechanism of EGF-HMSNs-5-FU in overcoming drug resistance in SW480/ADR cells could be attributed to the specific internalization of EGF-HMSNs-5-FU in EGFR overexpressed cells which can lead to high intracellular drug accumulation and cause cell death through S phase arrest.Acquired drug resistance (ADR) can be developed in colorectal cancer cells after 5-fluorouracil (5-FU) treatment and diminish the effectiveness of chemotherapy. In this work, acquired 5-FU resistance in the colorectal cancer cell line SW480 was obtained with the up-regulation of dihydropyrimidine dehydrogenase (DPYD) gene expression which can convert 5-FU to its inactive metabolite. To overcome ADR in colorectal cancer, hollow mesoporous silica nanoparticles (HMSNs) grafted with epidermal growth factor (EGF) were used as nanocarriers to deliver 5-FU to colorectal cancer cells with acquired drug resistance. The

  9. The Protective Effects of Shen-Fu Injection on Experimental Acute Pancreatitis in a Rat Model

    Lei Huang


    Full Text Available Objectives. In the present study, we investigated the protective effects of Shen-Fu injection (SFI on a caerulein-induced rat pancreatitis (AP model. Methods. SFI was given to rats in the SFI treated group through intraperitoneal injection. Blood and pancreas samples were collected for serological and histopathological studies. Results. Our results showed that AP caused significant decrease in tissue glutathione (GSH and serum IL-4 and IL-10, while pancreatic malondialdehyde (MDA and myeloperoxidase (MPO were increased. Furthermore, TNF-α, IL-1β, amylase, and lipase levels were also significantly increased. On the other hand, SFI treatment reserved all these biochemical indices as well as histopathologic alterations that were induced by caerulein. Conclusion. Our findings suggest that the SFI protects against caerulein-induced AP in rats via modulation of cytokines, oxidative stress, and Nuclear Factor-kappa B (NF-κB activity.


    Green, Joel D.; Evans, Neal J. II; Merello, Manuel; Pooley, David; Kospal, Agnes; Van Kempen, Tim A.; Van Dishoeck, Ewine; Herczeg, Gregory; Quanz, Sascha P.; Henning, Thomas; Bouwman, Jeroen; Lee, Jeong-Eun; Dunham, Michael M.; Meeus, Gwendolyn; Chen, Jo-Hsin; Guedel, Manuel; Skinner, Stephen L.; Rebull, Luisa M.; Guieu, Sylvain


    We analyze the submillimeter emission surrounding the new FU Orionis-type object, HBC 722. We present the first epoch of observations of the active environs of HBC 722, with imaging and spectroscopy from PACS, SPIRE, and HIFI on board the Herschel Space Observatory, as well as CO J = 2-1 and 350 μm imaging (SHARC-II) with the Caltech Submillimeter Observatory. The primary source of submillimeter continuum emission in the region-2MASS 20581767+4353310-is located 16'' south-southeast of the optical flaring source while the optical and near-infrared emission is dominated by HBC 722. A bipolar outflow extends over HBC 722; the most likely driver is the submillimeter source. We detect warm (100 K) and hot (246 K) CO emission in the surrounding region, evidence of outflow-driven heating in the vicinity. The region around HBC 722 itself shows little evidence of heating driven by the new outbursting source itself.

  11. [XI Hong, XI Hong acupuncture school of thought and Xi Hong Fu].

    Xu, Chun-Juan; Chen, Rong; Yang, Yong-Shou


    XI Hong, a famous acupuncturist in the Southern Song Dynasty, has an important influence and status in history of Chinese acupuncture and moxibustion. After he moved to Linchuan, Jiangxi province, his descendants passed acupuncture from generation to generation. According to records, it was passed to 12 generations. After the tenth generation, it was also passed to apprentices besides descendants, such as accomplished acupuncturists CHEN Hong-gang, LIU Jin and others, forming XI Hong acupuncture school of thought. The poem of acupuncture and moxibustion XI Hong Fu is the representative work about XI Hong academic thought, which was additionally compiled or written by XI Hong's apprentices according to XI Hong academic thought. The poems are of characteristics in acupuncture application and association of acupoints. The academic thought and therapeutic methods of acupuncture in the poems still are widely used in modern clinical acupuncture practice.

  12. Mass loss from pre-main-sequence accretion disks. I - The accelerating wind of FU Orionis

    Calvet, Nuria; Hartmann, Lee; Kenyon, Scott J.


    We present evidence that the wind of the pre-main-sequence object FU Orionis arises from the surface of the luminous accretion disk. A disk wind model calculated assuming radiative equilibrium explains the differential behavior of the observed asymmetric absorption-line profiles. The model predicts that strong lines should be asymmetric and blueshifted, while weak lines should be symmetric and double-peaked due to disk rotation, in agreement with observations. We propose that many blueshifted 'shell' absorption features are not produced in a true shell of material, but rather form in a differentially expanding wind that is rapidly rotating. The inference of rapid rotation supports the proposal that pre-main-sequence disk winds are rotationally driven.

  13. From specific training to global shift of manual preference in Kung Fu experts.

    Maeda, Rodrigo S; Souza, Rosana M; Teixeira, Luis A


    Manual preference and intermanual performance asymmetry have been approached from a multidimensional and dynamic perspective. A point of interest from that approach is the role of lateralized motor experiences on handedness. In this study, intermanual performance asymmetry in sport-specific movements and manual preference in daily living tasks were compared between Kung Fu athletes and novices. Analysis of movement time in the performance of interlaterally symmetric and asymmetric movement patterns showed smaller intermanual performance asymmetry in experts. Analysis of manual preference using the Edinburgh Handedness Inventory indicated that experts presented predominantly weak or moderate strength of right hand preference. Novices, conversely, were found to have predominantly strong right hand preference. These results suggest that extensive bimanual training by experts leads to a global shift of manual preference, affecting hand selection in distinct tasks.

  14. Cold CO Gas in the Envelopes of FU Orionis-type Young Eruptive Stars

    Kóspál, Á.; Ábrahám, P.; Moór, A. [Konkoly Observatory, Research Centre for Astronomy and Earth Sciences, Hungarian Academy of Sciences, Konkoly-Thege Miklós út 15-17, 1121 Budapest (Hungary); Csengeri, T.; Güsten, R. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Henning, Th. [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany)


    FU Orionis-type objects (FUors) are young stellar objects experiencing large optical outbursts due to highly enhanced accretion from the circumstellar disk onto the star. FUors are often surrounded by massive envelopes, which play a significant role in the outburst mechanism. Conversely, the subsequent eruptions might gradually clear up the obscuring envelope material and drive the protostar on its way to become a disk-only T Tauri star. Here we present an APEX {sup 12}CO and {sup 13}CO survey of eight southern and equatorial FUors. We measure the mass of the gaseous material surrounding our targets, locate the source of the CO emission, and derive physical parameters for the envelopes and outflows, where detected. Our results support the evolutionary scenario where FUors represent a transition phase from envelope-surrounded protostars to classical T Tauri stars.

  15. Clinical evaluation of adjuvant chemoradiotherapy with CDDP, 5-Fu, and VP-16 for advanced esophageal cancer

    Mukaida, Hidenori; Hirai, Toshihiro; Yamashita, Yoshinori; Yoshida, Kazuhiro; Hihara, Jun; Kuwahara, Masaki; Inoue, Hideki; Toge, Tetsuya [Hiroshima Univ. (Japan). Research Inst. for Radiation Biology and Medicine


    The aim of this study was to evaluate the efficacy of adjuvant chemoradiotherapy following surgery in patients with advanced esophageal cancer. We followed the cases of 57 such patients treated at our hospital, involving 19 who received adjuvant chemoradiotherapy (CR group), 19 who received radiotherapy alone (R group), and 19 who did received neither (N group). In the CR group, chemotherapy, consisting of cis-diaminodichloroplatinum (CDDP), 5-fluorouracil (5-FU), and etoposide (VP-16), was combined with radiotherapy was administered from 4 weeks after surgery. Concurrent radiotherapy was started at 3 weeks after esophagectomy. CDDP at 50 mg/m{sup 2} was administered on days 1 and 7.5-FU at 500 mg/m{sup 2} and VP-16 at 60 mg/m{sup 2} were administered on days 3, 4, and 5. Thirteen patients (68.4%) were treated with more than 2 cycles of chemotherapy combined with radiation. Side-effects of severe anorexia (grade 3) and leukocytopenia (<1900/{mu}l) were observed in 47% and 39% of the patients, respectively. However no treatment-related death was observed. The 5-year-survival rate was 25.2%, 18.9%, and 15.8%, in the CR group, R group, and N group, respectively. The recurrence rate was 66.7% in the CR group, which was higher than in the matched control groups (46.2% in the N group and 54.5% in the R group), but with no significant difference. These results suggested that adjuvant chemoradiotherapy did not contribute to improvement in prognosis for these patients with advanced esophageal cancer. (author)

  16. Clinical evaluation of adjuvant chemoradiotherapy with CDDP, 5-Fu, and VP-16 for advanced esophageal cancer

    Mukaida, Hidenori; Hirai, Toshihiro; Yamashita, Yoshinori; Yoshida, Kazuhiro; Hihara, Jun; Kuwahara, Masaki; Inoue, Hideki; Toge, Tetsuya


    The aim of this study was to evaluate the efficacy of adjuvant chemoradiotherapy following surgery in patients with advanced esophageal cancer. We followed the cases of 57 such patients treated at our hospital, involving 19 who received adjuvant chemoradiotherapy (CR group), 19 who received radiotherapy alone (R group), and 19 who did received neither (N group). In the CR group, chemotherapy, consisting of cis-diaminodichloroplatinum (CDDP), 5-fluorouracil (5-FU), and etoposide (VP-16), was combined with radiotherapy was administered from 4 weeks after surgery. Concurrent radiotherapy was started at 3 weeks after esophagectomy. CDDP at 50 mg/m 2 was administered on days 1 and 7.5-FU at 500 mg/m 2 and VP-16 at 60 mg/m 2 were administered on days 3, 4, and 5. Thirteen patients (68.4%) were treated with more than 2 cycles of chemotherapy combined with radiation. Side-effects of severe anorexia (grade 3) and leukocytopenia (<1900/μl) were observed in 47% and 39% of the patients, respectively. However no treatment-related death was observed. The 5-year-survival rate was 25.2%, 18.9%, and 15.8%, in the CR group, R group, and N group, respectively. The recurrence rate was 66.7% in the CR group, which was higher than in the matched control groups (46.2% in the N group and 54.5% in the R group), but with no significant difference. These results suggested that adjuvant chemoradiotherapy did not contribute to improvement in prognosis for these patients with advanced esophageal cancer. (author)

  17. Potential emerging treatment in vitiligo using Er:YAG in combination with 5FU and clobetasol.

    Mokhtari, Fatemeh; Bostakian, Anis; Shahmoradi, Zabihollah; Jafari-Koshki, Tohid; Iraji, Fariba; Faghihi, Gita; Hosseini, Sayed Mohsen; Bafandeh, Behzad


    Vitiligo is a pigmentary disorder of skin affecting at least 1% of the world population of all races in both sexes. Its importance is mainly due to subsequent social and psychological problems rather than clinical complications. Various treatment choices are available for vitiligo; however, laser-based courses have shown to give more acceptable results. The aim of this trial was to evaluate the efficacy of Er:YAG laser as a supplementary medicine to topical 5FU and clobetasol in vitiligo patients. Two comparable vitiligo patches from 38 eligible patients were randomized to receive topical 5FU and clobetasol in control group and additional Er:YAG laser in intervention group. Major outcomes of interest were the size of patch and pigmentation score at randomization and 2 and 4 months after therapy. Final sample included 18 (47%) male patients and age of 35.66±8.04. The performance Er:YAG group was superior in all sites. Reduction in the size of patches was greater in Er:YAG group (p-value=.004). Also, this group showed a higher pigmentation scores in the trial period than control group (p-value<.001). Greater reduction in the size and increase in pigmentation score was seen in Er:YAG group especially for short periods after therapy and repeating laser sessions may help improving final outcomes. Er:AYG could help in reducing complications of long-term topical treatments, achieving faster response, and improving patient adherence. © 2017 Wiley Periodicals, Inc.

  18. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Holt, Maria


    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  19. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing


    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  20. Fuels planning: science synthesis and integration; environmental consequences fact sheet 12: Water Erosion Prediction Project (WEPP) Fuel Management (FuMe) tool

    William Elliot; David Hall


    The Water Erosion Prediction Project (WEPP) Fuel Management (FuMe) tool was developed to estimate sediment generated by fuel management activities. WEPP FuMe estimates sediment generated for 12 fuel-related conditions from a single input. This fact sheet identifies the intended users and uses, required inputs, what the model does, and tells the user how to obtain the...

  1. The Effect of 5 FU on the Expression of Transforming Growth Factor Beta-1 (Tgf-1 in Cultured Tendon Cells

    Zeynep Karacor Altuntas


    Full Text Available This study investigated the effect of the treatment with 1 min exposures to 5-fluorouracil (5-FU  on the expression of TGF-beta 1 in cultured tendon cells. Fibroblasts cultured from the flexor tendons of dog paws were treated with 3 different doses of 5-FU ( control, 5-15-25 mgr /ml for 1 minute.  After 5-FU exposure  the expression of TGF –beta 1 were tested by real time Reverse Transcriptase-Polymerase Chain Reaction (RT-PCR at 3rd and 7th days. There were no statistically significant differences in the expression levels of the TGF-b1 gene between the control group and all other groups on day 3 and 7 (p>0.05.However, when the percentage changes in the TGF-BETA1 gene expression on days 3–7 were compared, there were statistically significant differences and this was maximally observed with 89% +12 (p<0.05 in the group treated with 25-mg/ml 5-FU.  We conclude that 1min. 5-FU application may be  sufficient to prevent adhesions in tendon healing by limiting the expression of TGF-BETA1. 

  2. The effect on the small bowel of 5-FU and oxaliplatin in combination with radiation using a microcolony survival assay

    Kjellén Elisabeth


    Full Text Available Abstract Background In locally advanced rectal cancer, 5-Fluorouracil (5-FU-based chemoradiation is the standard treatment. The main acute toxicity of this treatment is enteritis. Due to its potential radiosensitizing properties, oxaliplatin has recently been incorporated in many clinical chemoradiation protocols. The aim of this study was to investigate to what extent 5-FU and oxaliplatin influence the radiation (RT induced small bowel mucosal damage when given in conjunction with single or split dose RT. Methods Immune competent balb-c mice were treated with varying doses of 5-FU, oxaliplatin (given intraperitoneally and total body RT, alone or in different combinations in a series of experiments. The small bowel damage was studied by a microcolony survival assay. The treatment effect was evaluated using the inverse of the slope (D0 of the exponential part of the dose-response curve. Results In two separate experiments the dose-response relations were determined for single doses of RT alone, yielding D0 values of 2.79 Gy (95% CI: 2.65 - 2.95 and 2.98 Gy (2.66 - 3.39, for doses in the intervals of 5-17 Gy and 5-10 Gy, respectively. Equitoxic low doses (IC5 of the two drugs in combination with RT caused a decrease in jejunal crypt count with significantly lower D0: 2.30 Gy (2.10 - 2.56 for RT+5-FU and 2.27 Gy (2.08 - 2.49 for RT+oxaliplatin. Adding both drugs to RT did not further decrease D0: 2.28 Gy (1.97 - 2.71 for RT+5-FU+oxaliplatin. A clearly higher crypt survival was noted for split course radiation (3 × 2.5 Gy compared to a single fraction of 7.5 Gy. The same difference was seen when 5-FU and/or oxaliplatin were added. Conclusion Combining 5-FU or oxaliplatin with RT lead to an increase in mucosal damage as compared to RT alone in our experimental setting. No additional reduction of jejunal crypt counts was noted when both drugs were combined with single dose RT. The higher crypt survival with split dose radiation indicates a

  3. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Irena Dzwonkowska


    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  4. Loss of ABCB4 attenuates the caspase-dependent apoptosis regulating resistance to 5-Fu in colorectal cancer.

    Hu, Hanqing; Wang, Meng; Guan, Xu; Yuan, Ziming; Liu, Zheng; Zou, Chaoxia; Wang, Guiyu; Gao, Xu; Wang, Xishan


    The adenosine triphosphate-binding cassette (ABC) is a large group of proteins involved in material transportation, cellular homeostasis, and closely associated with chemoresistance. ATP-binding cassette protein B4 (ABCB4) is a member of ABCs which has a similar structure to ABCB1, but fewer researches were performed. The present study is aimed to investigate the putative mechanism of ABCB4 in 5-fluorouracil (5-Fu) resistance. Then, we found that ABCB4 was significantly down-regulated in the 5-Fu resistant HCT8 cell lines by polymerase chain reaction (PCR) and Western blot. The knockdown of ABCB4 by small interfering RNA decreased the apoptosis by 5-Fu in resistant HCT8R cell lines without influencing the proliferation. Also, we found a lower expression of cleaved caspase and PARP by Western blot after the knockdown of ABCB4. However, the knockdown of ABCB4 did not influence the proliferation and apoptosis. Furthermore, the histological detection of ABCB4 mRNA level in human colorectal cancer tissues and even in the recurrent tissues after 5-Fu single-agent chemotherapy was employed to provide more concrete evidence that ABCB4 may be a tumor suppressor gene to regulate chemoresistance in colorectal cancer. Moreover, a 109-patient cohort revealed that ABCB4 predicted a poor recurrence-free survival and overall survival. In summary, ABCB4 was down-regulated in the 5-Fu resistant cells and knockdown of ABCB4 alleviated the cell apoptosis and predicts a shorter recurrence-free survival and overall survival. © 2018 The Author(s).

  5. Low Impact Development Intensive Rural Construction Planning in Xu Fu Village Ningbo, China: Planning Review through Rural Resilience Perspective

    Roosmayri Lovina Hermaputi


    Full Text Available Xu Fu Village Ningbo LID Intensive Rural Construction Planning is a cooperation project between Zhejiang University and Ningbo Institute of Technology which named "12th Five-Year National Science and Technology support program-the comprehensive demonstration of the key technology of the beautiful rural construction in the rapid urbanization area of the Yangtze River Delta". This plan focuses on intensive rural construction as part of rural development and construction project that applies the principles of low impact development. Xu Fu Village located in the Yangtze River Delta Region. Currently, the rural growth brings the high impact of development, as a result of rapid urbanization growth arising several issues, such as low land use efficiency, dispersed rural residence, homestead occupies more, rural roads covering over, etc. Meanwhile, Xu Fu village wishes to develop its tourism potential. Thus, the intensive rural construction should be done to avoid the severe effect. The project result hopefully can improve the quality and level of rural residential planning, design, and construction; improve their living environment; save construction land and water use; and improve energy efficiency. The aim of this study is to review the Low Impact Development (LID Intensive Rural Construction in Xu Fu Village, Ningbo City through the rural resilience perspective. This paper will describe the project plan first, then review it through rural resilience perspective. This paper will elaborate the rural resilience theory and then review the rural resiliency through two parts; the first part is identifying rural resilience in rural infrastructure development based on the criteria created by Ayyob S. and Yoshiki Y. (2014, about urban resiliency criteria, and then the second part is reviewing Xu Fu Village resilience through Arup Resilience Qualities (2012, considering three rural resilience domain (economy, ecology, and cultural.

  6. In vivo 19F-MRS observation of 5-FU metabolism in fatty liver induced by choline-deficient diet

    Otsuka, Hideki; Harada, Masafumi; Nishitani, Hiromu; Koga, Keiko.


    Using 19 F-MRS, 5-FU metabolism was investigated in rat fatty liver. Fatty liver was induced by choline-deficient diet (CD diet). This study showed differences in 5-FU metabolism between normal and fatty liver. After laparotomy, a surface coil was placed directly on the liver surface. Spectra were continuously obtained after injection of 5-FU 100 mg/kg body weight via a catheter inserted into femoral vein. We made MRI and 1 H-MRS study to examine the lipid accumulation. Histological study was also performed using HE (hematoxylin-eosin) and oil red stain. The livers of rats fed a CD diet showed very high intensity on T 1 -WI. 1 H-MRS was very useful in deteminating the fat content because the fat ratio demonstrated by 1 H-MRS is well correlated to histological findings. In 19 F-MRS, we recognized the following four peaks: 5-FU, FBAL, Fnct (fluoronucleotide) and FUPA. The decrease of 5-FU was not very apparent, but compared to the normal liver, the formation of Fnct increased and the formation of FBAL was suppressed in fatty liver. The rats fed a CD diet for four weeks showed a higher Fnct peak and lower FBAL peak compared with the results of rats fed a CD diet for two weeks. In a CD diet group, liver cell degeneration and necrotic changes were observed histologically. It is reported that cell degeneration is followed by cell proliferation in fatty liver induced by a choline deficient diet, and the high Fnct peak found in our study may reflect this phenomenon. The high Fnct peak on 19 F-MRS may correspond to recovering reaction from liver injury like fatty liver. (author)

  7. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.


    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  8. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti


    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  9. Everybody was Kung-Fu fighting-The beneficial effects of Tai Chi Qigong and self-defense Kung-Fu training on psychological and endocrine health in middle aged and older men.

    Walther, A; Lacker, T J; Ehlert, U


    Higher age is associated to a variety of physical and mental disorders. Age-related changes in steroid secretion have been suggested to be an underlying mechanism leading to frailty, depression, and sexual dysfunction. However, Tai chi qigong and similar forms of exercise have been shown to improve a great variety of health-related parameters in older individuals. We examined 56 self-reporting healthy men actively practicing Tai chi qigong and/or self-defense Kung-fu and 55 age-matched self-reporting healthy controls. Saliva samples were obtained in a standardized procedure for subsequent quantification of circulating testosterone and cortisol levels. In addition, depressive symptoms, life satisfaction, and sexual health were assessesd via self-report questionnaires. Age was negatively associated with testosterone, while no association emerged for cortisol. Tai chi qigong and/or self-defense Kung-fu training was neither associated with testosterone nor cortisol. More weekly Tai chi qigong and/or self-defense Kung-fu training (4 or more times per week) was instead associated with a lower CT-ratio, less depressive symptoms, and higher life satisfaction compared to individuals, who trained only one to three times per week. More years of Tai chi qigong and/or self-defense Kung-fu training were associated with less depressive symptoms and higher life satisfaction but not with the CT-ratio. No significant associations emerged for Tai chi qigong and/or self-defense Kung-fu training and sexual health. When compared to the age-matched controls, there is a significant effect of Tai chi, qigong and/or self-defense Kung-fu on the CT-ratio. Contrast analyses revealed a significantly lower CT-ratio for the high training load group in contrast to the low training load group. Further, in contrast to the control group, the low training load group exhibits a significantly higher CT-ratio. For depression, contrast analyses revealed a significantly lower level of depression in the

  10. FE-I2 a front-end readout chip designed in a commercial 025- mu m process for the ATLAS pixel detector at LHC

    Blanquart, L; Einsweiler, Kevin F; Fischer, P; Mandelli, E; Meddeler, G; Peric, I


    A new front-end chip (FE-I2) has been developed for the ATLAS pixel detector at the future Large Hadron Collider (LHC) accelerator facility of the European Laboratory for Particle Physics (CERN). This chip has been submitted in a commercial 0.25- mu m CMOS process using special layout techniques for radiation tolerance. It comprises 2880 pixels arranged into 18 columns of 160 channels. Each pixel element of dimension 50 mu m * 400 mu m is composed of a charge- sensitive amplifier followed by a fast discriminator with a detection threshold adjustable within a range of 0-6000 electrons and slow control logic incorporating a wired-hit-Or, preamplifier-kill, readout mask, and automatic threshold tuning circuitry. There are two single-event- upset (SEU)-tolerant DACs for reducing threshold (7-b) and recovery- time (3-b) mismatches from pixel to pixel along with digital hit emulation and a differential readout circuit aimed at transporting time-stamped data from each pixel to buffers at the bottom of the chip. In c...

  11. Rezension von: Ulf Gebken, Söhnke Vosgerau (Hg.: Fußball ohne Abseits. Ergebnisse und Perspektiven des Projekts ‚Soziale Integration von Mädchen durch Fußball‘. Wiesbaden: Springer VS 2014.

    Robert Claus


    Full Text Available Seit 2006 wurden im Rahmen des vom Deutschen Fußball-Bund durchgeführten Modellprojektes „Soziale Integration von Mädchen durch Fußball“ an über 200 Standorten Schul-AGs in sogenannten Brennpunktbezirken aufgebaut. Im vorliegenden Sammelband beleuchten die Autor/-innen ausführlich die Funktion von Sport für die pädagogische Kompetenzvermittlung. Zudem erbringen sie einen umfassenden Projektbericht und leisten ein Plädoyer für die Modernisierung des Verhältnisses zwischen Schule und Vereinen, Lehrplan und Ehrenamt. Somit stellt das Buch, wie auch das Projekt, einen enorm wichtigen Beitrag zur Geschlechtergerechtigkeit im Sport dar. Gleichzeitig jedoch liest sich eine Reihe an Texten etwas zu sperrig für den Bericht einer Praxisforschung, und Begriffe im Feld der ‚Integration’ bleiben schwammig.

  12. Optimization of LDL targeted nanostructured lipid carriers of 5-FU by a full factorial design

    Sare Andalib


    Full Text Available Background: Nanostructured lipid carriers (NLC are a mixture of solid and liquid lipids or oils as colloidal carrier systems that lead to an imperfect matrix structure with high ability for loading water soluble drugs. The aim of this study was to find the best proportion of liquid and solid lipids of different types for optimization of the production of LDL targeted NLCs used in carrying 5-Fu by the emulsification-solvent evaporation method. Materials and Methods: The influence of the lipid type, cholesterol or cholesteryl stearate for targeting LDL receptors, oil type (oleic acid or octanol, lipid and oil% on particle size, surface charge, drug loading efficiency, and drug released percent from the NLCs were studied by a full factorial design. Results: The NLCs prepared by 54.5% cholesterol and 25% of oleic acid, showed optimum results with particle size of 105.8 nm, relatively high zeta potential of −25 mV, drug loading efficiency of 38% and release efficiency of about 40%. Scanning electron microscopy of nanoparticles confirmed the results of dynamic light scattering method used in measuring the particle size of NLCs. Conclusions: The optimization method by a full factorial statistical design is a useful optimization method for production of nanostructured lipid carriers.

  13. Optimization of LDL targeted nanostructured lipid carriers of 5-FU by a full factorial design.

    Andalib, Sare; Varshosaz, Jaleh; Hassanzadeh, Farshid; Sadeghi, Hojjat


    Nanostructured lipid carriers (NLC) are a mixture of solid and liquid lipids or oils as colloidal carrier systems that lead to an imperfect matrix structure with high ability for loading water soluble drugs. The aim of this study was to find the best proportion of liquid and solid lipids of different types for optimization of the production of LDL targeted NLCs used in carrying 5-Fu by the emulsification-solvent evaporation method. The influence of the lipid type, cholesterol or cholesteryl stearate for targeting LDL receptors, oil type (oleic acid or octanol), lipid and oil% on particle size, surface charge, drug loading efficiency, and drug released percent from the NLCs were studied by a full factorial design. The NLCs prepared by 54.5% cholesterol and 25% of oleic acid, showed optimum results with particle size of 105.8 nm, relatively high zeta potential of -25 mV, drug loading efficiency of 38% and release efficiency of about 40%. Scanning electron microscopy of nanoparticles confirmed the results of dynamic light scattering method used in measuring the particle size of NLCs. The optimization method by a full factorial statistical design is a useful optimization method for production of nanostructured lipid carriers.

  14. Sequential radiotherapy and chemotherapy using CDDP and 5-FU for advanced head and neck cancer

    Takamura, Akio; Arimoto, Takuro; Mizoe, Jun-etsu; Tomita, Masayoshi; Kitahara, Toshihiro; Irie, Goro; Matsuoka, Yoshisuke.


    From April 1989 to January 1990, nine patients with locally advanced stage IV squamous cell carcinoma of the head and neck underwent combined chemotherapy and radiotherapy (RT). Chemotherapy consisted of two cycles of CDDP (100 mg/m 2 , day 1) + 5-FU (1 g/m 2 , days 1-5, continuous infusion) every five weeks. RT was interdigitated with chemotherapy after the second course of chemotherapy. Each course was initiated two or three days after interrupting chemotherapy. RT was delivered at 65 or 70 Gy for 8 weeks. Of the 7 patients completing the treatment, 29% responded totally, and 43% responded partially. Seven patients died: two due to acute treatment-related toxicity; four due to locoregional progression; and one due to an unrelated cause. Two patients are still alive (10 and 12 months); one is free of tumor, the other has a metastatic bone tumor. Though sequential use of CT might be considered effective for some patients, acute toxicity was moderate to severe and patients with poor performance (≤70%), elderly (≥70 yr) and renal dysfunction (creatinine clearance<80 ml/min) patients must be considered as high risk for treatment by our combined regimen. (author)

  15. [Experimental study on preventing postoperative posterior urethra scar in response to Tablet Fu Kang].

    Mo, Jiacong; Wang, Shengyi


    To find an effective measurement to prevent and decrease the posterior urethral scar stricture. Twenty New Zealand rabbits were chosen. All the rabbits were made posterior urethra disruption model, and at the same time, the urethra anastomosis operation was performed. Twenty rabbits were divided into two groups after operation at random. One group was treated by Tablet Fu Kang (experimental group), another group was treated by NS (control group). All the rabbits were killed three weeks later, the urethra anastomotic stoma tissue was chosen and stained with Masson. All the figures of slides were inputted into figure analytic system. There were little collagenous fiber, sparsely and arranged in good order in scar tissue of urethra anastomotic stoma in experimental group. The area of collagenous fibers was 117.11 +/- 10.17 microm2 in three visual fields. There were many collagenous fibers, densely,and arranged in disorder in scar tissue of urethra anastomotic stoma in control group, the relative area was 136.43 +/- 15.85 microm2. There was statistic significance when comparing the area of collagenous fiber in two groups (P urethra.

  16. Summary report of Japan-US joint project (TITAN). FuY 2007-2012

    Okuno, K.; Muroga, T.


    This report summarizes the scientific accomplishments achieved through the TITAN Japan-US Collaboration Program. The TITAN collaboration (Tritium, Irradiation and Thermofluid for America and Nippon) has been carried out through six years (FuY 2007-2012) under the collaboration implemented by establishing Annex I to the NIFS-ORNL Agreement on Academic and Scientific Exchange. The TITAN collaboration was established to obtain fundamental understanding for the control of tritium and thermofluid in first wall, blanket and recovery systems with particular emphasis on their interfacial issues. The experiments were designed for testing under conditions specific to fusion, such as intense irradiation, high heat/particle flux, and circulation in a high magnetic field. The results have been applied using integrated modeling to advance the design of tritium and heat control in MFE and IFE systems. This issue is the collection of 34 papers presented at the entitled meeting. All the 34 of the presented papers are indexed individually. (J.P.N.)

  17. Alternative therapy using CDDP/5FU and radiotherapy for nasopharyngeal cancer

    Shikama, Naoto; Shikano, Masato; Toita, Takafumi; Yuda, Atsushi; Hayashi, Yasuyuki


    We conducted a prospective study of an alternative chemoradiation protocol comprising cisplatin (CDDP) (50 mg/m 2 /day, 2 days), 5FU (800 mg/m 2 /day, 5 days) and radiotherapy (66 Gy in 36 fractions) for locally advanced nasopharyngeal cancer (stage II-IV). We treated 67 patients (stage II-III:41 patients, IV:26) using this protocol. Fifty-seven patients (85%) received the full-course, three-cycle chemotherapy. Three-year overall survival rate of all patients was 90.5%, and 3-year disease-free survival rate was 78.3%. The recurrent sites were the primary site in four patients, neck lymph node in two and distant metastasis in eight. Severe myelosuppression (grade 3-4) was observed in half of the patients, and severe mucositis (grade 3-4) in about 30%. Chemotherapy induced severe dysfunction of liver or kidney (grade 3-4) was seen in three patients. This treatment strategy may be very useful, but careful medical management is essential. (author)

  18. A Reactor Development Scenario for the FuZE Sheared-Flow Stabilized Z-pinch

    McLean, Harry S.; Higginson, D. P.; Schmidt, A.; Tummel, K. K.; Shumlak, U.; Nelson, B. A.; Claveau, E. L.; Forbes, E. G.; Golingo, R. P.; Stepanov, A. D.; Weber, T. R.; Zhang, Y.


    We present a conceptual design, scaling calculations, and development path for a pulsed fusion reactor based on a flow-stabilized Z-pinch. Experiments performed on the ZaP and ZaP-HD devices have largely demonstrated the basic physics of sheared-flow stabilization at pinch currents up to 100 kA. Initial experiments on the FuZE device, a high-power upgrade of ZaP, have achieved 20 usec of stability at pinch current 100-200 kA and pinch diameter few mm for a pinch length of 50 cm. Scaling calculations based on a quasi-steady-state power balance show that extending stable duration to 100 usec at a pinch current of 1.5 MA and pinch length of 50 cm, results in a reactor plant Q 5. Future performance milestones are proposed for pinch currents of: 300 kA, where Te and Ti are calculated to exceed 1-2 keV; 700 kA, where DT fusion power would be expected to exceed pinch input power; and 1 MA, where fusion energy per pulse exceeds input energy per pulse. This work funded by USDOE ARPA-E and performed under the auspices of Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344. LLNL-ABS-734770.

  19. Combination hyperthermia and intraarterial 5-FU for metastatic colon carcinoma to liver

    Moseley, H.S.; Palmquist, M.


    Metastatic colorectal carcinoma to the liver remains a formidable challenge. Responses to chemotherapy are brief and the number of effective drugs is very limited. A phase II trial of hepatic hyperthermia and intraarterial chemotherapy was undertaken to attempt to improve response rates and duration. Patients were given a 10 day course of IA 5-FU at 15 mg/kg. During the infusion hyperthermia was given five times using the BSD Annular Phased Array (APA). Thermistors were placed percutaneously into normal liver and tumor using ultrasound or CT scan guidance. Six patients have been treated. Significant problems in positioning ill patients in the APA were encountered, and there was difficulty also in preventing heating throughout the abdominal cavity. Four patients, all with poor performance status, failed to benefit. One patient had improvement in liver function studies for two months and failed to respond on a repeat course. One patient had a complete response which is continuing over 18 months with a liver scan reverting to normal and CEA returning to normal. These preliminary results are promising and warrant further trials

  20. Electromiographic and kinematic characteristics of Kung Fu Yau-Man palm strike.

    Neto, O P; Magini, Marcio


    A kinematic and electromyographic analysis of Kung Fu (KF) Yau-Man palm strikes without impact is presented. An empirical model applied to data obtained by a high-speed camera describes the kinematic characteristics of the movement. The electromyographic patterns of the biceps brachii, brachioradialis and triceps brachii muscles were studied during the strike in the time (root mean square) and frequency (wavelet transform) domains. Eight KF practitioners participated in the investigation. A wooden board was placed in front of the subjects, and they were asked to perform the strike imagining a target above the board. The results show that the Yau-Man KF palm strike has very similar kinematic characteristics to a simple moderate speed elbow extension movement. All practitioners positioned themselves in relation to the wooden board in a way to achieve their highest hand speeds in the instant their hands crossed the board. The analyses of the electromyography data shows a well developed muscle coordination of the practitioners in agreement with kinematic results. The results of this paper are important not only for improving the performance of practitioners but also to demonstrate the applicability of KF in the process of motor control development.

  1. Kung fu training improves physical fitness measures in overweight/obese adolescents: the "martial fitness" study.

    Tsang, Tracey W; Kohn, Michael R; Chow, Chin Moi; Fiatarone Singh, Maria Antoinette


    Aim. To examine the efficacy of a six-month Kung Fu (KF) program on physical fitness in overweight/obese adolescents. Methods. Subjects were randomly assigned to the KF or sham exercise (Tai Chi, TC) control group. Physical measurements in cardiovascular fitness and muscle fitness occurred at baseline and after 6 months of training thrice weekly. Results. Twenty subjects were recruited. One subject was lost to follow-up, although overall compliance to the training sessions was 46.7 +/- 27.8%. At follow-up, the cohort improved in absolute upper (P = .002) and lower (P = .04) body strength, and upper body muscle endurance (P = .02), without group differences. KF training resulted in significantly greater improvements in submaximal cardiovascular fitness (P = .03), lower body muscle endurance (P = .28; significant 95% CI: 0.37-2.49), and upper body muscle velocity (P = .03) relative to TC training. Conclusions. This short-term KF program improved submaximal cardiovascular fitness, lower body muscle endurance, and muscle velocity, in overweight/obese adolescents with very low baseline fitness.

  2. Die Osteonekrose des Fußes: Eine Übersicht

    Schenk S


    Full Text Available Die Osteonekrose (ON am Fuß ist eine heterogene Gruppe von Krankheitsbildern, die sich deutlich hinsichtlich Klinik, Verlauf, Prädilektionsalter und Prognose unterscheiden. Ebenso sind die Ursachen für diese Erkrankungen vielfältig: Neben idiopathischen finden sich auch posttraumatische und postoperative Formen. Seltene Ursachen sind Kollagenosen, Stoffwechselerkrankungen wie Diabetes mellitus und Kortikoidtherapie. ON finden sich gehäuft nach Nierentransplantationen. Je nach Ursache tritt eine ON gehäuft in typischer Lokalisation auf. Idiopathische Formen findet man am Os naviculare pedis – Morbus Köhler 1 (MK1, an den Metatarsaleköpfchen – Morbus Köhler 2, "Freiberg’s disease" (MK2, an den Sesambeinen und an der Apophyse des Calcaneus. Operationsbedingte Fälle sind gehäuft am Metatarsaleköpfchen 1 nach Versorgung eines Hallux valgus lokalisiert, posttraumatische Nekrosen am Talus. In diesem Artikel werden die idiopathischen Formen hinsichtlich Klinik und Therapie näher beleuchtet. Bezüglich der Therapie gibt es konservative und operative Ansätze. Die wissenschaftlichen Daten zur Behandlung von idiopathischen Nekrosen sind spärlich, die Behandlungsstrategien jedoch einheitlich und allgemein anerkannt.

  3. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Zakharia, Zeena


    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  4. Enteric coated HPMC capsules plugged with 5-FU loaded microsponges: a potential approach for treatment of colon cancer

    Ankita Gupta


    Full Text Available The work was aimed at developing novel enteric coated HPMC capsules (ECHC plugged with 5 Florouracil (5-FU loaded Microsponges in combination with calcium pectinate beads. Modified quasi-emulsion solvent diffusion method was used to formulate microsponges based on 32 factorial design and the effects of independent variables (volume of organic solvent and Eudragit RS100 content on the dependent variables (Particle size, %EE & % CDR were determined. The optimized microsponges (F4 were characterized by SEM, PXRD, TGA and were plugged along with calcium pectinate beads in HPMC capsules and the HPMC capsules were further coated with enteric polymer Eudragit L 100 (Ed-L100 and/ or Eudrgit S 100 (Ed-S 100 in different proportions. In vitro release study of ECHC was performed in various release media sequentially SGF for 2 h, followed by SIF for the next 6 h and then in SCF (in the presence and absence of pectinase enzyme for further 16 h. Drug release was retarded on coating with EdS-100 in comparison to blend of EdS-100: EdL-100 coating. The percentage of 5-FU released at the end of 24 h from ECHC 3 was 97.83 ± 0.12% in the presence of pectinase whereas in control study it was 40.08 ± 0.02% drug. The optimized formulation was subjected to in vivo Roentgenographic studies in New Zealand white rabbits to analyze the in vivo behavior of the developed colon targeted capsules. Pharmacokinetic studies in New Zealand white rabbits were conducted to determine the extent of systemic exposure provided by the developed formulation in comparison to 5-FU aqueous solutions. Thus, enteric coated HPMC capsules plugged with 5-FU loaded microsponges and calcium pectinate beads proved to be promising dosage form for colon targeted drug delivery to treat colorectal cancer.

  5. Preoperative 5-FU, low-dose leucovorin, and radiation therapy for locally advanced and unresectable rectal cancer

    Minsky, Bruce D.; Cohen, Alfred M.; Enker, Warren E.; Saltz, Leonard; Guillem, Jose G.; Paty, Philip B.; Kelsen, David P.; Kemeny, Nancy; Ilson, David; Bass, Joanne; Conti, John


    Purpose: We report the local control and survival of two Phase I dose escalation trials of combined preoperative 5-fluorouracil (5-FU), low-dose leucovorin (LV), and radiation therapy followed by postoperative LV/5-FU for the treatment of patients with locally advanced and unresectable rectal cancer. Methods and Materials: A total of 36 patients (30 primary and 6 recurrent) received two monthly cycles of LV/5-FU (bolus daily x 5). Radiation therapy (50.40 Gy) began on day 1 in the 25 patients who received concurrent treatment and on day 8 in the 11 patients who received sequential treatment. Postoperatively, patients received a median of four monthly cycles of LV/5-FU. Results: The resectability rate with negative margins was 97%. The complete response rate was 11% pathologic and 14% clinical for a total of 25%. The 4-year actuarial disease-free survival was 67% and the overall survival was 76%. The crude local failure rate was 14% and the 4-year actuarial local failure rate was 30%. Crude local failure was lower in the four patients who had a pathologic complete response (0%) compared with those who either did not have a pathologic complete response (16%) or who had a clinical complete response (20%). Conclusion: Our preliminary data with the low-dose LV regimen reveal encouraging downstaging, local control, and survival rates. Additional follow-up is needed to determine the 5-year results. The benefit of downstaging on local control is greatest in patients who achieve a pathologic complete response

  6. Producing High-Performance, Stable, Sheared-Flow Z-Pinches in the FuZE project

    Golingo, R. P.; Shumlak, U.,; Nelson, B. A.; Claveau, E. L.; Forbes, E. G.; Stepanov, A. D.; Weber, T. R.; Zhang, Y.; McLean, H. S.; Tummel, K. K.; Higginson, D. P.; Schmidt, A. E.; University of Washington (UW) Collaboration; Lawrence Livermore National Laboratory (LLNL) Collaboration


    The Fusion Z-Pinch Experiment (FuZE) has made significant strides towards generating high-performance, stable Z-pinch plasmas with goals of ne = 1018 cm-3 and T =1 keV. The Z-pinch plasmas are stabilized with a sheared axial flow that is driven by a coaxial accelerator. The new FuZE device has been constructed and reproduces the major scientific achievements the ZaP project at the University of Washington; ne = 1016 cm-3,T = 100 eV, r20 μs. These parameters are measured with an array of magnetic field probes, spectroscopy, and fast framing cameras. The plasma parameters are achieved using a small fraction of the maximum energy storage and gas injection capability of the FuZE device. Higher density, ne = 5×1017 cm-3, and temperature, T = 500 eV, Z-pinch plasmas are formed by increasing the pinch current. At the higher voltages and currents, the ionization rates in the accelerator increase. By modifying the neutral gas profile in the accelerator, the plasma flow from the accelerator is maintained, driving the flow shear. Formation and sustainment of the sheared-flow Z-pinch plasma will be discussed. Experimental data demonstrating high performance plasmas in a stable Z-pinches will be shown. This work is supported by an award from US ARPA-E.

  7. TS gene polymorphisms are not good markers of response to 5-FU therapy in stage III colon cancer patients.

    Fariña-Sarasqueta, A; Gosens, M J E M; Moerland, E; van Lijnschoten, I; Lemmens, V E P P; Slooter, G D; Rutten, H J T; van den Brule, Adriaan J C


    Although the predictive and prognostic value of thymidylate synthase (TS) expression and gene polymorphism in colon cancer has been widely studied, the results are inconclusive probably because of methodological differences. With this study, we aimed to elucidate the role of TS gene polymorphisms genotyping in therapy response in stage III colon carcinoma patients treated with 5-FU adjuvant chemotherapy. 251 patients diagnosed with stage III colon carcinoma treated with surgery followed by 5-FU based adjuvant therapy were selected. The variable number of tandem repeats (VNTR) and the single nucleotide polymorphism (SNP) in the 5'untranslated region of the TS gene were genotyped. There was a positive association between tumor T stage and the VNTR genotypes (p = 0.05). In both univariate and multivariate survival analysis no effects of the studied polymorphisms on survival were found. However, there was an association between both polymorphisms and age. Among patients younger than 60 years, the patients homozygous for 2R seemed to have a better overall survival, whereas among the patients older than 67 this longer survival was seen by the carriers of other genotypes. We conclude that the TS VNTR and SNP do not predict response to 5-FU therapy in patients with stage III colon carcinoma. However, age appears to modify the effects of TS polymorphisms on survival.

  8. Spectral energy distribution analysis of class I and class II FU Orionis stars

    Gramajo, Luciana V.; Gómez, Mercedes [Observatorio Astronómico, Universidad Nacional de Córdoba, Argentina, Laprida 854, 5000 Córdoba (Argentina); Rodón, Javier A., E-mail:, E-mail:, E-mail: [European Southern Observatory, Alonso de Córdova 3107, Vitacura, Casilla 19001, Santiago 19 (Chile)


    FU Orionis stars (FUors) are eruptive pre-main sequence objects thought to represent quasi-periodic or recurring stages of enhanced accretion during the low-mass star-forming process. We characterize the sample of known and candidate FUors in a homogeneous and consistent way, deriving stellar and circumstellar parameters for each object. We emphasize the analysis in those parameters that are supposed to vary during the FUor stage. We modeled the spectral energy distributions of 24 of the 26 currently known FUors, using the radiative transfer code of Whitney et al. We compare our models with those obtained by Robitaille et al. for Taurus class II and I sources in quiescence periods by calculating the cumulative distribution of the different parameters. FUors have more massive disks: we find that ∼80% of the disks in FUors are more massive than any Taurus class II and I sources in the sample. Median values for the disk mass accretion rates are ∼10{sup –7} M {sub ☉} yr{sup –1} versus ∼10{sup –5} M {sub ☉} yr{sup –1} for standard young stellar objects (YSOs) and FUors, respectively. While the distributions of envelope mass accretion rates for class I FUors and standard class I objects are similar, FUors, on average, have higher envelope mass accretion rates than standard class II and class I sources. Most FUors (∼70%) have envelope mass accretion rates above 10{sup –7} M {sub ☉} yr{sup –1}. In contrast, 60% of the classical YSO sample has an accretion rate below this value. Our results support the current scenario in which changes experimented by the circumstellar disk explain the observed properties of these stars. However, the increase in the disk mass accretion rate is smaller than theoretically predicted, although in good agreement with previous determinations.

  9. Physiological, performance, and nutritional profile of the Brazilian Olympic Wushu (kung-fu) team.

    Artioli, Guilherme Giannini; Gualano, Bruno; Franchini, Emerson; Batista, Rafael Novaes; Polacow, Viviane Ozores; Lancha, Antonio Herbert


    The purpose of the present study was to determine physiological, nutritional, and performance profiles of elite Olympic Wushu (kung-fu) athletes. Ten men and four women elite athletes took part in the study. They completed the following tests: body composition, nutritional assessment, upper-body Wingate Test, vertical jump, lumbar isometric strength, and flexibility. Blood lactate was determined at rest and after the Wingate Test. Blood lactate was also determined during a training session (combat and Taolu training). We found low body fat (men: 9.5 +/- 6.3%; women: 18.0 +/- 4.8%), high flexibility (sit-and-reach-men: 45.5 +/- 6.1 cm; women: 44.0 +/- 6.3 cm), high leg power (vertical jump-men: 37.7 +/- 8.4 cm; women: 32.3 +/- 1.1 cm), high lumbar isometric strength (men: 159 +/- 13 cm; women: 94 +/- 6 cm), moderate arm mean and peak power (Wingate Test-men: 4.1 +/- 0.4 and 5.8 +/- 0.5 Wxkg, respectively; women: 2.5 +/- 0.3 and 3.4 +/- 0.3, respectively), and elevated blood lactate after the Wingate Test (men: 10.8 +/- 2.0 mmolxL; women: 10.2 +/- 2.0 mmolxL) and during training (combat: 12.0 +/- 1.8 mmolxL; Taolu: 7.7 +/- 3.3 mmolxL). Men athletes consume a high-fat, low-carbohydrate diet, whereas women consume a moderate, high-carbohydrate diet. Energy consumption was markedly variable. In conclusion, Olympic Wushu seems to be a highly anaerobic-dependent combat sport. Low body fat, high flexibility, leg anaerobic power, isometric strength, and moderately high arm anaerobic power seem to be important for successful competitive performance.

  10. Dinâmica sedimentar e feições sedimentares identificadas na superfície de fundo do sistema Cananéia-Iguape, SP

    Moysés Gonsalez Tessler


    Full Text Available O sistema Cananéia-Iguape é separado do oceano pela Ilha Comprida, com aproximadamente 70 km de extensão, tendo como limites ao sul e ao norte, respectivamente, as desembocaduras de Cananéia e Icapara. Estudos sobre as modificações na configuração das margens do sistema, no padrão de distribuição sedimentar, bem como sobre o conhecimento do padrão hidrodinâmico evidenciaram a interrelação existente entre os mecanismos de circulação geral, condicionados principalmente pelas correntes geradas pelas marés e a variação temporal de descarga de água doce, e a distribuição espacial dos sedimentos de superfície dos fundos dos canais. Dentre as feições sedimentares identificadas nas superfícies de fundo destacam-se as ocorrências de marcas onduladas de grande porte (1 a 2 metros de altura e comprimentos de onda de 20 a 30 metros concentradas no canal entre a Ponta do Frade (Mar de Cananéia e a foz do Rio Subaúma (Mar Pequeno. Estas feições de fundo resultam da dinâmica junto aos fundos dos canais, sob forte influência das correntes de maré, sobre sedimentos predominantemente arenosos, cujas fontes atuais são os depósitos quaternários de planície costeira depositados durante os eventos transgressivos/regressivos quaternários. A análise das orientações das correntes de maré, indicadas pelas marcas onduladas assimétricas, permite concluir que o local que representa, no processo hidrodinâmico da área, o ponto de inversão do sentido das marés vazantes, anteriormente atribuído à área da Pedra do "Tombo", apresenta-se, na verdade, deslocado cerca de 10 km no sentido SW.Cananéia-Iguape coastal system is located in the Southern part of São Paulo State. A 72 km long barrier beach named Ilha Comprida separates it from the Atlantic Oceano Based on studies of the evolution of channel margins, bottom sediment distribution and hydrodynamic pattern of the Cananéia-Iguape system, a relationship between the general

  11. The new open Flexible Emission Inventory for Greece and the Greater Athens Area (FEI-GREGAA): Account of pollutant sources and their importance from 2006 to 2012

    Fameli, Kyriaki-Maria; Assimakopoulos, Vasiliki D.


    Photochemical and particulate pollution problems persist in Athens as they do in various European cities, despite measures taken. Although, for many cities, organized and updated pollutant emissions databases exist, as well as infrastructure for the support of policy implementation, this is not the case for Greece and Athens. So far abstract efforts to create inventories from temporal and spatial annual low resolution data have not lead to the creation of a useful database. The objective of this study was to construct an emission inventory in order to examine the emission trends in Greece and the Greater Athens Area for the period 2006-2012 on a spatial scale of 6 × 6 km2 and 2 × 2 km2, respectively and on a temporal scale of 1 h. Emissions were calculated from stationary combustion sources, transportation (road, navigation and aviation), agriculture and industry obtained from official national and European sources. Moreover, new emission factors were calculated for road transport and aviation. The final database named F.E.I. - GREGAA (Flexible Emission Inventory for GREece and the GAA) is open-structured so as to receive data updates, new pollutants, various emission scenarios and/or different emission factors and be transformed for any grid spacing. Its main purpose is to be used in applications with photochemical models to contribute to the investigation on the type of sources and activities that lead to the configuration of air quality. Results showed a decreasing trend in CO, NOx and VOCs-NMVOCs emissions and an increasing trend from 2011 onwards in PM10 emissions. Road transport and small combustion contribute most to CO emissions, road transport and navigation to NOx and small combustion and industries to PM10. The onset of the economic crisis can be seen from the reduction of emissions from industry and the increase of biomass burning for heating purposes.

  12. Post-operative chemosensitized radiation with modulated 5-fluorouracil (5-FU) following resection of adenocarcinoma of the esophagus and esophagogastric (EG) junction

    Kurtzman, S.M.; Whittington, R.; Vaughn, D.; Rosato, E.F.; Haller, D.G.


    Purpose: To evaluate the survival and toxicity of post-operative chemosensitized radiation with modulated 5-FU chemotherapy in patients with resected adenocarcinomas of the esophagus and EG junction. Materials and Methods: One hundred and ninety-two patients with localized adenocarcinomas of the esophagus and EG junction were treated with single or combined modality therapy. The results in the first 165 patients treated between 1972 and 1989 demonstrated that survival was improved with chemosensitized radiation therapy following surgical resection. In the final group of patients treated between 1985 and 1989 a 96 hour inpatient 5-FU infusion was used to provide chemosensitization in those patients. Twenty-seven patients have been treated between January 1990 and December 1994 using a new outpatient regimen with modulated 5-FU chemotherapy for chemosensitization. Radiation and chemotherapy commenced within 6 weeks of surgery. The dose of radiation was 54 Gy in patients with no residual tumor, and 59.4 to 63.0 Gy in patients with positive margins or residual tumor. Modulated 5-FU using bolus 5-FU with Leukovorin +/-α-interferon (α-IFN) was given during the first and fifth week of radiation. Results: Median follow-up of surviving patients treated with modulated 5-FU is 15 months (max - 46 mos). Survival is 71% at 1 year, 45% at 2 years and 39% at 3 years. This compares favorably with the survival with 5-FU infusion, 75% - 1 year, 35% - 2 year, and 10% - 3 year. The toxicity of modulated 5-FU was no different from that observed in patients treated with 5-FU infusion. Three patients treated with modulated 5-FU leukovorin and α-IFN required intravenous hydration, and two patients experienced grade 3 leukopenia. There were two radiation related events in these patients, one case of radiation pneumonitis and one patient with pericarditis. Conclusions: Based on this experience, aggressive therapy of adenocarcinomas of the esophagus and EG junction with surgery and

  13. Preoperative Capecitabine and Pelvic Radiation in Locally Advanced Rectal Cancer-Is it Equivalent to 5-FU Infusion Plus Leucovorin and Radiotherapy?

    Chan, Alexander K.; Wong, Alfred O.; Jenken, Daryl A.


    Purpose: The aim of this retrospective case-matching study was to compare the treatment outcomes and acute toxicity of preoperative radiotherapy (RT) with capecitabine vs. preoperative RT with intermittent 5-fluorouracil (5-FU) infusion, leucovorin, and mitomycin C in rectal cancer. Methods and Materials: We matched 34 patients who were treated with preoperative concurrent capecitabine and 50 Gy of RT by their clinical T stage (T3 or T4) and the tumor location (≤7 cm or >7 cm from the anal verge) with another 68 patients who were treated with preoperative intermittent 5-FU infusion, leucovorin, mitomycin C, and 50 Gy of RT for a comparison of the pathologic tumor response, local control, distant failure, and survival rates. Results: The pathologic complete response rate was 21% with capecitabine and 18% with 5-FU and leucovorin (p = 0.72). The rate of T downstaging after chemoradiation was 59% for both groups. The rate of sphincter-sparing resection was 38% after capecitabine plus RT and 43% after 5-FU plus RT (p = 0.67). At 3 years, there was no significant difference in the local control rate (93% for capecitabine and 92% for 5-FU and leucovorin), relapse-free rate (74% for capecitabine and 73% for 5-FU and leucovorin), or disease-specific survival rate (86% for capecitabine and 77% for 5-FU and leucovorin). The acute toxicity profile was comparable, with little Grade 3 and 4 toxicity. Conclusions: When administered with concurrent preoperative RT, both capecitabine and intermittent 5-FU infusion with leucovorin modulation provided comparable pathologic tumor response, local control, relapse-free survival, and disease-specific survival rates in rectal cancer.

  14. Apigenin potentiates the antitumor activity of 5-FU on solid Ehrlich carcinoma: Crosstalk between apoptotic and JNK-mediated autophagic cell death platforms

    Gaballah, Hanaa H., E-mail: [Medical Biochemistry and Molecular Biology Department, Faculty of Medicine, Tanta University, Tanta, 3111 (Egypt); Gaber, Rasha A. [Medical Biochemistry and Molecular Biology Department, Faculty of Medicine, Tanta University, Tanta, 3111 (Egypt); Mohamed, Darin A. [Histopathology Department, Faculty of Medicine, Tanta University, Tanta, 3111 (Egypt)


    Background: Although 5- Fluorouracil (5-FU) has exhibited effectiveness against cancer, novel therapeutic strategies are needed to enhance its antitumor efficiency and modulate its cytotoxity. Apigenin, a flavonoid present in fruits and vegetables, is a potent dietary phytochemical effective in cancer chemoprevention. Aim: This study was undertaken to investigate the potential synergistic antitumor activity of apigenin and 5-FU on Solid Ehrlich carcinoma (SEC). Methods: Eighty Swiss albino male mice were divided into four equal groups: vehicle treated control SEC, SEC + 5-FU, SEC + apigenin, SEC + 5-FU + apigenin. Beclin-1 and caspases 3, 9 and JNK activities were estimated by ELISA; mRNA expression levels of the antiapoptotic gene Mcl-1 were estimated using quantitative real-time RT-PCR, while tissue malondialdehyde (MDA), glutathione peroxidase and total antioxidant capacity were evaluated spectrophotometrically. A part of the tumor was examined for histopathological and Ki-67 immunohistochemistry analysis. Results: 5-FU and/or apigenin caused significant increase in tissue levels of Beclin-1, caspases 3, 9 and JNK activities, MDA with significant decrease in tumor volume, Mcl-1expression, tissue glutathione peroxidase and total antioxidant capacity and alleviated the histopathological changes with significant decrease of Ki-67 proliferation index compared to vehicle treated SEC control group. In conclusion: The combination of 5-FU and apigenin had a greater effect than each of 5-FU or apigenin alone against solid Ehrlich carcinoma in mice. - Highlights: • Apigenin potentiated 5-FU cytotoxicity in EAC solid tumor models in vivo. • It acted via autophagy stimulation, downregulating MCL-1 and Ki-67 expression. • It caused JNK activation and ROS accumulation; resulted in tumor growth inhibition. • Apigenin can be used as a co-adjuvant agent in cancer therapy.

  15. [Study of the immunological mechanism of anti-tumor effects of 5-FU by establishing EL4 tumor-bearing mouse models].

    Li, Mo-Lin; Li, Chuan-Gang; Shu, Xiao-Hong; Li, Ming-Xia; Jia, Yu-Jie; Qin, Zhi-Hai


    To investigate the immunological mechanism of anti-tumor effect of 5-FU by establishing lymphoma EL4 tumor-bearing mouse models in wild type C57BL/6 mice and nude C57BL/6 mice, respectively. The mouse lymphoma EL4 cells were inoculated subcutaneously into wild type C57BL/6 mice (immune-competent mice). Twelve days later, 5-FU of different doses was administered intraperitoneally to treat these wild type C57BL/6 tumor-bearing mice. The size of tumors in the wild type C57BL/6 mice was observed and recorded to explore the minimal dose of 5-FU that could cure the tumor-bearing mice. Then the same amount of EL4 tumor cells was inoculated subcutaneously into wild type C57BL/6 mice and nude C57BL/6 mice (T cell-deficient mice) simultaneously, which had the same genetic background of C57BL/6. Twelve days later, 5-FU of the minimal dose was given intraperitoneally to treat both the wild type and nude C57BL/6 tumor-bearing mice. The size of tumors in the two different types of mice was observed and recorded. A single dose of 5-FU (75 mg/kg) cured both the EL4 tumor-bearing wild type C57BL/6 mice and the EL4 tumor-bearing nude C57BL/6 mice in the first week. Two weeks after 5-FU treatment, all of the nude mice died of tumor relapse while most of the wild type C57BL/6 mice were fully recovered. A single dose of 5-FU has marked anti-tumor effects on lymphoma EL4 tumor-bearing C57BL/6 mice with or without T lymphocytes. The relapse of tumors after 5-FU treatment might be related to the function of T lymphocytes.

  16. Synthesis, characterization and in vitro evaluation of magnetic nanoparticles modified with PCL-PEG-PCL for controlled delivery of 5FU.

    Asadi, Nahideh; Annabi, Nasim; Mostafavi, Ebrahim; Anzabi, Maryam; Khalilov, Rovshan; Saghfi, Siamak; Mehrizadeh, Masoud; Akbarzadeh, Abolfazl


    Magnetic nanoparticles have properties that cause to apply them in cancer therapy and vehicles for the delivery of drugs such as 5FU, especially when they are modified with biocompatible copolymers. The aim of this study is to modify superparamagnetic iron oxide nanoparticles (SPIONPs) with PCL-PEG-PCL copolymers and then utilization of these nanoparticles for encapsulation of anticancer drug 5FU. The ring-opening polymerization (ROP) was used for the synthesis of PCL-PEG-PCL copolymer by ε-caprolactone (PCL) and polyethylene glycol (PEG2000). We used the double emulsion method (water/oil/water) to prepare 5FU-encapsulated Fe 3 O 4 magnetic nanoparticles modified with PCL-PEG-PCL copolymer. Chemical structure and magnetic properties of 5FU-loaded magnetic-polymer nanoparticles were investigated systematically by employing FT-IR, XRD, VSM and SEM techniques. In vitro release profile of 5FU-loaded NPs was also determined. The results showed that the encapsulation efficiency value for nanoparticles were 90%. Moreover, the release of 5FU is significantly higher at pH 5.8 compared to pH 7.4. Therefore, these nanoparticles have sustained release and can apply for cancer therapy.

  17. The compound Chinese medicine "Kang Fu Ling" protects against high power microwave-induced myocardial injury.

    Zhang, Xueyan; Gao, Yabing; Dong, Ji; Wang, Shuiming; Yao, Binwei; Zhang, Jing; Hu, Shaohua; Xu, Xinping; Zuo, Hongyan; Wang, Lifeng; Zhou, Hongmei; Zhao, Li; Peng, Ruiyun


    The prevention and treatment of Microwave-caused cardiovascular injury remains elusive. This study investigated the cardiovascular protective effects of compound Chinese medicine "Kang Fu Ling" (KFL) against high power microwave (HPM)-induced myocardial injury and the role of the mitochondrial permeability transition pore (mPTP) opening in KFL protection. Male Wistar rats (100) were divided into 5 equal groups: no treatment, radiation only, or radiation followed by treatment with KFL at 0.75, 1.5, or 3 g/kg/day. Electrocardiography was used to Electrophysiological examination. Histological and ultrastructural changes in heart tissue and isolated mitochondria were observed by light microscope and electron microscopy. mPTP opening and mitochondrial membrane potential were detected by confocal laser scanning microscopy and fluorescence analysis. Connexin-43 (Cx-43) and endothelial nitric oxide synthase (eNOS) were detected by immunohistochemistry. The expression of voltage-dependent anion channel (VDAC) was detected by western blotting. At 7 days after radiation, rats without KFL treatment showed a significantly lower heart rate (P<0.01) than untreated controls and a J point shift. Myocyte swelling and rearrangement were evident. Mitochondria exhibited rupture, and decreased fluorescence intensity, suggesting opening of mPTP and a consequent reduction in mitochondrial membrane potential. After treatment with 1.5 g/kg/day KFL for 7 d, the heart rate increased significantly (P<0.01), and the J point shift was reduced flavorfully (P<0.05) compared to untreated, irradiated rats; myocytes and mitochondria were of normal morphology. The fluorescence intensities of dye-treated mitochondria were also increased, suggesting inhibition of mPTP opening and preservation of the mitochondrial membrane potential. The microwave-induced decrease of Cx-43 and VDAC protein expression was significantly reversed. Microwave radiation can cause electrophysiological, histological and

  18. The compound Chinese medicine "Kang Fu Ling" protects against high power microwave-induced myocardial injury.

    Xueyan Zhang

    Full Text Available BACKGROUND: The prevention and treatment of Microwave-caused cardiovascular injury remains elusive. This study investigated the cardiovascular protective effects of compound Chinese medicine "Kang Fu Ling" (KFL against high power microwave (HPM-induced myocardial injury and the role of the mitochondrial permeability transition pore (mPTP opening in KFL protection. METHODS: Male Wistar rats (100 were divided into 5 equal groups: no treatment, radiation only, or radiation followed by treatment with KFL at 0.75, 1.5, or 3 g/kg/day. Electrocardiography was used to Electrophysiological examination. Histological and ultrastructural changes in heart tissue and isolated mitochondria were observed by light microscope and electron microscopy. mPTP opening and mitochondrial membrane potential were detected by confocal laser scanning microscopy and fluorescence analysis. Connexin-43 (Cx-43 and endothelial nitric oxide synthase (eNOS were detected by immunohistochemistry. The expression of voltage-dependent anion channel (VDAC was detected by western blotting. RESULTS: At 7 days after radiation, rats without KFL treatment showed a significantly lower heart rate (P<0.01 than untreated controls and a J point shift. Myocyte swelling and rearrangement were evident. Mitochondria exhibited rupture, and decreased fluorescence intensity, suggesting opening of mPTP and a consequent reduction in mitochondrial membrane potential. After treatment with 1.5 g/kg/day KFL for 7 d, the heart rate increased significantly (P<0.01, and the J point shift was reduced flavorfully (P<0.05 compared to untreated, irradiated rats; myocytes and mitochondria were of normal morphology. The fluorescence intensities of dye-treated mitochondria were also increased, suggesting inhibition of mPTP opening and preservation of the mitochondrial membrane potential. The microwave-induced decrease of Cx-43 and VDAC protein expression was significantly reversed. CONCLUSION: Microwave radiation can

  19. Maps of Relocation and Poems of Tang Dynasty Poets: Li Bai, Du Fu, and Han Yu

    羅鳳珠、白璧玲、廖泫銘、范毅軍 、鄭錦全 Feng-Ju Lo,Pi-Ling Pai,Hsiung-Ming Liao,I-Chun Fan,Chin-Chuan Cheng


    Full Text Available Geographic environments affect literary contents and genre and thus, since ancient times, geographical area has been used to classify Chinese literature. In 1936 Liang Qichao was keenly aware of the relationship between literature and geography and brought up the idea of “literarygeography”. In 1979 Professor Chen Zhengxiang produced maps of birthplaces of Tang and Song poets to show the shift of Chinese cultural center from north to south. Furthermore, in the pastdecade, the attention to research in literary geography and geographical distribution of writersgradually increased. However, most studies focused on geographical distribution of birthplaces of writers and very few focused on the relationship between poets’ journey and the contents of their writings and their geographic environment. Meanwhile, geographic information system and aerialphotography have developed quickly and have become useful tools for the study of literary geography.Since then, the academic circles in Taiwan have built a solid foundation in this area. While Li Baiand Du Fu were called poetic immortal and poetic sage of the middle and end periods of the heydayof Tang Dynasty, respectively, Han Yu advocated the classical Chinese movement and becameone of the eight great authors of Tang and Song dynasties. Han Yu was also the best representative of Middle Tang poets. While the styles of these three poets differed from each other, they held key positions in the development and evolution of Tang poetry. Their footprints spread all over the countryand greatly affected later developments and contemporary of poetry. This project makes use of the digital Tang Dynasty maps by Tan Qixiang, Tang Dynasty transportation route maps by Yan Gengwang,aerial maps, the All Tang Poems, and chronicles of the poets to build the three poets’ relocation maps and study their poetic literature, language, geography, and interactions with others, in hopesof opening a new research direction

  20. A randomized phase III multicenter trial comparing irinotecan in combination with the Nordic bolus 5-FU and folinic acid schedule or the bolus/infused de Gramont schedule (Lv5FU2) in patients with metastatic colorectal cancer

    Glimelius, B; Sørbye, H; Balteskard, L


    not differ (4% versus 6%, P = 0.3). Grade 3/4 neutropenia (11% versus 5%, P = 0.01) and grade 2 alopecia (18% versus 9%, P = 0.002) were more common in the FLIRI group. The 60-day mortality was 2.4% versus 2.1%. CONCLUSIONS: Irinotecan with the bolus Nordic schedule (FLIRI) is a convenient treatment with PFS...... and OS comparable to irinotecan with the Lv5FU2 schedule. Neutropenia and alopecia are more prevalent, but both regimens are equally well tolerated....

  1. Electromyographic Study of a Sequence of Yau-Man Kung Fu Palm Strikes with and without Impact.

    Neto, Osmar Pinto; Magini, Marcio; Pacheco, Marcos T T


    IN MARTIAL ARTS AND CONTACT SPORTS, STRIKES ARE OFTEN TRAINED IN TWO DIFFERENT WAYS: with and without impacts. This study aims to compare the electromyographical activity (EMG) of the triceps brachii (TB), biceps brachii (BB) and brachioradialis (BR) muscles during strikes with and without impacts. Eight Yau-Man Kung Fu practitioners participated in the experiment. Each participant performed 5 sequences of 5 consecutive KF Yau-Man palm strikes with no impact intercalated with 5 sequences of 5 repetitions targeting a KF training shield. Surface EMG signals were obtained from the TB, BB, and RB for 3.0 seconds using an eight-channel module with a total amplifier gain of 2000 and sampled at 3500 Hz. The EMG analyses were done in the time (rms) and frequency (wavelet) domains. For the frequency domain, Morlet wavelet power spectra were obtained and an original method was used to quantify statistically significant regions on the power spectra. The results both in the time and frequency domains indicate a higher TB and BR muscle activity for the strikes with impacts. No significant difference was found for the BB in the two different scenarios. In addition, the results show that the wavelet power spectra pattern for the three analysed muscles obtained from the strikes with and without impacts were similar. Key pointsEMG analysis of a sequence of Kung Fu strikes demonstrates higher Triceps Brachii and Brachioradialis muscle activity for strikes with impact than strikes without impact.An original reliable method for quantifying EMG wavelet transform results is presented.EMG wavelet power spectra describe muscle roles during a Kung Fu sequence of strikes.


    Fischer, William J.; Megeath, S. Thomas; Kounkel, Marina [Department of Physics and Astronomy, University of Toledo, 2801 West Bancroft Street, Toledo, OH 43606 (United States); Tobin, John J. [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Stutz, Amelia M.; Henning, Thomas [Max-Planck-Institut fuer Astronomie, Koenigstuhl 17, D-69117 Heidelberg (Germany); Ali, Babar [NHSC/IPAC/Caltech, 770 South Wilson Avenue, Pasadena, CA 91125 (United States); Remming, Ian; Manoj, P. [Department of Physics and Astronomy, 500 Wilson Boulevard, University of Rochester, Rochester, NY 14627 (United States); Stanke, Thomas [ESO, Karl-Schwarzschild-Strasse 2, D-85748 Garching bei Muenchen (Germany); Osorio, Mayra [Instituto de Astrofisica de Andalucia, CSIC, Camino Bajo de Huetor 50, E-18008, Granada (Spain); Wilson, T. L., E-mail: [Naval Research Laboratory, 4555 Overlook Avenue SW, Washington, DC 20375 (United States)


    Individual outbursting young stars are important laboratories for studying the physics of episodic accretion and the extent to which this phenomenon can explain the luminosity distribution of protostars. We present new and archival data for V2775 Ori (HOPS 223), a protostar in the L 1641 region of the Orion molecular clouds that was discovered by Caratti o Garatti et al. to have recently undergone an order-of-magnitude increase in luminosity. Our near-infrared spectra of the source have strong blueshifted He I {lambda}10830 absorption, strong H{sub 2}O and CO absorption, and no H I emission, all typical of FU Orionis sources. With data from the Infrared Telescope Facility, the Two Micron All Sky Survey, the Hubble Space Telescope, Spitzer, the Wide-field Infrared Survey Explorer, Herschel, and the Atacama Pathfinder Experiment that span from 1 to 70 {mu}m pre-outburst and from 1 to 870 {mu}m post-outburst, we estimate that the outburst began between 2005 April and 2007 March. We also model the pre- and post-outburst spectral energy distributions of the source, finding it to be in the late stages of accreting its envelope with a disk-to-star accretion rate that increased from {approx}2 Multiplication-Sign 10{sup -6} M{sub Sun} yr{sup -1} to {approx}10{sup -5} M{sub Sun} yr{sup -1} during the outburst. The post-outburst luminosity at the epoch of the FU Orionis-like near-IR spectra is 28 L{sub Sun }, making V2775 Ori the least luminous documented FU Orionis outburster with a protostellar envelope. The existence of low-luminosity outbursts supports the notion that a range of episiodic accretion phenomena can partially explain the observed spread in protostellar luminosities.

  3. Concurrent chemoradiotherapy with nedaplatin and 5-fluorouracil (5-FU) for locally advanced squamous cell carcinoma of the esophagus

    Kubo, Naoshi; Morimoto, Junya; Tanaka, Hiroaki


    Concurrent chemoradiotherapy (CRT) using cisplatin (CDDP) and 5-fluorouracil (5-FU) is the standard treatment for unresectable locally advanced esophageal carcinoma. Although this regimen has been widely accepted in Japan, the adverse effect of CDDP such as gastrointestinal and renal toxicity may sometimes be the cause of interruption of the treatment, especially among the elderly patients. Cis-diammine-glycolatoplatinum (nedaplatin: CDGP) is a new platinum agent, which was developed with the aim of decreasing renal and gastrointestinal toxicities but maintaining the effectiveness of CDDP. We reported the efficacy and safety of CRT using CDGP and 5-FU for locally advanced squamous cell carcinoma of the esophagus. Between January 2001 and December 2007, 65 patients with locally advanced esophageal cancer (39 patients with unresectable tumor (cT4) and 26 patients with distant lymphnode or bulky lymphnode metastasis) were eligible and given informed consent and cared by the Department of Surgical Oncology of Osaka City University. Patients received a continuous infusion of 5-FU (250 mg/body) on days 1-21. CDGP was administered at the dose of 10 mg/body by bolus infusion for 1 hour on days 1-5, 8-12 and 15-19 just before radiotherapy. Radiotherapy was delivered in 1.8 Gy fractions, 5 days/week for 4 weeks. For the effective cases of CRT, a surgical resection was followed subsequently and an additional radiotherapy at the dose of 20 Gy was performed for non-effective cases. Complete or partial response was achieved in 46 patients (71%). Hematologic toxicities such as grades 3 and 4 leucocytopenia developed in 19 patients and thrombocytopenia developed in 20 patients, which were well tolerated by conservative therapy. Gastrointestinal and renal toxicities were developed in only a few patients. There was no CRT-related death. Of all 65 patients, 25 patients underwent a surgical resection while 19 patients could receive a curative resection (R0 operation). In the resected

  4. Herbal medicine Guan Chang Fu Fang enhances 5-fluorouracil cytotoxicity and affects drug-associated genes in human colorectal carcinoma cells.

    Yu, Chen; Liu, Shen-Lin; Qi, Ming-Hao; Zou, Xi; Wu, Jian; Zhang, Jing


    Guan Chang Fu Fang (GCFF) is a natural compound, which is extracted from three medicinal plants, Agrimonia pilosa Ledeb ., Patrinia scabiosaefolia and Solanum nigrum L . GCFF has demonstrated clinical efficacy in the treatment of colon cancer. At present, 5-fluorouracil (5-FU) is the primary active chemotherapeutic agent used for treating colon cancer. Using median-effect and apoptosis analyses, fluorescence microscopy and western blotting, the present study analyzed the association between GCFF and 5-FU in the human colon adenocarcinoma LoVo cell line. The effect of GCFF on the expression of chemotherapeutic agent-associated genes was also investigated. The results of the synergistic analysis revealed that GCFF exhibited a significant effect upon 5-FU-associated cytotoxicity within the LoVo cell line. This effect was observed over a broad dose-inhibition range (5-95%), but was particularly significant in the lower concentrations. The flow cytometry results revealed that low doses of GCFF or 5-FU induced S-phase arrest, as did a low-dose combination of the two drugs. After 48 h, GCFF significantly suppressed the expression levels of the chemotherapeutic agent resistance-associated genes within the colon cancer cells. The western blot analysis revealed that the combined effects of 5-FU and GCFF were due to a regulation of the B-cell lymphoma-2 family of proteins. The findings of the present study suggested that GCFF, when combined with 5-FU, has the potential to be a novel, chemotherapeutic compound for the treatment of colon cancer.

  5. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing


    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  6. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Liu Lili; Li Feng


    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  7. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties



    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  8. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Crespillo, M.L., E-mail: [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)


    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  9. [A case of advanced gastric cancer with carcinomatosa peritonitis effectively treated by 5-FU and low-dose CDDP therapy].

    Saito, E; Kunii, Y; Wada, G; Tsuchiya, S; Yamasaki, T; Sakakibara, N


    A 66-year-old woman was admitted to our clinic for appetite loss and abdominal distension in August 1995. Endoscopic study revealed an advanced gastric cancer in the upper body of her stomach. Abdominal CT study revealed massive ascites and para-aortic lymph nodal involvement. Cytological study of the ascites revealed class V. She was diagnosed to be in the terminal stage of gastric cancer with carcinomatosa peritonitis. Combination chemotherapy with 5-fluorouracil (5-FU) and low-dose cisplatin (CDDP) was given by continuous intravenous injection of 5-FU 500 mg/day, and intermittent intravenous injection of CDDP 30 mg/week was performed for reduction of the ascites and her complaint. Endoscopic study 6 weeks after starting chemotherapy could not find crater of the gastric cancer but only a shallow ulcerative lesion. The biopsy specimen of that lesion was group III. No ascites and over 50% reduction of the para-aortic lymph node were found by the abdominal CT study. This state persisted over 4 weeks. No myelo-suppression, renal dysfunction or any severe side effect were observed during chemotherapy. Her performance status improved from 3 to 1.

  10. Investigation on biochemical compositional changes during the microbial fermentation process of Fu brick tea by LC-MS based metabolomics.

    Xu, Jie; Hu, Feng-Lin; Wang, Wei; Wan, Xiao-Chun; Bao, Guan-Hu


    Fu brick tea (FBT) is a unique post-fermented tea product which is fermented with fungi during the manufacturing process. In this study, we investigated the biochemical compositional changes occurring during the microbial fermentation process (MFP) of FBT based on non-targeted LC-MS, which was a comprehensive and unbiased methodology. Our data analysis took a two-phase approach: (1) comparison of FBT with other tea products using PCA analysis to exhibit the characteristic effect of MFP on the formation of Fu brick tea and (2) comparison of tea samples throughout the MFP of FBT to elucidate the possible key metabolic pathways produced by the fungi. Non-targeted LC-MS analysis clearly distinguished FBT with other tea samples and highlighted some interesting metabolic pathways during the MFP including B ring fission catechin. Our study demonstrated that those fungi had a significant influence on the biochemical profiles in the FBT and consequently contributed to its unique quality. Copyright © 2014 Elsevier Ltd. All rights reserved.

  11. [Knockdown of DNA-PKcs inhibits cell cycle and its mechanism of drug-resistant Bel7402/5-Fu hepatocellular carcinoma cells].

    Li, Dayu; Liu, Yun; Yu, Chunbo; Liu, Xiping; Fan, Fang


    Objective To study the effect of the knock-down of the DNA-dependent protein kinase catalytic subunit (DNA-PKcs) on the cell cycle of the multidrug-resistant (MDR) Bel7402/5-Fu hepatocellular carcinoma cells and its MDR mechanism. Methods After cationic liposome-mediated siDNA-PKcs oligonucleotide transfection, the drug sensitivity of Bel7402/5-Fu cells to 5-fluorouracil (5-Fu) and adriamycin (ADM) was determined by MTT assay; the cell cycle were detected by flow cytometry; meanwhile, the protein expressions of cell cycle-related proteins P21, cell cycle protein B1 (cyclin B1), cell cycle division protein 2 (CDC2) were tested by Western blotting; the expressions of ataxia telangiectasia mutated (ATM) and p53 at both mRNA and protein levels were detected by real-time PCR and Western blot analysis. Results The MTT results showed siDNA-PKcs increased the chemotherapeutic sensitivity of Bel7402/5-Fu cells to 5-Fu and ADM. The flow cytometric analysis showed siDNA-PKcs decreased the percentage of S-phase cells but increased the percentage of G2/M phase cells. Western blotting showed siDNA-PKcs increased the protein expression of P21 but decreased cyclinB1 and CDC2 proteins. In addition, siDNA-PKcs also increased the expressions of ATM and p53. Conclusion DNA-PKcs silencing increases P21 while decreases cyclin B1 and CDC2 expressions, and finally induces G2/M phase arrest in Bel7402/5-Fu cells, which may be related to ATM-p53 signaling pathway.

  12. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.


    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  13. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: [Crystal Growth Centre, Anna University, Chennai 600 025 (India)


    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  14. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Curie Virág


    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  15. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    M. Carmen Hidalgo


    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  16. Non-viral genetic transfection of rat Schwann cells with FuGENE HD© lipofection and AMAXA© nucleofection is feasible but impairs cell viability.

    Kraus, Armin; Täger, Joachim; Kohler, Konrad; Haerle, Max; Werdin, Frank; Schaller, Hans-Eberhard; Sinis, Nektarios


    To determine transfection efficiency of FuGENE HD© lipofection and AMAXA© nucleofection on rat Schwann cells (SC). The ischiadic and median nerves of 6-8 week old Lewis rats were cultured in modified melanocyte-growth medium. SCs were genetically transfected with green fluorescent protein (GFP) as reporter gene using FuGENE HD© lipofection and AMAXA© nucleofection. Transfection rates were determined by visualization of GFP fluorescence under fluorescence microscopy and cell counting. Transfected cell to non-transfected cell relation was determined. Purity of Schwann cell culture was 88% as determined by immunohistologic staining. Transfection rate of FuGENE HD© lipofection was 2%, transfection rate of AMAXA© nucleofection was 10%. With both methods, Schwann cells showed pronounced aggregation behavior which made them unfeasible for further cultivation. Settling of Schwann cells on laminin and poly-L-ornithine coated plates was compromised by either method. Non-viral transfection of rat SC with FuGENE HD© lipofection and AMAXA© nucleofection is basically possible with a higher transfection rate for nucleofection than for lipofection. As cell viability is compromised by either method however, viral transfection is to be considered if higher efficiency is required.

  17. Expression and Role of Oct3/4 in Injury-Repair Process of Rat Alveolar Epithelium after 5-Fu Treatment

    Wen-ya Li


    Full Text Available Objective. We aimed to investigate how the embryonic stem cell-related gene Oct3/4 changes during the injury-repair process of distal pulmonary epithelium induced by 5-fluorouracil (5-Fu. Methods. We have developed the lung injury model induced by 5-Fu and observed the dynamic changes of Oct3/4 by indirect immunofluorescence, Western blot, and quantitative real-time PCR. Immunofluorescence double staining was used to compare the positions of Oct3/4(+ cells and other reported alveolar epithelial stem cells. Results. Oct3/4(+ cells were not found in normal rat lung epithelial cells. However, after treatment with 5-Fu, Oct3/4(+ cells appeared at 12 h, reached the peak at 24 h, then decreased at 48 h, and eventually disappeared at 72 h. Oct3/4 was localized in the nucleus. We found that the sites of Clara cell secretory protein and surfactant protein-C dual positive cells were apparently different from Oct3/4(+ cells. Conclusions. Our results revealed that, in rat alveolar epithelium, expression of Oct3/4 could be induced after treatment with 5-Fu, then decreased gradually, and was silenced following the alveolar epithelial differentiation. We hold that Oct3/4(+ cells are lung stem cells, which can provide new evidence for identification and isolation of lung epithelial stem cells.

  18. HAN Fei's Experience in Treatment of Children Tic Disorder by Using "Angle Medicine"%韩斐运用"角药"治疗小儿抽动障碍经验



    角药是针对一定病因、病机、病症,将3味药组合在一起以达到协同增效作用的一种配伍方法.韩斐教授是著名中医儿科专家,多年来致力于小儿抽动障碍的研究,具有丰富的临床经验.本文介绍了韩教授运用珍珠母合龙骨、牡蛎,白芍合僵蚕、蝉蜕,苍耳子合白芷、辛夷,首乌藤合石菖蒲、合欢皮等角药治疗小儿抽动障碍的经验,并初步分析其使用的原因及内涵.%Angle medicine is a concerted application of three kinds of Chinese materia medica for a certain cause, pathogenesis and disease. Professor HAN Fei is a famous TCM pediatric specialist. She has been working on children tic disorder for a number of years, with a lot of experience. This article introduced Professor HAN Fei's experience in treatment of children tic disorder by using angle medicine, and briefly analysed the reasons and connotation of application, including Margaritifera Concha combine with Dragons Bones and Ostreae Concha, Paeoniae Radix Alba combine with Bombyx Batryticatus and Cicadae Periostracum, Xanthii Fructus combine with Angelicae Dahuricae Radix and Magnoliae Flos, Polygoni Multiflori Caulis combine with Acori Tatarinowii Rhizoma and Albiziae Cortex.

  19. [Effects of intravenous alimentation on adjuvant chemotherapy--an experimental study on the distribution of 5-FU after injection of tegafur (2)].

    Kimoto, M; Nagano, H; Sano, K


    The stomach, small and large intestines, heart, lungs, bone and kidneys were removed from 48 Sato lung cancer-bearing rats used in the previous experiments and given 90 mg/kg of tegafur (FT-207) by single intravenous administration and tissue 5-FU and FT-207 concentrations were measured. FT-207 concentration in the alimentary canal was somewhat lower than the blood concentration, but both were lowered in parallel. 5-FU concentration in the stomach and large intestines showed virtually identical changes in both IVH and PO groups, but IVH group tended to have higher concentration. IVH group showed higher values than PO group anytime, particularly in the large intestines. A reduction of the side effects on the digestive system via intravenous alimentation was thought due to the elimination of mechanical stimulation via a cessation of oral feeding. 5-FU concentration in the bone was highest in PO group at six hours after administration and blood concentration changes were parallel, but there was virtually no change in IVH group. Maximum values were found one hour after administration and slowly declined thereafter; at 24 hrs the values were 0.059 +/- 0.013 microgram/g, relatively high compared to the PO group at 0.041 +/- 0.022 microgram/g. In the present study under intravenous alimentation, the concentration changes were slight in spite of 5-FU maximum concentration being lower than that by oral feeding and the long-term high concentration which was maintained; this is thought to be a disadvantageous action with regard to the bone marrow. FT-207 concentration in the kidney, heart and lungs was the same as that for the blood, with a gradual reduction in IVH group. 5-FU concentration was the same for the kidneys and IVH group quickly reached to the high levels compared to PO group with only slight changes thereafter. Effects of continuous water load might be involved but not clear.

  20. Regorafenib with a fluoropyrimidine for metastatic colorectal cancer after progression on multiple 5-FU-containing combination therapies and regorafenib monotherapy.

    Marks, Eric I; Tan, Carlyn; Zhang, Jun; Zhou, Lanlan; Yang, Zhaohai; Scicchitano, Angelique; El-Deiry, Wafik S


    We present 2 patients with metastatic colorectal cancer who had progressed despite treatment with first-line FOLFOX and second-line FOLFIRI combination chemotherapy regimens. After failing these fluoropyrimidine-based regimens, both patients received additional cytotoxic and targeted therapies with eventual disease progression. These therapies included capecitabine plus dabrafenib and trametinib, regorafenib monotherapy, and regorafenib with panitumumab. After exhausting available options, both patients were offered regorafenib with either 5-fluorouracil (5-FU) or capecitabine. These therapies are individually approved for the treatment of colorectal cancer but have not yet been studied in combination. This regimen produced stable disease in both patients with acceptable toxicity. One patient continued therapy for 17 months. Although these patients previously progressed during treatment with regorafenib, capecitabine or 5-FU, the combination had some activity in both cases of refractory metastatic colorectal cancer and may be considered in the palliative setting. In bedside-to-bench cell culture experiments performed after the clinical observations, we observed sensitivity of human colorectal cancer cell lines (N = 4) to single agent regorafenib or 5-FU and evidence of synergy with the combination therapy. Synergistic effects were noted in colorectal cancer cells with KRAS mutation, BRAF mutation, and p53 mutation, as well as mismatch repair deficient cells. Regorafenib suppressed Mcl-1 and Bcl-XL in treated cancer cells that may have contributed to the anticancer efficacy including in combination with 5-FU. The safety and efficacy of regorafenib with 5-FU or capecitabine in combination should be further investigated as a therapy for patients with refractory metastatic colorectal cancer, including individuals who had progressed on regorafenib monotherapy.

  1. Combined 5-FU and ChoKα inhibitors as a new alternative therapy of colorectal cancer: evidence in human tumor-derived cell lines and mouse xenografts.

    Ana de la Cueva

    Full Text Available Colorectal cancer (CRC is the third major cause of cancer related deaths in the world. 5-fluorouracil (5-FU is widely used for the treatment of colorectal cancer but as a single-agent renders low response rates. Choline kinase alpha (ChoKα, an enzyme that plays a role in cell proliferation and transformation, has been reported overexpressed in many different tumors, including colorectal tumors. ChoKα inhibitors have recently entered clinical trials as a novel antitumor strategy.ChoKα specific inhibitors, MN58b and TCD-717, have demonstrated a potent antitumoral activity both in vitro and in vivo against several tumor-derived cell line xenografts including CRC-derived cell lines. The effect of ChoKα inhibitors in combination with 5-FU as a new alternative for the treatment of colon tumors has been investigated both in vitro in CRC-tumour derived cell lines, and in vivo in mouse xenografts models. The effects on thymidilate synthase (TS and thymidine kinase (TK1 levels, two enzymes known to play an essential role in the mechanism of action of 5-FU, were analyzed by western blotting and quantitative PCR analysis. The combination of 5-FU with ChoKα inhibitors resulted in a synergistic effect in vitro in three different human colon cancer cell lines, and in vivo against human colon xenografts in nude mice. ChoKα inhibitors modulate the expression levels of TS and TK1 through inhibition of E2F production, providing a rational for its mechanism of action.Our data suggest that both drugs in combination display a synergistic antitumoral effect due to ChoKα inhibitors-driven modulation of the metabolization of 5-FU. The clinical relevance of these findings is strongly supported since TCD-717 has recently entered Phase I clinical trials against solid tumors.

  2. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  3. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  4. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Shevchenko V.


    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  5. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail:


    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  6. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Sivaji, K., E-mail: [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)


    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  7. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Igino Andrighetto


    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  8. The Many Sides of Happy Lim: aka Hom Ah Wing, Lin Jian Fu, Happy Lum, Lin Chien Fu, Hom Yen Chuck, Lam Kin Foo, Lum Kin Foo, Hom, Lim Goon Wing, Lim Gin Foo, Gin Foo Lin, Koon Wing Lim, Henry Chin, Lim Ying Chuck, Lim Ah Wing, et. al.

    Gordon H. Chang


    Full Text Available

    Known to the FBI, INS, and IRS as Mr. Ah Wing Hom, he was also Lin Jian Fu, Jian Fu (Tough Guy, or just Fu to the readers of the many poems and short stories he published in Chinese over four decades in the twentieth century. And to still others, primarily English-readers of his writing, he was Happy Lim, an ironic, even tragically bizarre name, as his life was far from pleasant. On New Year's Day 1986, he died alone in a dingy San Francisco Chinatown bachelor hotel suffering from a bacterial infection and a chronic blood disorder that had required the amputation of all his toes the year before. He was seventy-eight years of age and had spent most of his life within blocks of where he died.

  9. «A Ca’ Giustinian fu tutto diverso». La mostra di Paolo Veronese a Venezia (1939 / «A Ca’ Giustinian fu tutto diverso» (At Ca’ Giustiniani eveything was different. Paolo Veronese exhibition in Venice (1939

    Matilde Cartolari


    Full Text Available La mostra di Paolo Veronese si svolse a Venezia nel 1939 sotto la direzione di Rodolfo Pallucchini. Promuovendo una ricognizione materiale e critica dell’opera del maestro, la mostra fu l’occasione per effettuare una massiccia campagna di restauri ad opera del bergamasco Mauro Pellicioli e della sua squadra di collaboratori. Agendo sul duplice fronte della museografia e del restauro, Pallucchini si pose in dialogo con le parallele definizioni elaborate in sede istituzionale da Guglielmo Pacchioni e Giulio Carlo Argan. Il presente saggio intende offrire, attraverso materiale archivistico inedito, un’analisi del ruolo della mostra di Veronese nel contesto nazionale e internazionale, ricostruendo con un approccio interdisciplinare le dinamiche teoriche e operative che ne animarono lo svolgimento. Veronese exhibition took place in Venice in 1939 under the direction of Rodolfo Pallucchini. While promoting both material and critical examination of Veronese’s work, the exhibition was an opportunity to undertake a massive restoration, performed by Mauro Pellicioli and his team of collaborators. Pallucchini’s museographical and conservative program was in close relation with the theories promoted by Guglielmo Pacchioni and Giulio Carlo Argan in public administration. This paper intends to offer, through unpublished archival evidence, a detailed analysis of Veronese exhibition in relation to national and international context, in order to understand with an interdisciplinary approach both its theoretical and practical aspects.

  10. Long-term results of the maxillary sinus carcinoma with irradiation and intraarterial infusion of 5-FU

    Sakaguchi, Masanori; Netsu, Kiminori (Shinshu Univ., Matsumoto, Nagano (Japan). Faculty of Medicine); Kawarada, Kazuo; Yachiyama, Hitoshi


    Therapeutic results of 33 primary cases of maxillary sinus carcinoma treated with irradiation and intraarterial infusion of 5-FU between 1972 and 1984 were analyzed. The 5-year crude survival rate for the group with stage T2 carcinoma (n=10) was 50.0%, and for those with T3 (n=15) and T4 (n=8) it was 46.7% and 25.0%, respectively. The overall 5-year crude survival rate was 42.4%. Eight patients who did not undergo maxillectomy survived for 5 years after irradiation and intraarterial infusion. Recurrence of the tumor after the irradiation and intraarterial infusion occurred in 63.6%, and was frequently observed at the ethmoidal region and the orbita. In the areas in which the tumor extended to regions such as the ethmoid sinus and orbita, which are nourished by arteries other than the maxillary artery, conventional intraarterial infusion was ineffective for complete tumor eradication. Therefore, in most of the patients with advanced maxillary sinus carcinoma, partial or total maxillectomy following combined therapy of intraarterial infusion and irradiation is necessary to improve a prognosis. (author).


    Green, Joel D.; Robertson, Paul; Pak, Soojong; Meschiari, Stefano; Baek, Giseon; Lee, Jeong-Eun; Pooley, David; Im, Myungshin; Jeon, Yiseul; Choi, Changsu


    We present the detection of day-timescale periodic variability in the r-band lightcurve of newly outbursting FU Orionis-type object HBC 722, taken from >42 nights of observation with the CQUEAN instrument on the McDonald Observatory 2.1 m telescope. The optical/near-IR lightcurve of HBC 722 shows a complex array of periodic variability, clustering around 5.8-day (0.044 mag amplitude) and 1.28-day (0.016 mag amplitude) periods, after removal of overall baseline variation. We attribute the unusual number of comparable strength signals to a phenomenon related to the temporary increase in accretion rate associated with FUors. We consider semi-random 'flickering', magnetic braking/field compression and rotational asymmetries in the disk instability region as potential sources of variability. Assuming that the 5.8-day period is due to stellar rotation and the 1.28-day period is indicative of Keplerian rotation at the inner radius of the accretion disk (at 2 R * ), we derive a B-field strength of 2.2-2.7 kG, slightly larger than typical T Tauri stars. If instead the 5.8-day signal is from a disk asymmetry, the instability region has an outer radius of 5.4 R * , consistent with models of FUor disks. Further exploration of the time domain in this complicated source and related objects will be key to understanding accretion processes.

  12. Technical note: Fu-Liou-Gu and Corti-Peter model performance evaluation for radiative retrievals from cirrus clouds

    Lolli, Simone; Campbell, James R.; Lewis, Jasper R.; Gu, Yu; Welton, Ellsworth J.


    We compare, for the first time, the performance of a simplified atmospheric radiative transfer algorithm package, the Corti-Peter (CP) model, versus the more complex Fu-Liou-Gu (FLG) model, for resolving top-of-the-atmosphere radiative forcing characteristics from single-layer cirrus clouds obtained from the NASA Micro-Pulse Lidar Network database in 2010 and 2011 at Singapore and in Greenbelt, Maryland, USA, in 2012. Specifically, CP simplifies calculation of both clear-sky longwave and shortwave radiation through regression analysis applied to radiative calculations, which contributes significantly to differences between the two. The results of the intercomparison show that differences in annual net top-of-the-atmosphere (TOA) cloud radiative forcing can reach 65 %. This is particularly true when land surface temperatures are warmer than 288 K, where the CP regression analysis becomes less accurate. CP proves useful for first-order estimates of TOA cirrus cloud forcing, but may not be suitable for quantitative accuracy, including the absolute sign of cirrus cloud daytime TOA forcing that can readily oscillate around zero globally.

  13. Gauge-theoretic invariants for topological insulators: a bridge between Berry, Wess-Zumino, and Fu-Kane-Mele

    Monaco, Domenico; Tauber, Clément


    We establish a connection between two recently proposed approaches to the understanding of the geometric origin of the Fu-Kane-Mele invariant FKM\\in Z_2, arising in the context of two-dimensional time-reversal symmetric topological insulators. On the one hand, the Z_2 invariant can be formulated in terms of the Berry connection and the Berry curvature of the Bloch bundle of occupied states over the Brillouin torus. On the other, using techniques from the theory of bundle gerbes, it is possible to provide an expression for FKM containing the square root of the Wess-Zumino amplitude for a certain U( N)-valued field over the Brillouin torus. We link the two formulas by showing directly the equality between the above-mentioned Wess-Zumino amplitude and the Berry phase, as well as between their square roots. An essential tool of independent interest is an equivariant version of the adjoint Polyakov-Wiegmann formula for fields T^2 → U(N), of which we provide a proof employing only basic homotopy theory and circumventing the language of bundle gerbes.

  14. A randomized controlled trial of Kung Fu training for metabolic health in overweight/obese adolescents: the "martial fitness" study.

    Tsang, Tracey W; Kohn, Michael; Chow, Chin Moi; Singh, Maria Fiatarone


    Twenty overweight/obese adolescents underwent six months of Kung Fu or placebo (Tai Chi) training, 3x.wk(-1). Outcomes included fasting insulin and insulin resistance, lipids, glucose and HbA(1c), and C-reactive protein (CRP). CRP decreased significantly (p = 0.03) in both groups over time at six months. Although insulin sensitivity did not change, HbA(1c) tended to decrease over time (p = 0.09), again with no group difference (p = 0.60). Reduced CRP was related to increased upper body strength (p = 0.01). Increased lean body mass was related to reductions in HbA(1c), insulin resistance, triglycerides, and total cholesterol. Improvements in lean body mass appear to have a potential role in favorable metabolic outcomes, independent of changes in fat mass. Further research in this area is warranted before definite conclusions can be drawn about the efficacy of martial arts training for metabolic outcomes in this cohort.

  15. Kung Fu Training Improves Physical Fitness Measures in Overweight/Obese Adolescents: The “Martial Fitness” Study

    Tracey W. Tsang


    Full Text Available Aim. To examine the efficacy of a six-month Kung Fu (KF program on physical fitness in overweight/obese adolescents. Methods. Subjects were randomly assigned to the KF or sham exercise (Tai Chi, TC control group. Physical measurements in cardiovascular fitness and muscle fitness occurred at baseline and after 6 months of training thrice weekly. Results. Twenty subjects were recruited. One subject was lost to follow-up, although overall compliance to the training sessions was 46.7±27.8%. At follow-up, the cohort improved in absolute upper (P=.002 and lower (P=.04 body strength, and upper body muscle endurance (P=.02, without group differences. KF training resulted in significantly greater improvements in submaximal cardiovascular fitness (P=.03, lower body muscle endurance (P=.28; significant 95% CI: 0.37–2.49, and upper body muscle velocity (P=.03 relative to TC training. Conclusions. This short-term KF program improved submaximal cardiovascular fitness, lower body muscle endurance, and muscle velocity, in overweight/obese adolescents with very low baseline fitness.

  16. I Am the Invincible Sword Goddess: Mediatization of Chinese Gender Ideology through Female Kung-Fu Practitioners in Films

    Mie Hiramoto


    Full Text Available The media are avid portrayers of gender binarism and the belief in male-female distinctions, which are mainly attributed to perceived differences of a physical nature. In this paper, we investigate representations of female kung-fu practitioners (nuxia in films to discuss how processes of mediation and mediatization depict their femininity, so as to mitigate their appropriation of Chinese martial arts masculinity. Often, nuxias are portrayed as empowered women who are equipped to take control of their own lives and to courageously take on challenges from a variety of opponents. However, multimodal deconstruction of the various characteristics of nuxias must be placed in an Asian-specific context in order to understand the femininity specific to these characters and to move beyond Western gender ideologies displayed by the media. Perpetuating Confucian patriarchal ideals, nuxia roles constantly and consistently associate conformation to Confucian values with virtuousness and non-conformation with wickedness. We therefore can use the ideals of Confucianism as a more accurate foundation in deconstructing the identities of nuxias, which allows us to better understand the mediation and mediatization processes of ideologies associated with Chinese femininity and masculinity in martial arts films.

  17. Long-term results of the maxillary sinus carcinoma with irradiation and intraarterial infusion of 5-FU

    Sakaguchi, Masanori; Netsu, Kiminori; Kawarada, Kazuo; Yachiyama, Hitoshi.


    Therapeutic results of 33 primary cases of maxillary sinus carcinoma treated with irradiation and intraarterial infusion of 5-FU between 1972 and 1984 were analyzed. The 5-year crude survival rate for the group with stage T2 carcinoma (n=10) was 50.0%, and for those with T3 (n=15) and T4 (n=8) it was 46.7% and 25.0%, respectively. The overall 5-year crude survival rate was 42.4%. Eight patients who did not undergo maxillectomy survived for 5 years after irradiation and intraarterial infusion. Recurrence of the tumor after the irradiation and intraarterial infusion occurred in 63.6%, and was frequently observed at the ethmoidal region and the orbita. In the areas in which the tumor extended to regions such as the ethmoid sinus and orbita, which are nourished by arteries other than the maxillary artery, conventional intraarterial infusion was ineffective for complete tumor eradication. Therefore, in most of the patients with advanced maxillary sinus carcinoma, partial or total maxillectomy following combined therapy of intraarterial infusion and irradiation is necessary to improve a prognosis. (author)


    Osmar Pinto Neto


    Full Text Available In martial arts and contact sports, strikes are often trained in two different ways: with and without impacts. This study aims to compare the electromyographical activity (EMG of the triceps brachii (TB, biceps brachii (BB and brachioradialis (BR muscles during strikes with and without impacts. Eight Yau-Man Kung Fu practitioners participated in the experiment. Each participant performed 5 sequences of 5 consecutive KF Yau-Man palm strikes with no impact intercalated with 5 sequences of 5 repetitions targeting a KF training shield. Surface EMG signals were obtained from the TB, BB, and RB for 3.0 seconds using an eight-channel module with a total amplifier gain of 2000 and sampled at 3500 Hz. The EMG analyses were done in the time (rms and frequency (wavelet domains. For the frequency domain, Morlet wavelet power spectra were obtained and an original method was used to quantify statistically significant regions on the power spectra. The results both in the time and frequency domains indicate a higher TB and BR muscle activity for the strikes with impacts. No significant difference was found for the BB in the two different scenarios. In addition, the results show that the wavelet power spectra pattern for the three analysed muscles obtained from the strikes with and without impacts were similar

  19. 5-FU resistant EMT-like pancreatic cancer cells are hypersensitive to photochemical internalization of the novel endoglin-targeting immunotoxin CD105-saporin.

    Lund, Kaja; Olsen, Cathrine Elisabeth; Wong, Judith Jing Wen; Olsen, Petter Angell; Solberg, Nina Therese; Høgset, Anders; Krauss, Stefan; Selbo, Pål Kristian


    Development of resistance to 5-fluorouracil (5-FU) is a major problem in treatment of various cancers including pancreatic cancer. In this study, we reveal important resistance mechanisms and photochemical strategies to overcome 5-FU resistance in pancreatic adenocarcinoma. 5-FU resistant (5-FUR), epithelial-to-mesenchymal-like sub-clones of the wild type pancreatic cancer cell line Panc03.27 were previously generated in our lab. We investigated the cytotoxic effect of the endosomal/lysosomal-localizing photosensitizer TPCS 2a (fimaporfin) combined with light (photochemical treatment, PCT) using MTS viability assay, and used fluorescence microscopy to show localization of TPCS 2a and to investigate the effect of photodamage of lysosomes. Flow cytometric analysis was performed to investigate uptake of photosensitizer and to assess intracellular ROS levels. Expression and localization of LAMP1 was assessed using RT-qPCR, western blotting, and structured illumination microscopy. MTS viability assay was used to assess the effect of combinations of 5-FU, chloroquine (CQ), and photochemical treatment. Expression of CD105 was investigated using RT-qPCR, western blotting, flow cytometry, and fluorescence microscopy, and co-localization of TPCS 2a and anti-CD105-saporin was assessed using microscopy. Lastly, the MTS assay was used to investigate cytotoxic effects of photochemical internalization (PCI) of the anti-CD105-immunotoxin. The 5-FUR cell lines display hypersensitivity to PCT, which was linked to increased uptake of TPCS 2a , altered lysosomal distribution, lysosomal photodamage and increased expression of the lysosomal marker LAMP-1 in the 5-FUR cells. We show that inhibition of autophagy induced by either chloroquine or lysosomal photodamage increases the sensitivity to 5-FU in the resistant cells. The three 5-FUR sub-clones overexpress Endoglin (CD105). Treatment with the immunotoxin anti-CD105-saporin alone significantly reduced the viability of the CD105

  20. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.


    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  1. Review of dissertation The Association Of Intelligence, Visual-Motor Functioning, And Personality Characteristics With Adaptive Behavior In Individuals With Williams Syndrome by Juhsin Trista Fu

    Florova N.B.


    Full Text Available Juhsin Trista Fu (Taiwan is an American clinical psychologist, doctor of philosophy (PhD, on the national register of health professionals of United States National Provider Identifiers (NPI Registry. The proposed material gives a systematic description of the dynamics of specific behavioral construct in adults in situation of genetic anomalies. The author regards this condition as a volatile state which to a certain extent responds to interventions.

  2. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability


    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  3. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Bonivento, Walter M.


    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  4. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg


    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  5. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin


    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.


    Juan Diego Zamora Salas


    Full Text Available El presente estudio analizó el efecto del grito como mecanismo inhibidor de sensaciones como el dolor y la fatiga enpracticantes de Kung Fu, utilizando una prueba de push ups. Se formaron tres grupos de forma aleatoria,cada uno conformado por n= 10, cuyas edades estaban comprendidas entre los 15 y 30 años. Los sujetos del Grupo Experimental sin grito y Grupo Experimental con grito, les correspondía realizar las prácticas depush ups aplicando los tratamientos correspondientes durante cinco semanas; mientras que los sujetos delgrupo control no realizaban éstas prácticas durante el período establecido, sólo les correspondía el pre-testy post-test. A los valores recolectados durante las pruebas se les aplicó una Anova 3 x 2 y un análisis posthocde la interacción mostrando la existencia de una diferencia significativa entre el pre-test y el post-testtanto en el grupo que aplicó el grito personal como en el grupo que no lo aplicó, lo cual no se manifestóentre el pre-test y post-test del grupo control. Al comparar los datos obtenidos del grupo que utilizó el gritopersonal con respecto al grupo que no utilizó el grito como tratamiento, se encontró una diferenciasignificativa entre ambos métodos. Con el estudio se concluyó que el grito en combinación con el ejerciciofísico permite observar incrementos significativos en la cantidad de repeticiones de un ejercicio de fuerzapara el tren superior como son las push ups, luego de cinco semanas de tratamiento.

  7. Antibacterial Activity of Copper Oxide (CuO Nanoparticles Biosynthesized by Bacillus sp. FU4: Optimization of Experiment Design

    Mojtaba Taran, Maryam Rad, Mehran Alavi


    Full Text Available Background: There are several methods for synthesis of metallic nanoparticles (NPs including chemical, physical and biological process. In this study, Bacillus sp. FU4 was used as biological source for biosynthesis of CuO NPs. Methods: CuO NPs have been prepared by copper sulfate (CuSO4. CuO NPs were formed after oxidation of Cu NPs. Design and analysis of Taguchi experiments (an orthogonal assay and analysis of variance (ANOVA carried out by the Qualitek-4 software. Average effect of CuSO4 concentration (0.1, 0.01 and 0.001 M, incubation and culturing time (48, 72, 96 hours as three controllable factors with three levels were evaluated in CuO NPs biosynthesis. Characterization of CuO NPs was determined by UV-Vis spectroscopy, X-ray diffraction (XRD, Fourier transform infra-red (FT-IR spectroscopy and scanning electron microscopy (SEM. Also, the antimicrobial properties of CuO NPs were investigated using Escherichia coli ATCC 25922 and Staphylococcus aureus ATCC 43300 as multidrug resistant (MDR bacteria. Results: Results: It was evaluated that, NPs size distributions were in the range of 2-41 nm with spherical shapes. The anti-bacterial activities of CuO NPs were measured based on diameter of inhibition zone in disk diffusion tests of NPs dispersed in batch cultures. Two levels of CuSO4 concentrations (0.1 and 0.01M had antibacterial effect on E.coli (33±0.57 and 6 ±2mm. In the case of S. aureus, there was surprisingly no sign of growth. Conclusion: CuO NPs have antibacterial activity that can be benefit in medicinal aspect for fighting against prominent pathogen bacteria such as E.coli ATCC 25922 and S.aureus ATCC 43300.

  8. Pilot study of postoperative adjuvant chemoradiation for advanced gastric cancer: Adjuvant 5-FU/cisplatin and chemoradiation with capecitabine

    Lee, Hyung-Sik; Choi, Youngmin; Hur, Won-Joo; Kim, Hyo-Jin; Kwon, Hyuk-Chan; Kim, Sung-Hyun; Kim, Jae-Seok; Lee, Jong-Hoon; Jung, Ghap-Joong; Kim, Min-Chan


    AIM: To evaluate the efficacy and toxicity of postoperative chemoradiation using FP chemotherapy and oral capecitabine during radiation for advanced gastric cancer following curative resection. METHODS: Thirty-one patients who had underwent a potentially curative resection for Stage III and IV (M0) gastric cancer were enrolled. Therapy consists of one cycle of FP (continuous infusion of 5-FU 1000 mg/m2 on d 1 to 5 and cisplatin 60 mg/m2 on d 1) followed by 4500 cGy (180 cGy/d) with capecitabine (1650 mg/m2 daily throughout radiotherapy). Four wk after completion of the radiotherapy, patients received three additional cycles of FP every three wk. The median follow-up duration was 22.2 mo. RESULTS: The 3-year disease free and overall survival in this study were 82.7% and 83.4%, respectively. Four patients (12.9%) showed relapse during follow-up. Eight patients did not complete all planned adjuvant therapy. Grade 3/4 toxicities included neutropenia in 50.2%, anemia in 12.9%, thrombocytopenia in 3.2% and nausea/vomiting in 3.2%. Neither grade 3/4 hand foot syndrome nor treatment related febrile neutropenia or death were observed. CONCLUSION: These preliminary results suggest that this postoperative adjuvant chemoradiation regimen of FP before and after capecitabine and concurrent radiotherapy appears well tolerated and offers a comparable toxicity profile to the chemoradiation regimen utilized in INT-0116. This treatment modality allowed successful loco-regional control rate and 3-year overall survival. PMID:16489675

  9. Therapeutic effects of FuZhiSan on Alzheimer's disease rat model:evaluation with PET imaging

    Guo Zhe; Zhang Jinming; Yao Shulin; Feng Huiru; Li Xuling; Yin Dayi; Tian Jiahe


    Objective: To assess the feasibility of using PET molecular imaging to evaluate the therapeutic effects of traditional Chinese medicine FuZhiSan (FZS) on the model of aging Alzheimer's disease (AD) rats. Methods: Twenty aged AD rats (Sparague-Dawley rats,male) were randomly divided into FZS treated group (n = 10) and control group (n = 10). Another 10 healthy adult rats were as blank controls. Morris water maze record system was used for cognitive function assessment. Before and after FZS treatment 18 F-fluorodeoxyglucose (FDG) and 11 C-2- [4'-(methylamino) phenyl] benzothiazol-6-ol (PIB) PET imaging was undertaken. After post-treatment imaging procedures the brain tissues of all animals were taken for histochemical study, such as staining with HE, congo red, amyloid β (Aβ) immunofluorescence, 5-bromo-2-deoxyuridine (BrdU) immunofluorescence and NeuN immunofluorescence. Paired t-test was performed with SPSS 13.0 software for the data analysis. Results: The cognitive dysfunction of aging AD rats was improved after FZS treatment. The escape latency in FZS treated group was significantly shorter than that of control group ((32.5 ±10.8) s vs (102.6±8.8) s, t =15.7987, P=0. 0001). Diffuse neuronal loss and Aβ deposition were detected in the hippocampus and cortex in the aged AD rats. The imaging data showed that brain glucose metabolism was amended in FZS treated group while the abatement of amyloid deposition was not significant. Immunofluorescence results indicated that the neuronal proliferation was more remarkable in FZS treated group. Conclusions: It may be feasible to use PET imaging as a method to evaluate the therapeutic effect in AD rats. FZS may ameliorate memory dysfunction of aged AD rats. Its mechanism may be partly contributed to the enhancement of the neuronal proliferation and survival. (authors)

  10. Kung Fu a jeho zařazení do výuky úpolů ve školní tělesné výchově

    Krbcová, Pavlína


    The goal of this thesis is to analyse kung fu from the pespective of teaching Combatives in Physicial Education courses, suggest model exercises with the help of the consultants named in the theoretical part and create model lessons that teachers may use in their Physical Education courses. The teoretical part focuses on history, taxonomy and teaching of Combatives in Physical Education courses. In addition, in describes history, characteristics and taxonomy of kung fu. The experimental part ...

  11. Concurrent hyperfractionated accelerated radiotherapy with 5-FU and once weekly cisplatin in locally advanced head and neck cancer. The 10-year results of a prospective phase II trial

    Budach, V.; Boehmer, D.; Badakhshi, H.; Jahn, U.; Stromberger, C. [Campus Virchow Klinikum, Charite Universitaetsmedizin Berlin, Department for Radiooncology, Clinic for Radiooncology, Berlin (Germany); Becker, E.T. [Charite Universitaetsmedizin, Department of Otorhinolaryngology, Berlin (Germany); Wernecke, K.D. [Sostana Statistics GmbH, Charite Universitaetsmedizin Berlin, Berlin (Germany)


    In this study, the acute toxicity and long-term outcome of a hyperfractionated accelerated chemoradiation regimen with cisplatin/5-fluorouracil (5-FU) in patients with locally advanced squamous cell carcinomas of head and neck were evaluated. From 2000-2002, 38 patients with stage III (5.3 %) and stage IV (94.7 %) head and neck cancer were enrolled in a phase II study. Patients received hyperfractionated-accelerated radiotherapy with 72 Gy in 15 fractions of 2 Gy followed by 1.4 Gy twice daily with concurrent, continuous infusion 5-FU of 600 mg/m{sup 2} on days 1-5 and 6 cycles of weekly cisplatin (30 mg/m{sup 2}). Acute toxicities (CTCAEv2.0), locoregional control (LRC), metastases-free (MFS), and overall survival (OS) were analyzed and exploratively compared with the ARO 95-06 trial. Median follow-up was 11.4 years (95 % CI 8.6-14.2) and mean dose 71.6 Gy. Of the patients, 82 % had 6 (n = 15) or 5 (n = 16) cycles of cisplatin, 5 and 2 patients received 4 and 3 cycles, respectively. Grade 3 anemia, leukopenia, and thrombocytopenia were observed in 15.8, 15.8, and 2.6 %, respectively. Grade 3 mucositis in 50 %, grade 3 and 4 dysphagia in 55 and 13 %. The 2-, 5-, and 10-year LRC was 65, 53.6, and 48.2 %, the MFS was 77.5, 66.7, and 57.2 % and the OS 59.6, 29.2, and 15 %, respectively. Chemoradiation with 5-FU and cisplatin seems feasible and superior in terms of LRC and OS to the ARO 95-06C-HART arm at 2 years. However, this did not persist at the 5- and 10-year follow-ups. (orig.) [German] Untersuchung der Akuttoxizitaet und des Langzeitueberlebens einer hyperfraktioniert-akzelerierten simultanen Radiochemotherapie mit Cisplatin/5-Fluorouracil (5-FU) bei Patienten mit lokal fortgeschrittenen Kopf-Hals-Tumoren. Von 2000 bis 2002 wurden 38 Patienten mit Plattenepithelkarzinomen der Kopf-Hals-Region im Stadium III (5,3 %) und IV (94,7 %) eingeschlossen. Es erfolgte eine simultane hyperfraktionierte akzelerierte Radiochemotherapie mit 72 Gy in 15 Fraktionen a 2 Gy

  12. K3FU METAR

    National Oceanic and Atmospheric Administration, Department of Commerce — METAR is a routine scheduled observation and is the primary observation code used in the United States to satisfy requirements for reporting surface meteorological...

  13. Quantum kung fu

    Flicker, Felix


    If someone puts you in an armlock, what should you do? If you happen to be a martial artist well-practised in the art of joint manipulation, or chin na, you will know the answer already: there is one simple move that will allow you to turn the tables on your aggressor, leaving them on the wrong end of a throw.

  14. Avaliação do papel da drenagem na elaboração de feições geomorfológicas no município de GOIANA - PE

    Daniel Rodrigues de Lira


    Full Text Available Este artigo apresenta uma análise da influência da rede de drenagem no modelado da superfície terrestre e na evolução geomorfológica no município de Goiana, Estado de Pernambuco. Foram aplicadas técnicas de Modelagem Numérica do Terreno para estabelecer diferenças entre os padrões de drenagem, de relevo e de solos, buscando identificar áreas morfogeneticamente distintas. Foram identificados quatro padrões de drenagem: 1- padrão pinado, orientado para sudeste e relacionado às colinas dissecadas; 2- padrão paralelo, orientado para nordeste, com formas tabulares dissecadas; 3-paralelo e subparalelo, orientado para sudeste, com forma tabular; e 4- paralelo, direcionado a leste, forma tabular. Esses padrões são fortemente influenciados pela presença de feições morfotectônicas de grábens e horsts.

  15. [Isolation and characterization of petroleum catabolic broad-host-range plasmids from Shen-Fu wastewater irrigation zone].

    Wang, Ya-Fei; Wang, Ya-Fei; Li, Hui; Li, Xiao-Bin


    Based on triparental mating, we isolated a total of eight broad host range (BHR) petroleum hydrocarbon catabolic plasmids from the soils, sediments, and wastewater samples in the Shen-Fu irrigation zone. The antibiotic resistance of the plasmids was tested, and then, the plasmids were transferred to Escherichia coli EC100. The plasmids carrying no antibiotic resistance were tagged by miniTn5 transposon consisting of antibiotic resistant genes. The PCR-based incompatibility test revealed that the pS3-2C and pS4-6G belonged to Inc P group, the pS3-2G, pW22-3G, and pA15-7G belonged to Inc N group, the pS7-2G was identified as Inc W plasmid, and the pA23-1G and pA10-1C were placed into Inc Q group. By adopting the reported PCR amplification methods of petroleum hydrocarbon-degrading catabolic genes, the petroleum-degrading capability of these BHR plasmids were preliminarily analyzed. The plasmids pS3-2G, pS7-2G, pA23-1G, pW22-3G, and pA10-1C carried aromatic ring- hydroxylating dioxygenase gene phdA and toluene monooxygenase gene touA; the plasmid pA15-7G carried touA and toluene dioxygenase gene tod; the plasmid pS3-2C carried ben, phdA, and tod; whereas the pS4-6G only carried ben. The host range test showed that all the isolated plasmids except pS3-2C could be transferred and maintained stably in the representative strains Agrobacterium tumefaciens C58, Cupriavidus necator JMP228, and E. coli EC100 of the alpha-, beta-, and gamma-Proteobacteria, respectively.

  16. Effective inhibition of colon cancer cell growth with MgAl-layered double hydroxide (LDH loaded 5-FU and PI3K/mTOR dual inhibitor BEZ-235 through apoptotic pathways

    Chen J


    Full Text Available Jiezhong Chen,1,2 Renfu Shao,3 Li Li,4 Zhi Ping Xu,4 Wenyi Gu4 1School of Biomedical Sciences, University of Queensland, St Lucia, Queensland, 2Faculty of Science, Medicine and Health, University of Wollongong, Wollongong, New South Wales, 3GeneCology Research Centre, Faculty of Science, Health, Education and Engineering, University of the Sunshine Coast, Maroochydore, Queensland, 4Australian Institute of Bioengineering and Nanotechnology, University of Queensland, St Lucia, Queensland, Australia Abstract: Colon cancer is the third most common cancer and the third largest cause of cancer-related death. Fluorouracil (5-FU is the front-line chemotherapeutic agent for colon cancer. However, its response rate is less than 60%, even in combination with other chemotherapeutic agents. The side effects of 5-FU also limit its application. Nanoparticles have been used to deliver 5-FU, to increase its effectiveness and reduce side effects. Another common approach for colon cancer treatment is targeted therapy against the phosphoinositide 3-kinase (PI3K/protein kinase B (Akt pathway. A recently-invented inhibitor of this pathway, BEZ-235, has been tested in several clinical trials and has shown effectiveness and low side effects. Thus, it is a very promising drug for colon cancer treatment. The combination of these two drugs, especially nanoparticle-packed 5-FU and BEZ-235, has not been studied. In the present study, we demonstrated that nanoparticles of layered double hydroxide (LDH loaded with 5-FU were more effective than a free drug at inhibiting colon cancer cell growth, and that a combination treatment with BEZ-235 further increased the sensitivity of colon cancer cells to the treatment of LDH-packed 5-FU (LDH-5-FU. BEZ-235 alone can decrease colon cancer HCT-116 cell viability to 46% of the control, and the addition of LDH-5-FU produced a greater effect, reducing cell survival to 8% of the control. Our data indicate that the combination therapy of

  17. Establishment of a new human pleomorphic malignant fibrous histiocytoma cell line, FU-MFH-2: molecular cytogenetic characterization by multicolor fluorescence in situ hybridization and comparative genomic hybridization

    Isayama Teruto


    Full Text Available Abstract Background Pleomorphic malignant fibrous histiocytoma (MFH is one of the most frequent malignant soft tissue tumors in adults. Despite the considerable amount of research on MFH cell lines, their characterization at a molecular cytogenetic level has not been extensively analyzed. Methods and results We established a new permanent human cell line, FU-MFH-2, from a metastatic pleomorphic MFH of a 72-year-old Japanese man, and applied multicolor fluorescence in situ hybridization (M-FISH, Urovysion™ FISH, and comparative genomic hybridization (CGH for the characterization of chromosomal aberrations. FU-MFH-2 cells were spindle or polygonal in shape with oval nuclei, and were successfully maintained in vitro for over 80 passages. The histological features of heterotransplanted tumors in severe combined immunodeficiency mice were essentially the same as those of the original tumor. Cytogenetic and M-FISH analyses displayed a hypotriploid karyotype with numerous structural aberrations. Urovysion™ FISH revealed a homozygous deletion of the p16INK4A locus on chromosome band 9p21. CGH analysis showed a high-level amplification of 9q31-q34, gains of 1p12-p34.3, 2p21, 2q11.2-q21, 3p, 4p, 6q22-qter, 8p11.2, 8q11.2-q21.1, 9q21-qter, 11q13, 12q24, 15q21-qter, 16p13, 17, 20, and X, and losses of 1q43-qter, 4q32-qter, 5q14-q23, 7q32-qter, 8p21-pter, 8q23, 9p21-pter, 10p11.2-p13, and 10q11.2-q22. Conclusion The FU-MFH-2 cell line will be a particularly useful model for studying molecular pathogenesis of human pleomorphic MFH.

  18. Neoadjuvant Treatment With Single-Agent Cetuximab Followed by 5-FU, Cetuximab, and Pelvic Radiotherapy: A Phase II Study in Locally Advanced Rectal Cancer

    Bertolini, Federica; Chiara, Silvana; Bengala, Carmelo; Antognoni, Paolo; Dealis, Cristina; Zironi, Sandra; Malavasi, Norma; Scolaro, Tindaro; Depenni, Roberta; Jovic, Gordana; Sonaglio, Claudia; Rossi, Aldo; Luppi, Gabriele; Conte, Pier Franco


    Purpose: Preoperative chemoradiotherapy followed by surgery represents the standard of care for locally advanced rectal cancer (LARC). Cetuximab has proved activity in advanced colorectal cancer, and its incorporation in preoperative treatment may increase tumor downstaging. Methods and Materials: After biopsy and staging, uT3/uT4 N0/+ LARC received single-agent cetuximab in three doses, followed by weekly cetuximab plus 5-fluorouracil (5-FU), concomitantly with RT. Sample size was calculated according to Bryant and Day test, a two-stage design with at least 10 pathologic complete remissions observed in 60 patients (pts) able to complete the treatment plan. Results: Forty pts with LARC were entered: male/female = 34/6; median age: 61 (range, 28-77); 12 uT3N0 Ed(30%); 25 uT3N1 (62%); 3 uT4N1 (8%); all Eastern Cooperative Oncology Group = 0. Thirty-five pts completed neoadjuvant treatment; 5 (12%) withdrew therapy after one cetuximab administration: three for hypersensitivity reactions, one for rapid progression, and one for purulent arthritis. They continued 5-FU in continuous infusion in association with RT. Thirty-one pts (77%) presented with acnelike rash; dose reduction/interruption of treatment was necessary in six pts (15%): two for Grade 3 acnelike rash, two for Grade 3 gastrointestinal toxicity, and two for refusal. Thirty-eight pts were evaluable for pathological response (one patient refused surgery, and one was progressed during neoadjuvant treatment). Pathological staging was: pT0N0 three pts (8%), pT1N0 1 pt (3%); pT2N0 13 pts (34%), and pT3 19 pts (50%) (N0:9, N1:5; N2:5); pT4 2 pts (5%). Conclusions: Preoperative treatment with 5-FU, cetuximab, and pelvic RT is feasible with acceptable toxicities; however, the rate of pathologic responses is disappointingly low

  19. The dose-volume relationship of acute small bowel toxicity from concurrent 5-FU-based chemotherapy and radiation therapy for rectal cancer

    Baglan, Kathy L.; Frazier, Robert C.; Yan Di; Huang, Raywin R.; Martinez, Alvaro A.; Robertson, John M.


    Purpose: A direct relationship between the volume of small bowel irradiated and the degree of acute small bowel toxicity experienced during concurrent 5-fluorouracil (5-FU)-based chemoradiotherapy for rectal carcinoma is well recognized but poorly quantified. This study uses three-dimensional treatment-planning tools to more precisely quantify this dose-volume relationship. Methods and Materials: Forty patients receiving concurrent 5-FU-based chemotherapy and pelvic irradiation for rectal carcinoma had treatment-planning CT scans with small bowel contrast. A median isocentric dose of 50.4 Gy was delivered using a posterior-anterior and opposed lateral field arrangement. Bowel exclusion techniques were routinely used, including prone treatment position on a vacuum bag cradle to allow anterior displacement of the abdominal contents and bladder distension. Individual loops of small bowel were contoured on each slice of the planning CT scan, and a small bowel dose-volume histogram was generated for the initial pelvis field receiving 45 Gy. The volume of small bowel receiving each dose between 5 and 40 Gy was recorded at 5-Gy intervals. Results: Ten patients (25%) experienced Common Toxicity Criteria Grade 3+ acute small bowel toxicity. A highly statistically significant association between the development of Grade 3+ acute small bowel toxicity and the volume of small bowel irradiated was found at each dose level. Specific dose-volume threshold levels were found, below which no Grade 3+ toxicity occurred and above which 50-60% of patients developed Grade 3+ toxicity. The volume of small bowel receiving at least 15 Gy (V 15 ) was strongly associated with the degree of toxicity. Univariate analysis of patient and treatment-related factors revealed no other significant predictors of severe toxicity. Conclusions: A strong dose-volume relationship exists for the development of Grade 3+ acute small bowel toxicity in patients receiving concurrent 5-FU-based chemoradiotherapy

  20. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动



    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  1. Suppression of microRNA-31 increases sensitivity to 5-FU at an early stage, and affects cell migration and invasion in HCT-116 colon cancer cells

    Sun Xiao-Feng


    Full Text Available Abstract Background MicroRNAs (miRNAs are endogenously expressed noncoding RNAs with important biological and pathological functions. Although several studies have shown that microRNA-31 (miR-31 is obviously up-regulated in colorectal cancer (CRC, there is no study on the functional roles of miR-31 in CRC. Methods Anti-miR™ miRNA 31 inhibitor (anti-miR-31 is a sequence-specific and chemically modified oligonucleotide to specifically target and knockdown miR-31 molecule. The effect of anti-miR-31 transfection was investigated by real-time PCR. HCT-116p53+/+ and HCT-116p53-/-colon cancer cells were treated by anti-miR-31 with or without 5-fluorouracil (5-FU, cell proliferation was determined by MTT assay; apoptosis was detected by DAPI staining; cell cycle was evaluated by flow cytometry; colony formation, migration and invasion assays were performed to investigate the effect of suppression of miR-31 on the cell lines. Results Real-time PCR results showed that anti-miR-31 was efficiently introduced into the cells and reduced miR-31 levels to 44.1% in HCT-116p53+/+ and 67.8% in HCT-116p53-/-cell line (p = 0.042 and 0.046. MTT results showed that anti-miR-31 alone had no effect on the proliferation of HCT-116p53+/+ or HCT-116p53-/-. However, when combined with 5-FU, anti-miR-31 inhibited the proliferation of the two cell lines as early as 24 h after exposure to 5-FU (p = 0.038 and 0.044. Suppression of miR-31 caused a reduction of the migratory cells by nearly 50% compared with the negative control in both HCT-116p53+/+ and HCT-116p53-/-(p = 0.040 and 0.001. The invasive ability of the cells were increased by 8-fold in HCT-116p53+/+ and 2-fold in HCT-116p53-/- (p = 0.045 and 0.009. Suppression of miR-31 had no effect on cell cycle and colony formation (p > 0.05. Conclusions Suppression of miR-31 increases sensitivity to 5-FU at an early stage, and affects cell migration and invasion in HCT-116 colon cancer cells.

  2. Evaluation of RRTMG and Fu-Liou RTM Performance against LBLRTM-DISORT Simulations and CERES Data in terms of Ice Clouds Radiative Effects

    Gu, B.; Yang, P.; Kuo, C. P.; Mlawer, E. J.


    Evaluation of RRTMG and Fu-Liou RTM Performance against LBLRTM-DISORT Simulations and CERES Data in terms of Ice Clouds Radiative Effects Boyan Gu1, Ping Yang1, Chia-Pang Kuo1, Eli J. Mlawer2 Department of Atmospheric Sciences, Texas A&M University, College Station, TX 77843, USA Atmospheric and Environmental Research (AER), Lexington, MA 02421, USA Ice clouds play an important role in climate system, especially in the Earth's radiation balance and hydrological cycle. However, the representation of ice cloud radiative effects (CRE) remains significant uncertainty, because scattering properties of ice clouds are not well considered in general circulation models (GCM). We analyze the strengths and weakness of the Rapid Radiative Transfer Model for GCM Applications (RRTMG) and Fu-Liou Radiative Transfer Model (RTM) against rigorous LBLRTM-DISORT (a combination of Line-By-Line Radiative Transfer Model and Discrete Ordinate Radiative Transfer Model) calculations and CERES (Clouds and the Earth's Radiant Energy System) flux observations. In total, 6 US standard atmospheric profiles and 42 atmospheric profiles from Atmospheric and Environmental Research (AER) Company are used to evaluate the RRTMG and Fu-Liou RTM by LBLRTM-DISORT calculations from 0 to 3250 cm-1. Ice cloud radiative effect simulations with RRTMG and Fu-Liou RTM are initialized using the ice cloud properties from MODIS collection-6 products. Simulations of single layer ice cloud CRE by RRTMG and LBLRTM-DISORT show that RRTMG, neglecting scattering, overestimates the TOA flux by about 0-15 W/m2 depending on the cloud particle size and optical depth, and the most significant overestimation occurs when the particle effective radius is small (around 10 μm) and the cloud optical depth is intermediate (about 1-10). The overestimation reduces significantly when the similarity rule is applied to RRTMG. We combine ice cloud properties from MODIS Collection-6 and atmospheric profiles from the Modern

  3. Neoadjuvant 5-FU or Capecitabine Plus Radiation With or Without Oxaliplatin in Rectal Cancer Patients: A Phase III Randomized Clinical Trial

    Yothers, Greg; O’Connell, Michael J.; Beart, Robert W.; Wozniak, Timothy F.; Pitot, Henry C.; Shields, Anthony F.; Landry, Jerome C.; Ryan, David P.; Arora, Amit; Evans, Lisa S.; Bahary, Nathan; Soori, Gamini; Eakle, Janice F.; Robertson, John M.; Moore, Dennis F.; Mullane, Michael R.; Marchello, Benjamin T.; Ward, Patrick J.; Sharif, Saima; Roh, Mark S.; Wolmark, Norman


    Background: National Surgical Adjuvant Breast and Bowel Project R-04 was designed to determine whether the oral fluoropyrimidine capecitabine could be substituted for continuous infusion 5-FU in the curative setting of stage II/III rectal cancer during neoadjuvant radiation therapy and whether the addition of oxaliplatin could further enhance the activity of fluoropyrimidine-sensitized radiation. Methods: Patients with clinical stage II or III rectal cancer undergoing preoperative radiation were randomly assigned to one of four chemotherapy regimens in a 2x2 design: CVI 5-FU or oral capecitabine with or without oxaliplatin. The primary endpoint was local-regional tumor control. Time-to-event endpoint distributions were estimated using the Kaplan-Meier method. Hazard ratios were estimated from Cox proportional hazard models. All statistical tests were two-sided. Results: Among 1608 randomized patients there were no statistically significant differences between regimens using 5-FU vs capecitabine in three-year local-regional tumor event rates (11.2% vs 11.8%), 5-year DFS (66.4% vs 67.7%), or 5-year OS (79.9% vs 80.8%); or for oxaliplatin vs no oxaliplatin for the three endpoints of local-regional events, DFS, and OS (11.2% vs 12.1%, 69.2% vs 64.2%, and 81.3% vs 79.0%). The addition of oxaliplatin was associated with statistically significantly more overall and grade 3–4 diarrhea (P < .0001). Three-year rates of local-regional recurrence among patients who underwent R0 resection ranged from 3.1 to 5.1% depending on the study arm. Conclusions: Continuous infusion 5-FU produced outcomes for local-regional control, DFS, and OS similar to those obtained with oral capecitabine combined with radiation. This study establishes capecitabine as a standard of care in the pre-operative rectal setting. Oxaliplatin did not improve the local-regional failure rate, DFS, or OS for any patient risk group but did add considerable toxicity. PMID:26374429

  4. 浅析脏腑理论与方剂配伍的关系%A brief Analysis on the Relationship between the Zang Fu Theory and Compatibility of Formula

    齐放; 徐大鹏; 李明


    Each Zang-Fu organ has its own physiological characteristics .The relationships of inter-promotion and inter-restraint exist a-mong the Zang-Fu organs.Compatibility of formula can be modified according to physiological characteristics of the Zang and Fu organs and the relationships of inter-promotion and inter-restraint among the Zang and Fu organs .The Zang and Fu theory is an effective way to research the compatibility of formula and guide its clinical modification .%每个脏腑具有各自的生理特点,脏腑之间存在着相生相克的关系,方剂可以仿照脏腑的生理特点和脏腑之间生克制化的关系组方配伍。脏腑理论是研究方剂配伍和指导临证组方的有效途径。

  5. Effects of Shen-Fu Injection on the Expression of T-Cell-Specific Transcription Factors T-bet/Gata-3 in Porcine Postresuscitation Lung Injury

    Wei Gu


    Full Text Available Shen-Fu injection (SFI derived from the ancient traditional Chinese medicine. In this study, the effects of SFI on the expression of T-bet/GATA-3 and its potential mechanisms causing the shift of T cells from Th2 to Th1 on postresuscitation lung injury were examined in a porcine model of cardiac arrest. 30 pigs were randomly divided into SHAM ( and three return of spontaneous circulation (ROSC groups ( per group; 24 pigs were subjected to 8 min of electrically induced cardiac arrest and 2 min of basic life support, which received central venous injection of Shen-Fu (SFI, epinephrine (EP or saline (SA. After successful ROSC, 18 surviving pigs were sacrificed at 24 h after ROSC ( per group. The levels of serum and lung tissue interleukin (IL-4 and interferon (IFN-γ were measured by ELISA, and the protein and mRNA levels of GATA-3 and T-bet in the lung tissue were determined by western blotting and quantitative real-time polymerase chain reaction, respectively. Compared with the EP and SA groups, SFI treatment reduced the levels of IL-4 (, increased levels of IFN-γ (, and induced T-bet mRNA upregulation and GATA-3 mRNA downregulation (. SFI attenuated lung injury and regulated lung immune disorders. Therefore, SFI could protect postresuscitation lung injury by modulating a Th1/Th2 imbalance.

  6. USP22 knockdown enhanced chemosensitivity of hepatocellular carcinoma cells to 5-Fu by up-regulation of Smad4 and suppression of Akt.

    Zhang, Jing; Luo, Nan; Tian, Yu; Li, Jiazhi; Yang, Xiaozhou; Yin, Huimin; Xiao, Congshu; Sheng, Jie; Li, Yang; Tang, Bo; Li, Rongkuan


    USP22, a member of the deubiquitinases (DUBs) family, is known to be a key subunit of the human Spt-Ada-Gcn5 acetyltransferase (hSAGA) transcriptional cofactor complex. Within hSAGA, USP22 removes ubiquitin from histone proteins, thus regulating the transcription and expression of downstream genes. USP22 plays important roles in many cancers; however, its effect and the mechanism underlying HCC chemoresistance remain unclear. In the present study, we found that USP22 was highly expressed in chemoresistant HCC tissues and cells and was correlated with the prognosis of HCC patients who received chemotherapy. Silencing USP22 in chemoresistant HCC Bel/Fu cells dramatically inhibited proliferation, migration, invasion and epithelial-mesenchymal transition in vitro; suppressed tumorigenic and metastatic capacities in vivo; and inhibited drug resistance-related proteins (MDR1, LRP, MRP1). Mechanistically, we found that USP22 knockdown exerts its function through down-regulating PI3K and activating Smad4, which inhibited phosphorylation of Akt. Silencing Smad4 blocked USP22 knockdown-induced Akt inhibition in Bel/Fu cells. Our results, for the first time, provide evidence that USP22 plays a critical role in the development of chemoresistant HCC cells and that high USP22 expression serves as a molecular marker for the prognosis of HCC patients who undergo chemotherapy.

  7. Clinical implications of thymidylate synthetase, dihydropyrimidine dehydrogenase and orotate phosphoribosyl transferase activity levels in colorectal carcinoma following radical resection and administration of adjuvant 5-FU chemotherapy

    Ishikawa, Masashi; Miyauchi, Takayuki; Kashiwagi, Yutaka


    A number of studies have investigated whether the activity levels of enzymes involved in 5-fluorouracil (5-FU) metabolism are prognostic factors for survival in patients with colorectal carcinoma. Most reports have examined thymidylate synthetase (TS) and dihydropyrimidine dehydrogenase (DPD) in unresectable or metastatic cases, therefore it is unclear whether the activity of these enzymes is of prognostic value in colorectal cancer patients treated with radical resection and adjuvant chemotherapy with 5-FU. This study examined fresh frozen specimens of colorectal carcinoma from 40 patients who had undergone curative operation and were orally administered adjuvant tegafur/uracil (UFT) chemotherapy. TS, DPD and orotate phosphoribosyl transferase (OPRT) activities were assayed in cancer tissue and adjacent normal tissue and their association with clinicopathological variables was investigated. In addition, the relationships between TS, DPD and OPRT activities and patient survival were examined to determine whether any of these enzymes could be useful prognostic factors. While there was no clear relationship between pathological findings and TS or DPD activity, OPRT activity was significantly lower in tumors with lymph node metastasis than in tumors lacking lymph node metastasis. Postoperative survival was significantly better in the groups with low TS activity and/or high OPRT activity. TS and OPRT activity levels in tumor tissue may be important prognostic factors for survival in Dukes' B and C colorectal carcinoma with radical resection and adjuvant chemotherapy with UFT

  8. Assessment of benzene-induced hematotoxicity using a human-like hematopoietic lineage in NOD/Shi-scid/IL-2Rγnull mice.

    Masayuki Takahashi

    Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.

  9. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei


    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.

  10. Therapeutic effect of intra-arterial chemotherapy with DDP and 5-FU via bilateral uterine arteries for advanced uterine cervical cancer

    Zhou Kang; Li Xiaoguang; Jin Zhengyu; Yang Ning; Liu Wei; Pan Jie; Zhang Xiaobo; Shi Haifeng; Sun Hao; Wang Zhiwei


    Objective: To evaluate the therapeutic effect of intra-arterial chemotherapy with Ddp and 5-Fu via bilateral uterine arteries for advanced uterine cervical cancer. Methods: During the period of Jan. 2006-Jan. 2009, initial intra-arterial chemotherapy by using a combination of Ddp and 5-Fu via bilateral uterine arteries was performed in 72 patients (mean age 42.9 years) with advanced uterine cervical caner. Of 72 patients, stage I b2 cervical cancer was confirmed in 28, stage II a in 12 and stage II b in 32. Pathologically, cervical squamous cell carcinoma was seen in 56 and cervical adenocarcinoma in 16 patients. Ultrasonography and physical examination were conducted both before and after intra-arterial chemotherapy. The therapeutic results,complications,the surgical resection rate and the pathologic findings were observed and statistically analyzed. Results: Fifty-four patients received one treatment course and 18 patients received two treatment courses. The over all response rate was 77.8%. The response rates of patients with I b2, II a and II b cervical cancer were 92.9%, 83.3% and 62.5% respectively, the difference between three groups was statistically significant (P < 0.05). And the response rates of patients with squamous cell carcinoma and adenocarcinoma were 85.7% and 50.0% respectively, the difference between the two was statistically significant (P < 0.05). The most common side-effects included gastrointestinal symptoms and bone marrow suppression. Thirty-four patients received radical hysterectomy,among them, 22 (78.6%) had stage I b2, 8 (66.7%) had stage II a and 4 (12.5%) had stage II b cervical cancer (P < 0.05). Pathologic exam found no vaginal invasion and ovarian metastasis in all 34 patients. The occurrence of metastasis to lymph nodes and para uterine infiltration were 17.6% and 11.8% respectively. Conclusion: Intra-arterial chemotherapy with a combination of DDP and 5-Fu via bilateral uterine arteries can safely and effectively reduce the

  11. Fußball und Identität in Israel - Die Rolle der Medien im Kontext politisch-kultureller Identitätsbildung und Ausgrenzungsprozesse

    Michael Schuster


    Full Text Available Eine gängige These besagt, dass sich im Sport gesellschaftliche Konflikte widerspiegeln. Insbesondere dem Fußball wird unterstellt, eine Arena zur Artikulation und Repräsentation exklusiver Identität nationaler Minderheiten zu bieten. Der vorliegende Artikel widmet sich dem Thema der politisch-kulturellen Identitätsbildung in fragmentierten Gesellschaften. Am Beispiel der arabischen Minderheit in Israel wird dargestellt, dass unter bestimmten gesellschaftlichen Konstellationen der Fußball als Element der Popularkultur dem Staat auch als Mittel der Unterdrückung eines nationalen Minderheitenbewusstseins dienen kann. Unter Zuhilfenahme der Hegemonietheorie Antonio Gramscis kann das Entstehen einer pro-israelischen Identität der arabischen Minderheit - in Abgrenzung zu einer eigenen, arabischen oder widerständigen Identität - im Kontext des Fußballs rekonstruiert werden. Zu diesem Zweck wird aufgezeigt, welche Bedeutungs- und Definitionsmacht hebräische und arabische Sportmedien als Akteure divergierender Bedeutungszuschreibungen in dem Konfliktfeld der Herausbildung politisch-kultureller Identitäten besitzen und ihrerseits vorherrschende Integrations- und Dominanzprozesse beeinflussen. It is a widespread/popular thesis that sports are a useful means to display social conflicts; in particular it is argued that football offers a platform for the articulation and representation of the identity of ethnic/national/(cultural minorities. This article focuses on the construction of identity in fragmented societies with the help of politics and culture. With the example of the Arab minority in Israel it is portrayed here, that under particular social circumstances football can be used as an element of popular culture to repress the cultural and political identity of minorities. Gramsci's theory of hegemony explains the construction of a pro-Israel identity among the Arab minority which differs from their own Arab identity. It is shown here to

  12. A randomised placebo-exercise controlled trial of Kung Fu training for improvements in body composition in overweight/obese adolescents: the "Martial Fitness" study.

    Tsang, Tracey W; Kohn, Michael; Chow, Chin Moi; Singh, M Fiatarone


    The purpose of the study was to investigate if Chinese martial arts (Kung Fu, KF) might be effective for improving body composition, as well as being an appealing form of physical activity for inexperienced, sedentary, overweight/obese adolescents. Twenty subjects (age: 13.3 ± 1.8 y; BMI percentile: 98.6(86.5 - 99.8); 60% girls) were randomly-assigned to the supervised KF or placebo (Tai Chi, TC) control group 3 d.wk(-1) for 6 months. We assessed body composition, including total and regional fat and lean mass, total and regional bone mineral density (BMD), percent lean and fat mass, body mass index and waist circumference, at baseline and after 6 months of training using anthropometry and dual-energy X-ray absorptiometry (DXA). Habitual physical activity and dietary intake were recorded as covariates via self-report at each time-point. As expected due to natural growth, significant increases in height, weight, total and lumbar BMD, and lean mass were seen in the cohort over time, with a trend for increased whole body fat mass, with no difference between groups. By contrast, percent fat and android fat mass via DXA did not increase in either group over time. The absence of a similar expected increase in central adiposity over 6 months could indicate a positive effect of participation in both programs on the metabolically critical abdominal adiposity in this cohort. Further research in this area is warranted to determine ways to increase uptake and compliance, and to see if longer-term martial arts training not only maintains, but improves abdominal fat mass and related metabolic health indices in overweight/ obese adolescents. Key pointsParticipation in our martial arts trial attenuated the increases in body fat mass expected due to growth in our overweight/obese adolescent group.All subjects allocated to the Kung Fu intervention were satisfied with their Kung Fu training, in contrast to our placebo-exercise (Tai Chi) subjects, suggesting that this form of

  13. Applying dam height-storage curve to geomorphic features analysis within virtual geographic environment: a case study of the Hong-Shi-Mao watershed

    Wang, Daojun; Gong, Jianhua; Ma, Ainai; Li, Wenhang; Wang, Xijun


    There are generally two kinds of approaches to studying geomorphic features in terms of the quantification level and difference of major considerations. One is the earlier qualitative characterization, and the other is the 2-dimension measurement that includes section pattern and projection pattern. With the development of geo-information technology, especially the 3-D geo-visualization and virtual geographic environments (VGE), 3-dimension measurement and dynamic interactive between users and geo-data/geo-graphics can be developed to understand geomorphic features deeply, and to benefit to the effective applications of such features for geographic projects like dam construction. Storage-elevation curve is very useful for site selection of projects and flood dispatching in water conservancy region, but it is just a tool querying one value from the other one. In fact, storage-elevation curve can represent comprehensively the geomorphic features including vertical section, cross section of the stream and the landform nearby. In this paper, we use quadratic regression equation shaped like y = ax2 + bx + c and the DEM data of Hong-Shi-Mao watershed, Zi Chang County, ShaanXi Province, China to find out the relationship between the coefficients of the equation and the geomorphic features based on VGE platform. It's exciting that the coefficient "a" appear to be correlative strongly with the stream scale, and the coefficient "b" may give an index to the valley shape. In the end, we use a sub-basin named Hao-Jia-Gou of the watershed as an application. The result of correlative research about quadratic regression equation and geomorphic features can save computing and improve the efficiency in silt dam systems planning.

  14. Preliminary results of pre-operative 5-FU, low dose leucovorin (LV), and concurrent radiation therapy (RT) for resectable T3 rectal cancer

    Grann, Alison; Minsky, Bruce D.; Cohen, Alfred M.; Saltz, Leonard; Kelsen, David P.; Kemeny, Nancy; Ilson, David; Guillem, Jose G.; Paty, Philip B.; Bass, Joanne


    PURPOSE: We report the downstaging, acute toxicity, and preliminary local control and survival of pre-op 5-FU, low dose LV, and concurrent RT followed by post-op LV/5-FU for pts with clinically resectable, T3 rectal cancer. MATERIALS AND METHODS: A total of 32 pts (M:26, F:6) were prospectively treated from 12/91-8/95. Eligibility criteria included adequate hematologic indicies, primary adenocarcinoma limited to the pelvis, and T3 disease confirmed by transrectal ultrasound. Twenty five pts were considered clinically to require an APR on initial (pre-treatment) assessment by their operating surgeon. The median age was 56 (range: 24-80), and the median distance from the anal verge was 5.0cm (range: 3-9cm). Pts received 2 monthly cycles (bolus daily X 5) of LV (20mg/m2) and 5-FU (325mg/m2), beginning concurrently with day 1 of RT, followed by surgery 4-5 weeks later. RT included 4680 cGy to the pelvis followed by a boost to 5040 cGy. Post-operatively, pts received a median of 2 monthly cycles (range: 0-10 cycles) of LV (20 mg/m2) and 5-FU (425mg/m2). A toxicity assessment was performed at each visit using the NCI toxicity criteria modified for gastrointestinal toxicity. The median follow-up was 12 months (range: 3-48 months). All 32 patients were included in the analysis of toxicity, sphincter preservation, and downstaging. Analysis of patterns of failure and survival was limited to the 15 pts who had a minimum follow-up of 1yr or developed failure prior to 1 yr. For this subset the median follow-up was 24 months (range: 3-48 months). RESULTS: During the pre-op segment, individual grade 3+ acute toxicities were; diarrhea: 16%, bowel movements: 16%, leukopenia: 12%. The incidence of total toxicity was 25% ((8(32))). The median nadir counts were; WBC: 2.9 (range: 1.7-5.6), HGB: 12.4 (range: 7.1-15.0), and PLT (X1000): 161 (range: 113-237). The pathologic complete response rate was 9% ((3(32))). An additional 13% ((4(32))) had negative lymph nodes and 1-2 microscopic

  15. Molecular analysis of Ixodes rugicollis, Candidatus Neoehrlichia sp. (FU98) and a novel Babesia genotype from a European badger (Meles meles).

    Hornok, Sándor; Trauttwein, Klaudia; Takács, Nóra; Hodžić, Adnan; Duscher, Georg Gerhard; Kontschán, Jenő


    The European badger (Meles meles) is a widespread mammal in most countries of the European continent, with increasingly recognized veterinary/medical importance owing to its preferred habitats (including pastures and urban environments), broad spectrum of food items, and role as a game hunting target. However, ticks and tick-borne pathogens associated with badgers are only partly known, and most of them have not yet been analysed with molecular biological methods The aim of this study was to perform molecular taxonomic analysis of ticks collected from a road-killed European badger, as well as to molecularly investigate its ticks and blood sample for the presence of Anaplasmataceae and piroplasms. Ticks from the badger were morphologically identified as females of Ixodes rugicollis. Based on its cytochrome oxidase subunit I (COI) and 16S rRNA sequences, I. rugicollis phylogenetically clustered together with I. lividus and I. arboricola, i.e. other members of the subgenus Pholeoixodes. The blood sample of the badger contained the DNA of Candidatus Neoehrlichia sp. (FU98) recently identified in red fox in Austria and the Czech Republic. This genotype is most closely related to Ca. N. lotoris (from raccoons in North America), and has lower sequence identity with the I. ricinus-transmitted zoonotic agent, Ca. N. mikurensis found in Eurasia. In the blood of the badger and in one female I. rugicollis, the DNA of a new Babesia genotype was also present, which differed from a piroplasm detected in M. meles in Spain, and clustered phylogenetically in the B. microti clade. Phylogenetic analysis of I. rugicollis (based on two genetic markers) confirms its status in subgenus Pholeoixodes. Ca. Neoehrlichia sp. (FU98) was identified for the first time in M. meles and in Hungary. In addition, a molecularly previously not yet characterized Babesia genotype occurs in badgers in Central Europe. Copyright © 2016 Elsevier GmbH. All rights reserved.

  16. O "Kung Fu" no Brasil na perspectiva dos mestres pioneiros: problemas e perspectivas no uso da história oral como instrumental de análise

    Fernando Dandoro Castilho FERREIRA


    Full Text Available Objetivando analisar a disseminação das artes marciais chinesas no Brasil optamos por entrevistar mestres pioneiros que imigraram da China trazendo na bagagem o "Kung Fu". Ao fazer esta opção em nossa dissertação, tomamos contato com um instrumental que é o uso de entrevistas na perspectiva da História Oral. Remexer a memória, aceitar os silêncios, respeitar o conhecimento construído e desconstruir outros, por si só já se mostram tarefas bastante árduas. Escutar estes mestres nos levou, mesmo que superficialmente, a tentar compreender aspectos da cultura chinesa sob os quais os mestres e o próprio "Kung Fu" se fundamentaram. Entender as lacunas, as dificuldades e as possibilidades do uso da História Oral como ferramenta metodológica é o que neste artigo buscamos, na perspectiva de contribuir com análises semelhantes, seja de outras práticas marciais ou mesmo de outros olhares sobre a cultura chinesa. Assim sendo, objetivamos neste artigo apontar e discutir a metodologia da História Oral e sua pertinência para o estudo das práticas marciais a partir do uso de entrevistas. Podemos, fruto da discussão apresentada, apontar a História Oral como instrumental bastante útil para a discussão das práticas marciais, considerando logicamente, as pertinências e especificidades necessárias para a adequada utilização desta metodologia de pesquisa.

  17. Pituitary-dependent hyperadrenocorticism in a shi tzu dog treated with twice-daily oral trilostane: a case reportHyperadrenocorticismo hipófise dependente em um cão shi tzu tratado com trilostane oral a cada 12 horas: relato de caso

    Lucas Alécio Gomes


    Full Text Available Hyperadrenocorticism can be defined as a chronic high circulating cortisol, and is a relatively common disease in dogs when compared to cats. Of dogs with naturally occurring HAC, 80 to 85% have pituitary-dependent hyperadrenocorticism (PDH, which is an excessive secretion of ACTH by the pituitary, causing bilateral adrenal hyperplasia and excessive secretion of glucocorticoids. More than 90% of dogs with PDH have a pituitary tumor. The aim of this article is to report a case of a dog, seven years old, female, Shi Tzu, that presented with panting, polyuria/polydipsia, polyphagia, pendulous abdomen and bilateral abdominal alopecia, and intermittent weakness in the pelvic limbs. Based on laboratorial and screening tests a pituitary-dependent hyperadrenocorticism was diagnosed and treated with twice-daily trilostane, orally. In the early monitoring period, ACTH test was performed with an unusual interval (to 30 days. In this case, the starting dose didn’t show improvement in the cutaneous alterations, requiring an increase on the dosage. Hiperadrenocorticismo (HAC é uma doença relativamente comum em cães quando comparado aos gatos e pode ser definido como aumento persistente do cortisol na circulação sanguínea. Quanto ao tipo de manifestação o HAC hipófise-dependente ocorre em 80 a 85% dos casos, causando secreção excessiva de ACTH pela hipófise levando ao aumento bilateral das glândulas adrenais. Mais de 90% dos casos de HAC hipófise-dependente (em cães ocorrem devido a tumores na glândula. O objetivo deste trabalho é relatar o caso de uma cadela da raça Shi Tzu, com sete anos de idade, que apresentou respiração ofegante, poliúria/polidipsia, polifagia, abdome pendular, alopecia bilateral simétrica e fraqueza intermitente em membros pélvicos. Os exames laboratoriais de rotina associados aos testes de triagem confirmaram a suspeita de hiperadrenocorticismo hipófise dependente. O tratamento desde o início tem sido com

  18. A prospective evaluation of treatment with Selective Internal Radiation Therapy (SIR-spheres) in patients with unresectable liver metastases from colorectal cancer previously treated with 5-FU based chemotherapy

    Lim, L; Gibbs, P; Yip, D; Shapiro, JD; Dowling, R; Smith, D; Little, A; Bailey, W; Liechtenstein, M


    To prospectively evaluate the efficacy and safety of selective internal radiation (SIR) spheres in patients with inoperable liver metastases from colorectal cancer who have failed 5FU based chemotherapy. Patients were prospectively enrolled at three Australian centres. All patients had previously received 5-FU based chemotherapy for metastatic colorectal cancer. Patients were ECOG 0–2 and had liver dominant or liver only disease. Concurrent 5-FU was given at investigator discretion. Thirty patients were treated between January 2002 and March 2004. As of July 2004 the median follow-up is 18.3 months. Median patient age was 61.7 years (range 36 – 77). Twenty-nine patients are evaluable for toxicity and response. There were 10 partial responses (33%), with the median duration of response being 8.3 months (range 2–18) and median time to progression of 5.3 mths. Response rates were lower (21%) and progression free survival shorter (3.9 mths) in patients that had received all standard chemotherapy options (n = 14). No responses were seen in patients with a poor performance status (n = 3) or extrahepatic disease (n = 6). Overall treatment related toxicity was acceptable, however significant late toxicity included 4 cases of gastric ulceration. In patients with metastatic colorectal cancer that have previously received treatment with 5-FU based chemotherapy, treatment with SIR-spheres has demonstrated encouraging activity. Further studies are required to better define the subsets of patients most likely to respond

  19. Prevalence of swallowing and speech problems in daily life after chemoradiation for head and neck cancer based on cut-off scores of the patient-reported outcome measures SWAL-QOL and SHI.

    Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René


    The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.

  20. Difference in effect of single immunosuppressive agents (cyclophosphamide, CCNU, 5-FU) on peripheral blood immune cell parameters and central nervous system immunoglobulin synthesis rate in patients with multiple sclerosis.

    Shih, W W; Baumhefner, R W; Tourtellotte, W W; Haskell, C M; Korn, E L; Fahey, J L


    Cyclophosphamide (CY), 1-(2-chloroethyl)-3-cyclohexyl-1-nitrosourea (CCNU) and 5-fluorouracil (5-FU) were given in single course schedules to chronic progressive multiple sclerosis (MS) patients clinically stable for 6 months. The following peripheral immune cellular parameters were measured before, during and after each drug administration: white blood count (WBC), polymorphonuclear count (PMN), lymphocyte count, percentage of T cells, T cell response to phytohaemagglutinin (PHA), percentage of B cells, percentage of cells bearing receptors for the Fc portion of immunoglobulin (% FcR cells), killer (K) cell activity defined by antibody-dependent cellular cytotoxicity (ADCC), and natural killer (NK) cell activity. Central nervous system (CNS) immunoglobulin G (IgG) synthesis was also measured. The patients were followed carefully by both quantitative and qualitative methods for any change in their neurologic condition. Selective reduction in NK activity was observed with CY and 5-FU while no significant alteration was seen in %FcR cells and K activity. CY differed from 5-FU in reducing lymphocyte count and B cell percentage while 5-FU decreased the percentage of T cells. CCNU, but not the other drugs, reduced T cell proliferative response to PHA. In addition, CCNU, which is known to penetrate well into the nervous system, caused a modest reduction in CNS IgG synthesis, while 5-FU had an uncertain effect. Clinically the patients were unchanged or continued to progress in their disability. The results suggest an independence of the CNS immune from the systemic immune system in MS in response to many immunosuppressive drugs. PMID:6603303

  1. 石氏针药结合治疗急性踝关节扭伤早期疗效研究%Clinical Observation on the Treatment of Acute Ankle Sprain by Shi's Acupuncture Therapy Combined with Compound Zijing Plaster

    李涛; 郭海玲; 杨光月; 商海滨; 赵咏芳


    目的:研究石氏针刺结合复方紫荆消伤膏外用治疗急性踝关节扭伤早期症状改善特点,评价石氏针刺结合外用膏药治疗急性踝关节扭伤、弹力绷带固定治疗和功能锻炼治疗的优效性.方法:对上海市浦东新区6家医院2014年1月至2016年10月收治的300例急性踝关节扭伤患者随机分为针药结合治疗组、弹力绷带固定组和功能锻炼组,三组受试者分别予石氏针刺结合膏药外用治疗,弹力绷带固定结合膏药治疗和功能锻炼处方结合膏药治疗.在入组时(入组)、第7天(第1周、访视一)、第28天(第4周、访视二)和第42天(第6周、访视三)采用美国足踝外科学会AOFAS踝后足评分量表、VAS疼痛评分进行优效性评价.结果:三种治疗方法对急性踝关节扭伤均有疗效(P<0.05).在第7天,针药结合组AOFAS评分与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组AOFAS评分高于绷带固定组和功能锻炼组评分.在第7天、第28天针药结合组VAS疼痛评分变化与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组VAS疼痛评分改善大于弹力绷带固定组和功能锻炼组.针药结合组AOFAS疗效评定痊愈率和VAS疼痛疗效评定痊愈率高于绷带固定组和功能锻炼组(P<0.05).结论:石氏针药结合治疗急性踝关节扭伤临床疗效明确,对损伤早期的疼痛改善和功能恢复疗效优于弹力绷带固定治疗和功能锻炼治疗.%Objective:To study the improvement characteristics of early symptoms of acute ankle sprain treated with the Shi's acupuncture therapy combined with compound Zijing plaster,and to evaluate the superiority of the Shi's therapy combined with topical plaster,elastic bandage fixation and functional exercise therapy in the treatment of acute ankle sprain.Methods:All 300 cases of acute ankle sprain patients were randomly assigned to groups of Shi's therapy

  2. The ReFuGe 2020 consortium - Using ‘omics’ approaches to explore the adaptability and resilience of coral holobionts to environmental change

    Christian Robert Voolstra


    Full Text Available Human-induced environmental changes have been linked directly with loss of biodiversity. Coral reefs, which have been severely impacted by anthropogenic activities over the last few decades, exemplify this global problem and provide an opportunity to develop research addressing key knowledge gaps through ‘omics’-based approaches. While many stressors, e.g. global warming, ocean acidification, overfishing and coastal development have been identified, there is an urgent need to understand how corals function at a basic level in order to conceive strategies for mitigating future reef loss. In this regard, availability of fully sequenced genomes has been immensely valuable in providing answers to questions of organismal biology. Given that corals are metaorganisms comprised of the coral animal host, its intracellular photosynthetic algae, and associated microbiota (i.e. bacteria, archaea, fungi, viruses, these efforts must focus on entire coral holobionts. The Reef Future Genomics 2020 (ReFuGe 2020 consortium has formed to sequence hologenomes of ten coral species representing different physiological or functional groups to provide foundation data for coral reef adaptation research that is freely available to the research community.

  3. Antidiabetic Effect of Tibetan Medicine Tang-Kang-Fu-San on High-Fat Diet and Streptozotocin-Induced Type 2 Diabetic Rats

    Bailu Duan


    Full Text Available The aim of this study was to investigate the antidiabetic effects of a Tibetan medicine, Tang-Kang-Fu-San (TKFS, on experimental type 2 diabetes mellitus (T2DM rats and to explore its underlying mechanisms. Firstly two major chemical compositions of TKFS, gallic acid and curcumin, were characterized by HPLC fingerprint analysis. Next T2DM in rats was induced by high-fat diet and a low-dose streptozotocin (STZ 35 mg/kg. Then oral gavage administration of three different doses of TKFS (0.3 g/kg, 0.6 g/kg, and 1.2 g/kg was given to T2DM rats. Experimental results showed that TKFS dramatically reduced the levels of fasting blood glucose, fasting blood insulin, triglyceride, total cholesterol, LDL cholesterol, and HDL cholesterol, even though it did not alter the animal body weight. The downregulation of phosphorylation-AKT (p-AKT and glucose transporter-4 (GLUT4 in skeletal muscle of T2DM rats was restored and abnormal pathological changes in pancreas tissues were also improved. Our work showed that TKFS could alleviate diabetic syndromes, maintain the glucose homeostasis, and protect against insulin resistance in T2DM rats, and the improvement of AKT phosphorylation and GLUT4 translocation in skeletal muscle would be one of its possible underlying mechanisms.

  4. Silencing of NRF2 Reduces the Expression of ALDH1A1 and ALDH3A1 and Sensitizes to 5-FU in Pancreatic Cancer Cells

    Hong-Quan Duong


    Full Text Available Pancreatic cancer remains an intractable cancer with a poor five-year survival rate, which requires new therapeutic modalities based on the biology of pancreatic oncogenesis. Nuclear factor E2 related factor-2 (NRF2, a key cytoprotective nuclear transcription factor, regulates antioxidant production, reduction, detoxification and drug efflux proteins. It also plays an essential role in cell homeostasis, cell proliferation and resistance to chemotherapy. We aimed to evaluate the possibility that modulation of NRF2 expression could be effective in the treatment of pancreatic cancer cells. We investigated whether the depletion of NRF2 by using small interfering RNAs (siRNAs is effective in the expression of biomarkers of pancreatic cancer stemness such as aldehyde dehydrogenase 1 family, member A1 (ALDH1A1 and aldehyde dehydrogenase 3 family, member A1 (ALDH3A1. NRF2 knockdown markedly reduced the expression of NRF2 and glutamate-cysteine ligase catalytic subunit (GCLC in cell lines established from pancreatic cancers. NRF2 silencing also decreased the ALDH1A1 and ALDH3A1 expression. Furthermore, this NRF2 depletion enhanced the antiproliferative effects of the chemotherapeutic agent, 5-fluorouracil (5-FU in pancreatic cancer cells.

  5. On-line monitoring the extract process of Fu-fang Shuanghua oral solution using near infrared spectroscopy and different PLS algorithms

    Kang, Qian; Ru, Qingguo; Liu, Yan; Xu, Lingyan; Liu, Jia; Wang, Yifei; Zhang, Yewen; Li, Hui; Zhang, Qing; Wu, Qing


    An on-line near infrared (NIR) spectroscopy monitoring method with an appropriate multivariate calibration method was developed for the extraction process of Fu-fang Shuanghua oral solution (FSOS). On-line NIR spectra were collected through two fiber optic probes, which were designed to transmit NIR radiation by a 2 mm flange. Partial least squares (PLS), interval PLS (iPLS) and synergy interval PLS (siPLS) algorithms were used comparatively for building the calibration regression models. During the extraction process, the feasibility of NIR spectroscopy was employed to determine the concentrations of chlorogenic acid (CA) content, total phenolic acids contents (TPC), total flavonoids contents (TFC) and soluble solid contents (SSC). High performance liquid chromatography (HPLC), ultraviolet spectrophotometric method (UV) and loss on drying methods were employed as reference methods. Experiment results showed that the performance of siPLS model is the best compared with PLS and iPLS. The calibration models for AC, TPC, TFC and SSC had high values of determination coefficients of (R2) (0.9948, 0.9992, 0.9950 and 0.9832) and low root mean square error of cross validation (RMSECV) (0.0113, 0.0341, 0.1787 and 1.2158), which indicate a good correlation between reference values and NIR predicted values. The overall results show that the on line detection method could be feasible in real application and would be of great value for monitoring the mixed decoction process of FSOS and other Chinese patent medicines.

  6. Evaluation of hematologic toxicity of concurrent chemoradiotherapy using protracted infusion of low-dose cisplatin and 5-FU and radiotherapy for malignant tumors in elderly patients

    Itoh, Yoshiyuki; Fuwa, Nobukazu; Matsumoto, Akira; Asano, Akiko; Sasaoka, Masahiro; Ii, Noriko; Kimura, Yasuo


    We evaluated the relationship between hematologic toxicity and the daily dose of CDDP or the field size of radiation in 26 patients with malignant tumors aged>70 years who underwent concurrent chemoradiotherapy consisting of infusion of low-dose CDDP and 5-FU and radiotherapy. None of the 26 patients developed Gr4 toxicity. The incidence of Gr3 toxicity was 23.1% (6/26) for leukocytes, 7.7% (2/26) for platelets, and 3.8% (1/26) for hemoglobin, being high for leukocytes. When the patients were classified into those aged 70-74 years (younger group) and those aged>75 years (older group), the incidence of Gr3 leukocyte and platelet toxicity was low in the former but high in the latter. Concerning the relationship between hematologic toxicity and the field size of radiation, the incidence of Gr3 hemoglobin, leukocyte, and platelet toxicity with a radiation field size 2 was 44% (4/9) in the older group but 0% in the younger group. In the older group, the daily CDDP dose tended to be low, and the field size of radiation tended to be small, but the incidence of hematological toxicity was high. In the younger group, the incidence of Gr2 or Gr3 toxicity increased with the daily dose of CDDP and the field size of radiation. (author)

  7. Impact of Martial Arts (Judo, Karate, and Kung Fu) on Bone Mineral Density Gains in Adolescents of Both Genders: 9-Month Follow-Up.

    Ito, Igor H; Kemper, Han C G; Agostinete, Ricardo R; Lynch, Kyle R; Christofaro, Diego G D; Ronque, Enio R; Fernandes, Rômulo A


    To compare bone mineral density (BMD) gains in adolescents of both genders stratified according to different martial art styles in a 9-month follow-up study. The longitudinal study consisted of 29 adolescents of both genders and age between 11 and 17 years stratified into a control group (not engaged in any sport) and 50 fighters (kung fu/karate, n = 29; judo, n = 21). All 79 subjects underwent anthropometric measures (weight, height, leg length, and height set) and dual-energy X-ray absorptiometry (BMD, in g/cm 2 ) at 2 moments, baseline and 9 months later. Maturity offset (age at peak height velocity), lean soft tissue, chronological age, and resistance training were treated as covariates. Male judoists presented higher gains in BMD-spine [0.098 g/cm 2 (95% confidence interval, 0.068-0.128)] than control group [0.040 g/cm 2 (95% confidence interval, 0.011-0.069)] (post hoc test with P = .030). There was no effect of martial art on BMD gains among girls. Independently of gender, in all multivariate models, lean soft tissue constituted the most relevant covariate. Judo practice in adolescents affected the bone accrual significantly after 9-month follow-up compared with controls, mainly in boys.

  8. Validation of the 12-gene colon cancer recurrence score in NSABP C-07 as a predictor of recurrence in patients with stage II and III colon cancer treated with fluorouracil and leucovorin (FU/LV) and FU/LV plus oxaliplatin.

    Yothers, Greg; O'Connell, Michael J; Lee, Mark; Lopatin, Margarita; Clark-Langone, Kim M; Millward, Carl; Paik, Soonmyung; Sharif, Saima; Shak, Steven; Wolmark, Norman


    Accurate assessments of recurrence risk and absolute treatment benefit are needed to inform colon cancer adjuvant therapy. The 12-gene Recurrence Score assay has been validated in patients with stage II colon cancer from the Cancer and Leukemia Group B 9581 and Quick and Simple and Reliable (QUASAR) trials. We conducted an independent, prospectively designed clinical validation study of Recurrence Score, with prespecified end points and analysis plan, in archival specimens from patients with stage II and III colon cancer randomly assigned to fluorouracil (FU) or FU plus oxaliplatin in National Surgical Adjuvant Breast and Bowel Project C-07. Recurrence Score was assessed in 892 fixed, paraffin-embedded tumor specimens (randomly selected 50% of patients with tissue). Data were analyzed by Cox regression adjusting for stage and treatment. Continuous Recurrence Score predicted recurrence (hazard ratio for a 25-unit increase in score, 1.96; 95% CI, 1.50 to 2.55; P < .001), as well as disease-free and overall survival (both P < .001). Recurrence Score predicted recurrence risk (P = .001) after adjustment for stage, mismatch repair, nodes examined, grade, and treatment. Recurrence Score did not have significant interaction with stage (P = .90) or age (P = .76). Relative benefit of oxaliplatin was similar across the range of Recurrence Score (interaction P = .48); accordingly, absolute benefit of oxaliplatin increased with higher scores, most notably in patients with stage II and IIIA/B disease. The 12-gene Recurrence Score predicts recurrence risk in stage II and stage III colon cancer and provides additional information beyond conventional clinical and pathologic factors. Incorporating Recurrence Score into the clinical context may better inform adjuvant therapy decisions in stage III as well as stage II colon cancer.

  9. Preliminary clinical evaluation of continuous infusion of 5-FU and low-dose cisplatin (LFP) therapy alone and combined with radiation therapy for treatment of advanced or recurrent esophageal cancer

    Itoh, Satoshi; Morita, Sojiro; Ohnishi, Takenao; Tsuji, Akihito; Takamatsu, Masahiro; Horimi, Tadashi


    We evaluated the clinical effect of 5-FU and low-dose Cisplatin (LFP) therapy alone and LFP therapy combined with radiation therapy in patients with advanced or recurrent esophageal cancer. From March 1995 to September 2000, 11 patients with inoperable esophageal cancer, 8 patients with adjuvant chemotherapy post operation, and 14 patients with recurrent esophageal cancer were treated with LFP therapy. 5-FU (160 mg/m 2 /day) was continuously infused over 24 hours, and CDDP (3-7 mg/m 2 /day) was infused for 30 minutes. The administration schedule consisted of 5-FU for 7 consecutive days and CDDP for 5 days followed by a 2-day rest, each for four weeks. We combined radiation therapy for the patients with all lesions that could be included in the radiation field. Of 30 patients with measurable lesions the response rates of LFP therapy alone and LFP therapy combined with radiation therapy were 33% and 60%, respectively. Toxicity over grade 3 appeared in 3 of 15 patients with LFP therapy combined with radiation therapy. There was no significant difference between LFP therapy alone and LFP therapy combined with radiation therapy with regard to survival rate of inoperable and recurrent esophageal cancer. In conclusion, LFP therapy alone may be effective for esophageal cancer. (author)

  10. Xue-fu-Zhu-Yu decoction protects rats against retinal ischemia by downregulation of HIF-1α and VEGF via inhibition of RBP2 and PKM2.

    Tan, Shu-Qiu; Geng, Xue; Liu, Jorn-Hon; Pan, Wynn Hwai-Tzong; Wang, Li-Xiang; Liu, Hui-Kang; Hu, Lei; Chao, Hsiao-Ming


    Retinal ischemia-related eye diseases result in visual dysfunction. This study investigates the protective effects and mechanisms of Xue-Fu-Zhu-Yu decoction (XFZYD) with respect to retinal ischemia. Retinal ischemia (I) was induced in Wistar rats by a high intraocular pressure (HIOP) of 120 mmHg for 1 h, which was followed by reperfusion of the ischemic eye; the fellow untreated eye acted as a control. Electroretinogram (ERG), biochemistry and histopathology investigations were performed. Significant ischemic changes occurred after ischemia including decreased ERG b-wave ratios, less numerous retinal ganglion cells (RGCs), reduced inner retinal thickness, fewer choline acetyltransferase (ChAT) labeled amacrine cell bodies, increased glial fibrillary acidic protein (GFAP) immunoreactivity and increased vimentin Müller immunolabeling. These were accompanied by significant increases in the mRNA/protein concentrations of vascular endothelium growth factor, hypoxia-inducible factor-1α, pyruvate kinase M2 and retinoblastoma-binding protein 2. The ischemic changes were concentration-dependently and significantly altered when XFZYD was given for seven consecutive days before or after retina ischemia, compared to vehicle. These alterations included enhanced ERG b-wave amplitudes, more numerous RGCs, enhanced inner retinal thickness, a greater number of ChAT immunolabeled amacrine cell bodies and decreased GFAP/vimentin immunoreactivity. Furthermore, decreased mRNA levels of VEGF, HIF-1α, PKM2, and RBP2 were also found. Reduced protein concentrations of VEGF, HIF-1α, PKM2, and RBP2 were also demonstrated. Furthermore, there was an inhibition of the ischemia-associated increased ratios (target protein/β-actin) in the protein levels of VEGF, HIF-1α, PKM2, and RBP2, which were induced by Shikonin, JIB-04 or Avastin. XFZYD would seem to protect against well-known retinal ischemic changes via a synergistic inhibition of RBP2 and PKM2, as well as down-regulation of HIF-1

  11. Estimating the terrestrial N processes in subtropical mountainous forestry catchment through INCA-N: A case study in FuShan catchment, Taiwan

    Lu, Meng-Chang; Huang, -Chuan, Jr.; Chang, Chung-Te; Shih, Yu-Ting; Lin, Teng-Chiu


    The riverine DIN is a crucial indicator for eutrophication in river network. The riverine DIN export in Taiwan is featured by the extremely high yield, ~3800 kg-N km-2yr-1, nearly 20-fold than the global average, showing the interesting terrestrial N process yet rarely documented. In this study we collected the DIN samples in rainwater, soil water, and stream water in a mountainous forest watershed, FuShan experimental forest watershed 1 (WS1) which is a natural broadleaf forest without human activities. Based on the intensive observations, we applied the INCA-N to simulate the riverine DIN response and thus estimate the terrestrial N processes in a global synthesis. The result showed that both discharge and DIN yield were simulated well with the average Nash-Sutcliffe efficiency coefficient of 0.83 and 0.76 , respectively. Among all N processes, N uptake, mineralization, nitrification, denitrfication, and immobilization are significantly positive correlated with soil moisture (R2>0.99), which indicates that soil moisture greatly influences N cycle processes. The average rate of mineralization and nitrification in wet years are consistent with documented values, whereas the rates in dry years are lower than the observations. Despite the high nitrification rate, the secondary forest may uptake abundant N indicating the plant uptake, which responds for removing considerable nitrate, is a controlling factor in forest ecosystem. Our simulated denitrification rate falls between the documented rates of temperate forest and agricultural area, and that may be affected by the high N-deposition in Taiwan. Simulated in-stream denitrification rate is less than 10% of the rate in soil, and is a little lower than that in temperate forest. This preliminary simulation provides an insightful guide to establish the monitoring programme and improve the understanding of N cycle in subtropical.


    Tracey W. Tsang


    Full Text Available The purpose of the study was to investigate if Chinese martial arts (Kung Fu, KF might be effective for improving body composition, as well as being an appealing form of physical activity for inexperienced, sedentary, overweight/obese adolescents. Twenty subjects (age: 13.3 ± 1.8 y; BMI percentile: 98.6(86.5 - 99.8; 60% girls were randomly-assigned to the supervised KF or placebo (Tai Chi, TC control group 3 d.wk-1 for 6 months. We assessed body composition, including total and regional fat and lean mass, total and regional bone mineral density (BMD, percent lean and fat mass, body mass index and waist circumference, at baseline and after 6 months of training using anthropometry and dual-energy X-ray absorptiometry (DXA. Habitual physical activity and dietary intake were recorded as covariates via self-report at each time-point. As expected due to natural growth, significant increases in height, weight, total and lumbar BMD, and lean mass were seen in the cohort over time, with a trend for increased whole body fat mass, with no difference between groups. By contrast, percent fat and android fat mass via DXA did not increase in either group over time. The absence of a similar expected increase in central adiposity over 6 months could indicate a positive effect of participation in both programs on the metabolically critical abdominal adiposity in this cohort. Further research in this area is warranted to determine ways to increase uptake and compliance, and to see if longer-term martial arts training not only maintains, but improves abdominal fat mass and related metabolic health indices in overweight/ obese adolescents

  13. Title of paper: the induction of P-53 independent programmed cell death (apoptosis) with ionizing radiation and 5-fluorouracil (5-FU) in the HT-29 human colon carcinoma cell line

    Blackstock, A. Wm.; Gill, Misha; Hess, Suzanne M.; Fisher, Robert W.; Leadon, Steven A.; Tepper, Joel E.


    Purpose/Objective: The role of programmed cell death (apoptosis) as a cellular response to cancer therapy such as radiation or chemotherapy is the subject of much study, and manipulation of the apoptotic response in tumor cells may be valuable in the treatment of a variety of cancers. Both p53 dependent and independent apoptotic pathways have been identified; p53 is mutated in at least 50 % of human cancers and a majority of radiation resistant tumors contain p53 mutations. This study is designed to examine the induction of programmed cell death in a human colon carcinoma cell line that possesses two mutated p53 alleles. Ionizing radiation alone, or in combination with the chemotherapeutic drug 5-fluorouracil (5-FU), were used to elicit the apoptotic response. This study will focus on whether these treatments can induce a significant apoptotic response in cells that have mutated p53 alleles. Materials and Methods: HT-29 cells were assessed for clonogenic survival after being plated at a variety of densities, and treated with single graded doses of radiation (0, 1, 2, 4, 6, 8, 10 Gy) either alone or immediately prior to a 24 hour exposure to 5-FU (2 ug/ml). The extent of radiation and 5-FU-induced apoptosis was determined in the HT-29 cell line after single doses of 0, 2, 5, and 10 Gy either alone or immediately prior to a 24 hour incubation in 5-FU (2 ug/ml). Three separate assays were used to evaluate the apoptotic response. Cells undergoing apoptosis undergo gross morphological changes including a condensation of chromatin, membrane blebbing, and an eventual release of membrane bound cytoplasmic fragments. Hematoxylin and eosin staining were used to visualize some of these morphological changes. Another characteristic of the apoptotic response is the activation of an endonuclease that cleaves DNA into specific fragments. Accordingly, an ELISA cell death assay (Boehringer Mannheim, Indianapolis IN) was used to quantitate cytoplasmic histone-associated DNA

  14. No fué suficiente

    Gustavo Junca


    Full Text Available Crecimiento económico. Teoría, instituciones y experiencia internacional. Mónica Aparicio y William Easterly (coordinadores. Banco Mundial-Banco de la República, Bogotá, 1995,598 págs.

  15. [Comparison of Curative Effect between Fu Fang Huang Dai Pian and Arsenic Trioxide in Treatment of 45 Patients with Acute Promyelocytic Leukaemia].

    Wang, Jian; Huang, Jun-Bin; Liu, Zu-Lin; Zhang, Bi-Hong; Xu, Hong-Gui; Xue, Hong-Man; Chen, Chun


    To investigate the clinical efficacy of Fu Fan Huang Dai Pian(RIF) and arsenic trioxide (ATO) regimens for treatment of children with acute promyelocytic leukemia (APL) and to explore the risk factors affecting the prognosis of patients. The clinical data of 45 newly diagnosed APL children admitted in our hospital from January 2004 to May 2017 were analyzed retrospectively. Among 45 APL children, 25 children were treated by chemotherapetic regimen including RIF (RIF group), another 20 children were treated by chemotherapeutic regimen including ATO (ATO group). The follow-up was performed in all APL children. The prognosis and incidence of side reactions from drugs in 2 groups were compared, and the high risk factors affecting the prognosis of patients were analyzed. The median follow-up time was 49.8% months. In RIF group, no early death occured in 25 APL children; 5 cases did not achieve complete remission (CR) after induction therapy, CR rate was 88%. Out of 25 cases 2 caes relapsed, 3 cases died, 20 cases maintained contined CR (CCR), 2 cases failed to be followed-up. In ATO group, 2 cases suffered from early death, 5 cases did not achieve CR after induction therapy, CR rate was 90%, 2 caese relapsed and died, 15 cases maintained CCR, the follow-up failed in 1 caes. The 5 year- OS and EFS rate in all the patients were predicted as (82.2±6.2)% and (76.4±6.6)% respectively. The OS and EFS rate in RIF group were (86.1±7.4)% and (78.4±8.6)% respectively, which were significantly different from OS and EFS rate (76.4%±10.6%) and (74.0%±10.1%) respectively in ATO group (all P>0.05). As for the side reaction from drug, except for the cardiac damage (P0.05). In addition, the 5 year-OS and EFS rates in APL children with CNSL were significantly lower than those in APL children without CNSL (all Phigh risk were significantly lower than those in APL children reached M1 after induction therapy and with low and standerd risk (Ptreatment of APL children. The CNSL, poor

  16. ShenFu Preparation Protects AML12 Cells Against Palmitic Acid-Induced Injury Through Inhibition of Both JNK/Nox4 and JNK/NFκB Pathways

    Jia-Fu Ji


    Full Text Available Background/Aims: Nonalcoholic steatohepatitis includes steatosis along with liver inflammation, hepatocyte injury and fibrosis. In this study, we investigated the protective role and the potential mechanisms of a traditional Chinese medicine ShenFu (SF preparation in an in vitro hepatic steatosis model. Methods: In palmitic acid (PA-induced murine hepatic AML12 cell injury, effects of SF preparation on cellular apoptosis and intracellular triglyceride (iTG level were assessed using TUNEL and TG Colorimetric Assay. Reactive oxygen species (ROS and mitochondrial membrane potential (MMP levels were measured using DCF and JC-1 assay. Cytokine levels were evaluated using ELISA assay. Immunoblot was used to compare the activation level of c-Jun N terminal kinase (JNK, NADPH oxidase (Nox4, and NFκB pathways. Results: Addition of SF preparation prevented PA-mediated increase of apoptosis and iTG as well as IL-8 and IL-6. In PA-treated cell, SF preparation reduced the level of Nox4 and ROS, while increasing the level of MMP and the expression of manganese superoxide dismutase (MnSOD and catalase, indicating emendation of mitochondrial dysfunction. Nox4 inhibitor GKT137381 prevented PA-induced increase of ROS and apoptosis, while decreasing iTG slightly and not influencing the level of IL-8 and IL-6. SF preparation prevented PA-induced upregulation of phospho-JNK. JNK inhibitor SP600125 prevented PA-mediated increase of Nox4, IL-8, IL-6 and iTG. Nuclear translocation of NFκB/p65 was detected in PA-treated cells, which was prevented by SF preparation. An IκB degradation inhibitor, BAY11-7082, prevented PA-induced increase of IL-8 and IL-6 as well as iTG, whereas it only decreased ROS levels slightly and showed no influence on cellular apoptosis. Conclusion: SF preparation shows a beneficial role in prevention of hepatocyte injury by attenuating oxidative stress and cytokines production at least partially through inhibition of JNK/Nox4 and JNK

  17. Tempo de jejuar e resistir: a presença do kung-fu no treinamento do ator : a experiência extracotidiana no teatro vocacional em proposição épica

    Oliveira, Juliana Rocha de [UNESP


    Esta pesquisa surgiu da necessidade de registrar, organizar, sistematizar e relacionar os conhecimentos adquiridos em minha formação de atriz, professora de teatro e artista marcial, no intuito de melhor explorar o processo de criação teatral, utilizando técnicas marciais orientais. Aproximando as duas artes: teatral e marcial – kung fu, termo que além de designar uma arte marcial de origem chinesa possui outros significados como, por exemplo, capacidade de aguentar jejum e resistir, vislumbr...

  18. The Effect and Mechanism of Transdermal Penetration Enhancement of Fu's Cupping Therapy: New Physical Penetration Technology for Transdermal Administration with Traditional Chinese Medicine (TCM) Characteristics.

    Xie, Wei-Jie; Zhang, Yong-Ping; Xu, Jian; Sun, Xiao-Bo; Yang, Fang-Fang


    In this paper, a new type of physical penetration technology for transdermal administration with traditional Chinese medicine (TCM) characteristics is presented. Fu's cupping therapy (FCT), was established and studied using in vitro and in vivo experiments and the penetration effect and mechanism of FCT physical penetration technology was preliminarily discussed. With 1-(4-chlorobenzoyl)-5-methoxy-2-methylindole-3-ylacetic acid (indomethacin, IM) as a model drug, the establishment of high, medium, and low references was completed for the chemical permeation system via in vitro transdermal tests. Furthermore, using chemical penetration enhancers (CPEs) and iontophoresis as references, the percutaneous penetration effect of FCT for IM patches was evaluated using seven species of in vitro diffusion kinetics models and in vitro drug distribution; the IM quantitative analysis method in vivo was established using ultra-performance liquid chromatography-tandem mass spectrometry technology (UPLC-MS/MS), and pharmacokinetic parameters: area under the zero and first moment curves from 0 to last time t (AUC 0-t , AUMC 0-t ), area under the zero and first moment curves from 0 to infinity (AUC 0-∞ , AUMC 0-∞ ), maximum plasma concentration (C max ) and mean residence time (MRT), were used as indicators to evaluate the percutaneous penetration effect of FCT in vivo. Additionally, we used the 3 K factorial design to study the joint synergistic penetration effect on FCT and chemical penetration enhancers. Through scanning electron microscopy (SEM) and transmission electron microscope (TEM) imaging, micro- and ultrastructural changes on the surface of the stratum corneum (SC) were observed to explore the FCT penetration mechanism. In vitro and in vivo skin permeation experiments revealed that both the total cumulative percutaneous amount and in vivo percutaneous absorption amount of IM using FCT were greater than the amount using CPEs and iontophoresis. Firstly, compared with

  19. The Herb Medicine Formula “Chong Lou Fu Fang” Increases the Cytotoxicity of Chemotherapeutic Agents and Down-Regulates the Expression of Chemotherapeutic Agent Resistance-Related Genes in Human Gastric Cancer Cells In Vitro

    Yongping Liu


    Full Text Available The herb medicine formula “Chong Lou Fu Fang” (CLFF has efficacy in inhibiting the proliferation of human gastric cancer in vitro and in vivo. To explore the potentially useful combination of CLFF with chemotherapeutic agents commonly used in gastric cancer therapy, we assess the interaction between CLFF and these chemotherapeutic agents in both SGC-7901 cell lines and BGC-823 cell lines using a median effect analysis and apoptosis analysis, and we also investigate the influence of CLFF on chemotherapeutic agent-associated gene expression. The synergistic analysis indicated that CLFF had a synergistic effect on the cytotoxicity of 5-fluorouracil (5-FU in a relative broad dose inhibition range (20–95% fraction affected in SGC-7901cell lines and 5–65% fraction affected in BGC-823 cell lines, while the synergistic interaction between CLFF and oxaliplatin or docetaxel only existed in a low dose inhibition range (≤50% fraction affected in both cell lines. Combination of CLFF and chemotherapeutic agents could also induce apoptosis in a synergistic manner. After 24 h, CLFF alone or CLFF combination with chemotherapeutic agents could significantly suppress the levels of expression of chemotherapeutic agent resistance related genes in gastric cancer cells. Our findings indicate that there are useful synergistic interactions between CLFF and chemotherapeutic agents in gastric cancer cells, and the possible mechanisms might be partially due to the down-regulation of chemotherapeutic agent resistance related genes and the synergistic apoptotic effect.

  20. Anti-mitotic potential of 7-diethylamino-3(2′-benzoxazolyl)-coumarin in 5-fluorouracil-resistant human gastric cancer cell line SNU620/5-FU

    Kim, Nam Hyun; Kim, Su-Nam; Oh, Joa Sub; Lee, Seokjoon; Kim, Yong Kee


    Highlights: ► DBC exerts antiproliferative potential against 5FU-resistant human gastric cancer cells. ► This effect is mediated by destabilization of microtubules and subsequent mitotic arrest. ► DBC enhances apoptosis via caspase activation and downregulation of antiapoptotic genes. -- Abstract: In this study, we investigate an anti-mitotic potential of the novel synthetic coumarin-based compound, 7-diethylamino-3(2′-benzoxazolyl)-coumarin, in 5-fluorouracil-resistant human gastric cancer cell line SNU-620-5FU and its parental cell SNU-620. It exerts the anti-proliferative effects with similar potencies against both cancer cells, which is mediated by destabilization of microtubules and subsequent mitotic arrest. Furthermore, this compound enhances caspase-dependent apoptotic cell death via decreased expression of anti-apoptotic genes. Taken together, our data strongly support anti-mitotic potential of 7-diethylamino-3(2′-benzoxazolyl)-coumarin against drug-resistant cancer cells which will prompt us to further develop as a novel microtubule inhibitor for drug-resistant cancer chemotherapy.

  1. Towards the identification of alkaline phosphatase binding ligands in Li-Dan-Hua-Shi pills: A Box-Behnken design optimized affinity selection approach tandem with UHPLC-Q-TOF/MS analysis.

    Tao, Yi; Huang, Surun; Gu, Xianghui; Li, Weidong; Cai, Baochang


    Alkaline phosphatase conjugated magnetic microspheres were synthesized via amide reaction, and employed as an effective adsorbent in affinity selection of binding ligands followed by UHPLC-Q-TOF/MS analysis. The analytical validity of the developed approach was evaluated under optimized conditions and the following figures of merit were obtained: linearity, 0.01-0.5 g L -1 with good determination coefficients (R 2  = 0.9992); limits of detection (LODs), 0.003 g L -1 ; and limits of quantitation (LOQ), 0.01 g L -1 . The precision (RSD%) of the proposed affinity selection approach was studied based on intra-day (0.8%) and inter-day (1.3%) precisions. Finally, the adsorbent was successfully applied to identification of binding ligands in Li-Dan-Hua-Shi pills and good recoveries were obtained in the range from 96.9 to 99.4% (RSDs 1.6-3.0%). Copyright © 2018 Elsevier B.V. All rights reserved.

  2. A randomized phase II study of weekly nab-paclitaxel plus gemcitabine or simplified LV5FU2 as first-line therapy in patients with metastatic pancreatic cancer: the AFUGEM GERCOR trial.

    Bachet, Jean-Baptiste; Chibaudel, Benoist; Bonnetain, Franck; Validire, Pierre; Hammel, Pascal; André, Thierry; Louvet, Christophe


    Metastatic pancreatic adenocarcinoma (PAC) prognosis remains dismal and gemcitabine monotherapy has been the standard treatment over the last decade. Currently, two first-line regimens are used in this setting: FOLFIRINOX and nab-paclitaxel plus gemcitabine. Increasing translational data on the predictive value of hENT1 for determining gemcitabine efficacy suggest that a non-gemcitabine-based regimen is favored in about 60 % of patients with PAC due to high resistance of PAC to this cytotoxic drug. This study aims to evaluate the efficacy of weekly nab-paclitaxel combined with gemcitabine or a simplified (s) LV5FU2 regimen in patients with previously untreated metastatic PAC. AFUGEM is a two-stage, open-label, randomized, multicenter, phase II trial. Patients with PAC who meet the inclusion criteria and provide written informed consent will be randomized in a 1:2 ratio to either nab-paclitaxel (125 mg/m(2)) plus gemcitabine (1000 mg/m(2)) given on days 1, 8, and 15 every 28 days or nab-paclitaxel (125 mg/m(2)) plus sLV5FU2 (leucovorin 400 mg/m(2) followed by bolus 400 mg/m(2) 5-fluorouracil and by 5-fluorouracil 2400 mg/m(2) as an 46-h intravenous infusion) given on days 1 and 15 every 28 days. A total of 114 patients will be randomized to one of the treatment arms. The primary endpoint is progression-free survival at 4 months. Secondary outcomes are rate and duration of response, disease control, overall survival, safety, and quality of life. Potential biomarkers of gemcitabine (hENT1, dCK) and 5-fluorouracil (TS) efficacy will be assessed. The AFUGEM trial is designed to provide valuable information regarding efficacy and tolerability of nab-paclitaxel plus gemcitabine and nab-paclitaxel plus sLV5FU2 regimens. Identification of potential predictive biomarkers of gemcitabine and 5-fluorouracil is likely to drive therapeutic decisions in patients with metastatic PAC. AFUGEM is registered at NCT01964534 , October 15, 2013.

  3. Long-term outcomes of trimodality treatment for squamous cell carcinoma of the esophagus with cisplatin and/or 5-FU. More than 20 years' experience at a single institution

    Fakhrian, Khashayar [Ruhr-Universitaet Bochum, Department of Radiation Oncology, Marien Hospital Herne and Sankt Josef Hospital Bochum, Bochum (Germany); Technische Universitaet Muenchen, Department of Radiation Oncology, Klinikum rechts der Isar, Munich (Germany); Universitaetsklinikum der Ruhr-Universitaet Bochum, Klinik fuer Strahlentherapie und Radio-Onkologie, Marienhospital Herne, Herne (Germany); Ordu, Arif Deniz; Molls, Michael [Technische Universitaet Muenchen, Department of Radiation Oncology, Klinikum rechts der Isar, Munich (Germany); Lordick, Florian [University Clinic Leipzig, University Cancer Center Leipzig (UCCL), Leipzig (Germany); Technische Universitaet Muenchen, Department of Internal Medicine III (Hematology/Oncology), Munich (Germany); Theisen, Joerg [Technische Universitaet Muenchen, Department of Surgery, Klinikum rechts der Isar, Munich (Germany); Haller, Bernhard [Technische Universitaet Muenchen, Institute for Medical Statistics and Epidemiology, Klinikum rechts der Isar, Munich (Germany); Omrcen, Tomislav [Technische Universitaet Muenchen, Department of Radiation Oncology, Klinikum rechts der Isar, Munich (Germany); University Hospital Split, Center of Oncology and Radiotherapy, Split (Croatia); Nieder, Carsten [Department of Oncology and Palliative Medicine, Nordland Hospital Trust, Bodoe (Norway); University of Tromsoe, Institute of Clinical Medicine, Faculty of Health Sciences, Tromsoe (Norway); Geinitz, Hans [Technische Universitaet Muenchen, Department of Radiation Oncology, Klinikum rechts der Isar, Munich (Germany); Krankenhaus der Barmherzigen Schwestern Linz, Department of Radiation Oncology, Linz (Austria)


    The purpose of this article is to report the outcome of neoadjuvant radiochemotherapy (N-RCT) + surgery in patients with squamous cell carcinoma of the esophagus at a single institution. We retrospectively reviewed data from patients who were referred to our department for N-RCT. From 1988-2011, 103 patients were treated with N-RCT with cisplatin and/or 5-fluorouracil (5-FU). Group 1: (n = 55) from 1988-2006 with 39.6-40 Gy and 5-FU with (n = 17) or without cisplatin (n = 38). Group 2: from 2003-2010 with 44-45 Gy and 5-FU with (n = 40) or without cisplatin (n = 8). All patients underwent radical resection with reconstruction according to tumor location and 2-field lymph node dissection. The degree of histomorphologic regression was defined as grade 1a (pCR, 0 % residual tumor), grade 1b (pSTR, < 10 % residual tumor), grade 2 (10-50 % residual tumor), and grade 3 (> 50 % residual tumor). Median follow-up time from the start of N-RCT was 100 months (range 2-213 months). The median overall survival (OS) for the whole cohort was 42 months and the 5-year OS was 45 ± 5 %. In the multivariate analysis, worse ECOG performance status (p < 0.001), weight loss > 10 % before the start of the N-RCT (p = 0.025), higher pT category (p = 0.001), and grade 2/3 pathologic remission (p < 0.001) were significantly associated with a poor OS. PCR and pSTR rates for group 1 were 36 % and 18 % compared to 53 % and 22 % for group 2 (p = 0.011). There was a tendency for a better outcome in group 2 patients without statistical significance. The 5-year OS, disease-free survival and recurrent-free survival were 36 ± 7 %, 35 ± 6, and 36 ± 7 % for group 1 and 55 ± 7, 49 ± 7, and 53 ± 7 in group 2 (p = 0.117, p = 0.124, and p = 0.087). There was no significant difference between the two groups considering the postoperative morbidity and mortality. Higher radiation doses and more use of simultaneous cisplatin lead to higher pathologic response rates to N-RCT and may be associated with

  4. Implementación de un equipo de laboratorio para la planta piloto de lácteos campus Juan Lunardi, para el análisis de la leche en tres razas de vacas (Holstein, Jersey y Criollas) de la comuna indígena de Shiña-Nabón

    Ascaribay Andrade, Saúl Geovani


    El presente trabajo de grado trata sobre la implementación de un equipo de laboratorio para el análisis comparativo de la leche entre tres razas de vacas, (Holstein, Jersey y Criollas), este análisis se lo realizo en la Asociación de Productores Agropecuarios de la comuna indígena de Shiña perteneciente al cantón Nabón provincia del Azuay, los parámetros a ser analizados están basados dentro de las normas técnicas que dicta el INEN, las normas que fueron analizadas fueron: Leche Cruda Requisi...

  5. Continuous infusion (CI) 5-FU and leucovorin (LCV) combined with hepatic (H), nodal (N), and tumor bed (TB) irradiation (XRT) following pancreaticoduodenectomy (PDD) for head of pancreas (HOP) and other periampullary (PA) adenocarcinoma

    Abrams, R.A.; Yeo, C.J.; Grochow, L.B.; Chakravarthy, A.; Sohn, T.A.; Zahurek, M.L.; Haulk, T.; Ord, S.; Hruban, R.H.; Lillemoe, K.D.; Pitt, H.A.; Cameron, J.L.


    Purpose: To make preliminary assessment of whether use of this regimen in the post PDD adjuvant context is associated with: (1) an acceptable toxicity profile and (2) encouraging survival results as compared to either no or standard (GITSG) adjuvant (adj) therapy. Methods: From 10/1/91 through 9/30/95 28 post PDD patients (pts) (21 HOP, 7 PA) received adj chemoxrt with CI 5-FU (200 mg/m 2 ) and LCV (5 mg/m 2 ) via a semi-permanent central line Monday thru Friday along with H, N, and TB XRT. The first 18 pts received XRT doses of 2340 cGy (H) and 5040 cGy (N and TB). The last 10 pts received XRT doses of 2700 cGy (H), 5400 cGy (N), and 5760 cGy (TB). Fraction size = 180 cGy. XRT was administered after computerized and CAT scan based planning using 6 MV or greater photon energy. Therapy began within 10 wks of PDD. 1 month following chemoxrt, pts were to begin the first of 4 monthly cycles of 5-FU/LCV given without xrt but at the same doses and scheduled Monday thru Friday for 2 weeks on followed by 2 weeks off. Results: (M(F)) ratio (12(16)). The median age was 58 yrs (range 44-76). 23 pts had +ve nodes (10 pts had 5 or more +ve nodes). 6 pts had microscopically +ve resection margins of whom 5 also had +ve nodes. 26 pts completed chemoxrt as planned. 1 pt failed to complete chemoxrt due to the onset of immune thrombocytopenia. 1 pt completed after delay due to family death. 15 pts did not complete the planned 4 cycles of 5-FU/LCV (9-disease progression on therapy, 3-toxicity, 3-other). 9 pts had IV catheter problems. 7 pts had mild to moderate emotional depression while on therapy. Pts were monitored for wt loss, decline in performance status, liver, GI, heme, esophageal, oral mucosal and hand/foot toxicities. There were no grade (4(5)) toxicities. The only grade 3 toxicities were hepatic (3 pts) (elevations in AST, ALT, OR ALK PHOS without jaundice or hepatic failure). Median actuarial survival for these 28 pts was 15 months (20 pts deceased). For the 21 HOP pts

  6. Identification of colorectal cancer patients with tumors carrying the TP53 mutation on the codon 72 proline allele that benefited most from 5-fluorouracil (5-FU) based postoperative chemotherapy

    Godai, Ten-i; Sakuma, Yuji; Tsuchiya, Eiju; Kameda, Yoichi; Akaike, Makoto; Miyagi, Yohei; Suda, Tetsuji; Sugano, Nobuhiro; Tsuchida, Kazuhito; Shiozawa, Manabu; Sekiguchi, Hironobu; Sekiyama, Akiko; Yoshihara, Mitsuyo; Matsukuma, Shoichi


    Although postoperative chemotherapy is widely accepted as the standard modality for Dukes' stage C or earlier stage colorectal cancer (CRC) patients, biomarkers to predict those who may benefit from the therapy have not been identified. Previous in vitro and clinical investigations reported that CRC patients with wild-type p53 gene (TP53)-tumors benefit from 5-fluorouracil (5-FU) based chemotherapy, while those with mutated TP53-tumors do not. However, these studies evaluated the mutation-status of TP53 by immunohistochemistry with or without single-strand conformation polymorphism, and the mutation frequency was different from study to study. In addition, the polymorphic status at p53 codon 72, which results in arginine or proline residues (R72P) and is thought to influence the function of the protein significantly, was not examined. To evaluate the significance of the TP53 mutation as a molecular marker to predict the prognosis of CRC patients, especially those who received postoperative chemotherapy, we examined the mutation by direct sequencing from fresh CRC tumors and evaluated the R72P polymorphism of the mutated TP53 by a combined mutant allele- and polymorphic allele-specific polymerase chain reaction (PCR). The TP53 mutation occurred in 147 (70%) of 211 Japanese CRC tumors. The mutation was observed in 93 (63%) tumors on the R72 allele and in 54 (37%) tumors on the P72 allele. Although the alterations to TP53 have no prognostic significance for CRC patients overall, we found that Dukes' stage C CRC patients who did not receive postoperative chemotherapy and carried the mutated TP53-R72 showed significantly longer survival times than those with the mutated TP53-P72 when evaluated by overall survival (p = 0.012). Using a combined mutant allele- and polymorphic allele-specific PCR, we defined the codon 72 polymorphic status of the TP53 mutated allele in Japanese CRC patients. We raised a possibility that Dukes' stage C colorectal cancer

  7. The SHiP facility at CERN



    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in dierent theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment and outline the performances of a detector operating at the same facility for the search for the tau --> mu mu mu decay

  8. Coaxing shy particles into an atomic jar

    Hellemans, A


    A Dutch-American team claim they can produce anti-hydrogen atoms in far greater quantities than any other current method. They use rubidium ions to trap electrons by applying a pulsed electric field in a series of steps (1 page).

  9. Do talented women shy away from competition?

    Hoyer, Britta; van Huizen, T.M.; Keijzer, L.M.; Rezaei Khavas, T.; Rosenkranz, S.; Westbrock, B.


    We study the willingness to compete in a cognitive task among an entire cohort of fresh man business and economics students. Combining data from a lab-in-thefield experiment with university admissions data, we trace the gender gap in competitiveness at different levels of high school performance.

  10. Biased Facial Expression Interpretation in Shy Children

    Kokin, Jessica; Younger, Alastair; Gosselin, Pierre; Vaillancourt, Tracy


    The relationship between shyness and the interpretations of the facial expressions of others was examined in a sample of 123 children aged 12 to 14?years. Participants viewed faces displaying happiness, fear, anger, disgust, sadness, surprise, as well as a neutral expression, presented on a computer screen. The children identified each expression…

  11. Degradation of 5-FU by means of advanced (photo)oxidation processes: UV/H{sub 2}O{sub 2}, UV/Fe{sup 2+}/H{sub 2}O{sub 2} and UV/TiO{sub 2} — Comparison of transformation products, ready biodegradability and toxicity

    Lutterbeck, Carlos Alexandre, E-mail: [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Faculty of Sustainability, Leuphana University of Lüneburg, Scharnhorststraße 1/C13, DE-21335 Lüneburg (Germany); Graduate Program in Environmental Technology, Universidade de Santa Cruz do Sul — UNISC, Av. Independência, 2293, CEP 96815-900 Santa Cruz do Sul, Rio Grande do Sul (Brazil); Wilde, Marcelo Luís, E-mail: [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Faculty of Sustainability, Leuphana University of Lüneburg, Scharnhorststraße 1/C13, DE-21335 Lüneburg (Germany); Baginska, Ewelina, E-mail: [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Faculty of Sustainability, Leuphana University of Lüneburg, Scharnhorststraße 1/C13, DE-21335 Lüneburg (Germany); Leder, Christoph, E-mail: [Sustainable Chemistry and Material Resources, Institute of Sustainable and Environmental Chemistry, Faculty of Sustainability, Leuphana University of Lüneburg, Scharnhorststraße 1/C13, DE-21335 Lüneburg (Germany); Machado, Ênio Leandro, E-mail: [Graduate Program in Environmental Technology, Universidade de Santa Cruz do Sul — UNISC, Av. Independência, 2293, CEP 96815-900 Santa Cruz do Sul, Rio Grande do Sul (Brazil); and others


    The present study investigates the degradation of the antimetabolite 5-fluorouracil (5-FU) by three different advanced photo oxidation processes: UV/H{sub 2}O{sub 2}, UV/Fe{sup 2+}/H{sub 2}O{sub 2} and UV/TiO{sub 2}. Prescreening experiments varying the H{sub 2}O{sub 2} and TiO{sub 2} concentrations were performed in order to set the best catalyst concentrations in the UV/H{sub 2}O{sub 2} and UV/TiO{sub 2} experiments, whereas the UV/Fe{sup 2+}/H{sub 2}O{sub 2} process was optimized varying the pH, Fe{sup 2+} and H{sub 2}O{sub 2} concentrations by means of the Box–Behnken design (BBD). 5-FU was quickly removed in all the irradiation experiments. The UV/Fe{sup 2+}/H{sub 2}O{sub 2} and UV/TiO{sub 2} processes achieved the highest degree of mineralization, whereas the lowest one resulted from the UV/H{sub 2}O{sub 2} treatment. Six transformation products were formed during the advanced (photo)oxidation processes and identified using low and high resolution mass spectrometry. Most of them were formed and further eliminated during the reactions. The parent compound of 5-FU was not biodegraded, whereas the photolytic mixture formed in the UV/H{sub 2}O{sub 2} treatment after 256 min showed a noticeable improvement of the biodegradability in the closed bottle test (CBT) and was nontoxic towards Vibrio fischeri. In silico predictions showed positive alerts for mutagenic and genotoxic effects of 5-FU. In contrast, several of the transformation products (TPs) generated along the processes did not provide indications for mutagenic or genotoxic activity. One exception was TP with m/z 146 with positive alerts in several models of bacterial mutagenicity which could demand further experimental testing. Results demonstrate that advanced treatment can eliminate parent compounds and its toxicity. However, transformation products formed can still be toxic. Therefore toxicity screening after advanced treatment is recommendable. - Highlights: • Full primary elimination of 5-FU was

  12. 从对电视剧《施琅大将军》的争论看 中国文化民族主义复兴的困境 (The Dilemma of Chinese Cultural Nationalism: the Case of the TV Program 'General Shi Lang'

    Mobo Gao


    Full Text Available With the rise of China's status on international stage as a result of its economic development there is an increasingly audible voice of Chinese cultural nationalism. More and more educators and intellectuals are calling for the revival of Chinese traditional culture values. However, the very issues of who are the Chinese and what are traditional Chinese cultural values present a huge dilemma. The debates on a recent a TV program "General Shi Lang" consist a good case to illustrate this dilemma. Shi Lang was a general of the last days of the Ming Dynasty, but had surrendered to the Manchu Qing dynasty invaders and fought for the Machus take over Taiwan from a Chinese ruler. The debates show that the dilemma has its cause in at least three issues. First, it is not at all obvious who should be categorized as Chinese. Secondly, it is not at all obvious what Chinese cultural values are. And finally it is the issue of evaluation of traditional values against the universal claim of the values of liberal democracy.

  13. Chemical profiling approach to evaluate the influence of traditional and simplified decoction methods on the holistic quality of Da-Huang-Xiao-Shi decoction using high-performance liquid chromatography coupled with diode-array detection and time-of-flight mass spectrometry.

    Yan, Xuemei; Zhang, Qianying; Feng, Fang


    Da-Huang-Xiao-Shi decoction, consisting of Rheum officinale Baill, Mirabilitum, Phellodendron amurense Rupr. and Gardenia jasminoides Ellis, is a traditional Chinese medicine used for the treatment of jaundice. As described in "Jin Kui Yao Lue", a traditional multistep decoction of Da-Huang-Xiao-Shi decoction was required while simplified one-step decoction was used in recent repsorts. To investigate the chemical difference between the decoctions obtained by the traditional and simplified preparations, a sensitive and reliable approach of high-performance liquid chromatography coupled with diode-array detection and electrospray ionization time-of-flight mass spectrometry was established. As a result, a total of 105 compounds were detected and identified. Analysis of the chromatogram profiles of the two decoctions showed that many compounds in the decoction of simplified preparation had changed obviously compared with those in traditional preparation. The changes of constituents would be bound to cause the differences in the therapeutic effects of the two decoctions. The present study demonstrated that certain preparation methods significantly affect the holistic quality of traditional Chinese medicines and the use of a suitable preparation method is crucial for these medicines to produce special clinical curative effect. This research results elucidated the scientific basis of traditional preparation methods in Chinese medicines. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Adjuvant post-operative radiotherapy vs radiotherapy plus 5-FU and levamisole in patients with TNM stage II-III resectable rectal cancer. A phase III randomized clinical trial

    Cafiero, F.; Gipponi, M.; Di Somma, C. [Istituto Nazionale per la Ricerca sul Cancro, Geneo (Italy). Istituto di Oncologia Clinica] [and others


    Loco-regional and distant relapses contribute to impair the outcome of rectal cancer patients. As to the former, either pre-or post-operative radiation therapy (RT) significantly reduce loco-regional recurrence; post-operative chemotherapy (CT), alone or in different combinations with RT, is effective in improving both disease-free survival and survival. However, many drawbacks still exist regarding the method of RT delivery as well as the toxicity of combination adjuvant chemotherapy. The aim of this trial is to assess the effectiveness and toxicity of adjuvant post-operative RT vs combined RT and CT (5-FU plus levamisole) in patients with TNM stage II-III resectable rectal cancer (pT3-4, pN0, M0; pT1-4, pN1-3, M0). The primary endpoint is overall survival; secondary endpoints are disease-free survival rate of loco-regional recurrence, and treatment-related toxicity/morbidity. (author).

  15. Simultaneous Qualitative and Quantitative Analysis of Multiple Chemical Constituents in YiQiFuMai Injection by Ultra-Fast Liquid Chromatography Coupled with Ion Trap Time-of-Flight Mass Spectrometry

    Chunhua Liu


    Full Text Available YiQiFuMai injection (YQFM is a modern lyophilized powder preparation derived from the traditional Chinese medicine Sheng-mai san (SMS used for treating cardiovascular diseases, such as chronic heart failure. However, its chemical composition has not been fully elucidated, particularly for the preparation derived from Ophiopogon japonicus. This study aimed to establish a systematic and reliable method to quickly and simultaneously analyze the chemical constituents in YQFM by ultra-fast liquid chromatography coupled with ion trap time-of-flight mass spectrometry (UFLC-IT-TOF/MS. Sixty-five compounds in YQFM were tentatively identified by comparison with reference substances or literature data. Furthermore, twenty-one compounds, including three ophiopogonins, fifteen ginsenosides and three lignans were quantified by UFLC-IT-TOF/MS. Notably, this is the first determination of steroidal saponins from O. japonicus in YQFM. The relative standard deviations (RSDs of intra- and inter-day precision, reproducibility and stability were <4.9% and all analytes showed good linearity (R2 ≥ 0.9952 and acceptable recovery of 91.8%–104.2% (RSD ≤ 5.4%, indicating that the methods were reliable. These methods were successfully applied to quantitative analysis of ten batches of YQFM. The developed approach can provide useful and comprehensive information for quality control, further mechanistic studies in vivo and clinical application of YQFM.


    Juan Diego Zamora Salas


    Full Text Available El presente estudio analizó el efecto de dos métodos de estiramiento (estático y P.N.F. para mejorar el rango de movimiento en la articulación de la cadera en practicantes de Kung Fu Wing Chun, utilizando una prueba de flexibilidad de cadera. Se formaron tres grupos cada uno conformado por n= 10, cuyas edades estaban comprendidas entre los 15 y 28 años. Los sujetos del Grupo Control les correspondía continuar con sus entrenamientos normalmente; y a los sujetos del Grupo B y Grupo C, les correspondía realizar la prueba de flexibilidad de la cadera utilizando el método estático y el método P.N.F. respectivamente. A los valores recolectados durante la prueba se les aplicó una Anova 3x3, Análisis de Efecto Simple para Grupos y Mediciones, además de un análisis de Tukey, en donde se encontró una mejora de los resultados tanto en el grupo que utilizó el método estático como para el que utilizó el método P.N.F., en comparación al grupo control, pero no existiendo una diferencia significativa entre ambos métodos, sólo entre el pre-test y post-test de ambos tratamientos. También se encontró una mayor retención de la mejora en el R.M.A.; en los sujetos que utilizaron el método P.N.F., cuatro semanas después de haberse suspendido éste método en comparación a los sujetos que utilizaron el método estático.

  17. Simultaneous determination of bioactive components in essential oil of Xiang-Fu-Si-Wu Formula in Beagle dog plasma by UPLC-MS/MS and its application to pharmacokinetics.

    Liu, Pei; Li, Zhenhao; Qian, Dawei; Li, Wei; Shang, Er-Xin; Duan, Jin-Ao


    A highly sensitive and rapid ultraperformance liquid chromatography-tandem mass spectrometry (UPLC-MS/MS) has been developed and validated for simultaneous quantification of the three main bioactive compounds, i.e., ligustilide, dehydrocostuslactone and α-cyperone in dog plasma after oral administration of the essential oil of Xiang-Fu-Si-Wu Formula (XEO). Clarithromycin was used as an internal standard (IS). Plasma samples were processed by protein precipitation with methanol. The separation was performed on an Acquity BEH C18 column (100mm×2.1mm, 1.7μm) at a flow rate of 0.4mLmin(-1), using 0.1% formic acid-acetonitrile as mobile phase. The MS/MS ion transit ions monitored were 190.5→90.9 for ligustilide, 231.1→185.1 for dehydrocostuslactone, 219.2→123.0 for α-cyperone and 748.5→158.1 for IS. Method validation was performed as per Food and Drug Administration guidelines and the results met the acceptance criteria. The lower limit of quantification (LLOQ) achieved was 5.12ng/mL for ligustilide, 1.06ng/mL for dehydrocostuslactone and 1.89ng/mL for α-cyperone, respectively, and the calibration curves obtained were linear (r>0.99) over the concentration range approximately 1-1000ng/mL. The intra- and inter-day precision was less than 15% and the accuracy was within ±9.2%. After validation, this method was successfully applied to a pharmacokinetic study where dogs were orally given 0.3g/kg XEO, equivalent to 183.6mg/kg of ligustilide, 5.0mg/kg of dehydrocostuslactone and 26.2mg/kg of α-cyperone, respectively. Copyright © 2013 Elsevier B.V. All rights reserved.

  18. The Shi’a Crescent: A Misconception of Shi’a Alliance


    Iranian origin to Iran.33 After the Iraq-Iran War started, Saddam’s regime encouraged Iraqi men who were married to Iranian women to divorce their...region, indicating that “The Shi’a point to a pattern of negligence and poverty resulting from discriminatory practices of governments from Ottoman...decreased the authority of the sayyids, who were tribal counselors on marriages, divorces , and inheritances,26 and marked the success of the Sunni

  19. The PANDA study: a randomized phase II study of first-line FOLFOX plus panitumumab versus 5FU plus panitumumab in RAS and BRAF wild-type elderly metastatic colorectal cancer patients.

    Battaglin, Francesca; Schirripa, Marta; Buggin, Federica; Pietrantonio, Filippo; Morano, Federica; Boscolo, Giorgia; Tonini, Giuseppe; Lutrino, Eufemia Stefania; Lucchetti, Jessica; Salvatore, Lisa; Passardi, Alessandro; Cremolini, Chiara; Arnoldi, Ermenegildo; Scartozzi, Mario; Pella, Nicoletta; Boni, Luca; Bergamo, Francesca; Zagonel, Vittorina; Loupakis, Fotios; Lonardi, Sara


    Few data are available regarding the treatment of metastatic colorectal cancer elderly patients with anti-EGFR agents in combination with chemotherapy. FOLFOX plus panitumumab is a standard first-line option for RAS wild-type metastatic colorectal cancer. Slight adjustments in chemo-dosage are commonly applied in clinical practice to elderly patients, but those modified schedules have never been prospectively tested. Clinical definition of elderly (≥70 years old) patients that may deserve a more or less intensive combination therapy is still debated. Several geriatric screening tools have been developed to predict survival and risk of toxicity from treatment. Among those, the G8 screening tool has been tested in cancer patients showing the strongest prognostic value for overall survival, while the CRASH score can stratify patients according to an estimated risk of treatment-related toxicities. The PANDA study is a prospective, open-label, multicenter, randomized phase II trial of first-line therapy with panitumumab in combination with dose-adjusted FOLFOX or with 5-fluorouracil monotherapy, in previously untreated elderly patients (≥70 years) with RAS and BRAF wild-type unresectable metastatic colorectal cancer. RAS and BRAF analyses are centralized. Geriatric assessment by means of G8 and CRASH score is planned at baseline and G8 will be re-evaluated at disease progression. The primary endpoint is duration of progression-free survival in both arms. Secondary endpoints include prospective evaluation of the prognostic role of G8 score and the correlation of CRASH risk categories with toxicity. The PANDA study aims at exploring safety and efficacy of panitumumab in combination with FOLFOX or with 5FU/LV in elderly patients affected by RAS and BRAF wild-type metastatic colorectal cancer, to identify the most promising treatment strategy in this setting. Additionally, this is the first trial in which the prognostic role of the G8 score will be prospectively

  20. Comparisons of pharmacokinetic and tissue distribution profile of four major bioactive components after oral administration of Xiang-Fu-Si-Wu Decoction effective fraction in normal and dysmenorrheal symptom rats.

    Liu, Pei; Li, Wei; Li, Zhen-hao; Qian, Da-wei; Guo, Jian-ming; Shang, Er-xin; Su, Shu-lan; Tang, Yu-ping; Duan, Jin-ao


    Xiang-Fu-Si-Wu Decoction (XFSWD) has been widely used to treat primary dysmenorrhea in clinical practice for hundreds of years and shown great efficacy. One fraction of XFSWD, which was an elution product by macroporous adsorption resin from aqueous extract solution with 60% ethanol (XFSWE), showed great analgesic effect. The present study was conducted to investigate the possible pharmacokinetic and tissue distribution profiles of four major bioactive constituents (berberine, protopine, tetrahydrocoptisine and tetrahydropalmatine) after oral administration of XFSWE in dysmenorrheal symptom rats, and to compare the difference between normal and dysmenorrheal symptom rats. Estradiol benzoate and oxytocin were used to produce dysmenorrheal symptom rat model. The experimental period was seven days. At the final day of experimental period, both normal and dysmenorrheal symptom rats were orally administrated with XFSWE, and then the blood and tissues samples were collected at different time points. Berberine, protopine, tetrahydrocoptisine and tetrahydropalmatine in blood and tissue samples were determined by LC-MS/MS. Pharmacokinetic parameters were calculated from the plasma concentration-time data using non-compartmental methods. The differences of pharmacokinetic parameters among groups were tested by one-way analysis of variance (ANOVA). There were statistically significant differences (Pnormal and dysmenorrheal symptom rats that orally administered with same dosage of XFSWE. In tissue distribution study, the results showed that the overall trend was C(Spleen)>C(Liver)>C(Kidney)>C(Uterus)>C(Heart)>C(Lung)>C(Ovary)>C(Brain)>C(Thymus), C(M-60 min)>C(M-120 min)>C(M-30 min)>C(C-60 min)>C(C-120 min)>C(C-30 min). The contents of protopine in liver, spleen and uterus were more than that in other tissues of dysmenorrheal symptom rats. Compared to normal rats, partial contents of the compounds in dysmenorrheal symptom rats׳ tissues at different time points had significant

  1. Opinion of the Consultative Committee for the EURATOM Research and Training Programme in the Field of Nuclear Energy (Fusion) - CCE-FU - on the European domestic assessment of the ITER-FEAT outline design report. Brussels, 11 July 2000


    The CCE-FU endorses the findings of the FTC on the European Domestic Assessment of the ITER-FEAT Outline Design Review, and expresses the opinion that: The machine, ITER-FEAT, the design of which is presented in the Outline Design Report and accompanying document (Technical Basis for the ITER-FEAT Outline Design) successfully responds, in broad terms, to the requirements set by the Special Working Group, established by the ITER Council, in response to Task No. 1 and adopted by the Council; The parameters chosen represent convergence towards a coherent design, based upon preserving adequate margins within the cost target against the new objectives and yet retaining flexibility to exploit advances in physics understanding; ITER-FEAT can meet its objectives of extended burn in induction operation with power amplification Q>10 at the reference operating values of Ip=15MA, Paux=40MW, thus providing 400 MW of fusion power. The margins to achieve this objective are in the range of 15-25%. The design also has sufficient flexibility to explore hybrid scenarios with long pulse capability (> 2000 seconds), and scenarios aiming at demonstrating steady state operation with the ratio of fusion power to input power for current drive of at least 5, provided further confinement enhancement can be achieved; Although most of the components of ITER-FEAT are still in a preliminary design state, the new design appears suitable to be developed into the final design stage, the new design appears suitable to be developed into the final design of a machine capable of achieving the objectives set by the ITER Council; The target cost for the realisation of ITER-FEAT was set by the ITER Council at about half of the 1998 ITER cost estimates. The present preliminary analysis provides confidence that this target will be reached. By the end of 2000, the detailed cost estimates will be provided from the detailed design specifications and manufacturing studies in the industries of the three Parties

  2. Phase II-trial of radiation therapy with 45 Gy, 5-fluorouracil (5-FU) and mitomycin C (MMC) in patients with anal cancer - a rationale to add regional hyperthermia?

    Graf, R.; Wust, P.; Gellermann, J.; Mohr, B.; Goegler, H.; Riess, H.; Felix, R.


    Purpose: To evaluate the effect of standard regimen of chemoradiation for anal cancer with a radiation dose of 45 Gy on survival, local control and toxicity with respect to the discussion about intensification of therapy. Assessment of prognostic factors and designing improved treatment strategies for certain risk groups. Materials and Methods: From 1987 to 1995 46 patients with localized anal cancer were eligible. Thirty-five women and 11 men with a median age of 54 years were treated according to the protocoll. Thirty-two (70%) patients had histologically a squamous cell carcinoma, 12 (26%) a cloacogenic carcinoma. Thirty-one patients (68%) had T1, T2 tumors, 15 patients (33%) had locally advanced primary tumors (T3, T4), 9 patients (20%) had N1-3 disease. Radiotherapy consisted of 30 Gy to the primary tumor and pelvic lymph nodes, followed by one week treatment break and boost to the primary tumor to a total dose of 45 Gy with a single dose of 2 Gy, mean duration of radiotherapy 44 days. 5-FU was given on days 1-5 and 29-33 as continuous infusion (800 mg/m 2 /day), MMC (10 mg/m 2 ) was given intravenously as bolus on day 1 and 29. Patients were followed for survival and local control. Toxicity was assessed using Common Toxicity Criteria and the LENT score (late effects normal tissues). The mean follow-up time was 34,4 months. Results: The cancer specific actuarial 5-year survival rate was 69%: 79% in T1, T2 and 41% in T3, T4 tumors (p = 0,03). The 5-year actuarial local control rate was 74%: 89% in T1, T2 tumors, 42% ind T3, T4 tumors (p 5 cm): p 4 cm): p = 0,04, depth of infiltration: p < 0,00, response: p < 0,00. No local control was achievable for tumors greater than 6 cm, whereas all local failures occurred when there was extrasphincteric infiltration. Conclusions: Colostomy-free survival was unsatisfactory. Depth of infiltration (extrasphincteric involvement) as well as tumor size (≥ 5 cm) has been shown as negative prognostic factor for local control

  3. Bruce Lee vs. Fu Manchu: Kung Fu Films and Asian American Stereotypes in America.

    Farquhar, Judith; Doi, Mary L.


    Discussed in this article are numerous films which feature Asian characters and the influence these films have on stereotyped images of Asians and prevailing racist attitudes toward Asian Americans. (EB)

  4. Determination of Heavy Metal Ions in Tobacco and Tobacco Additives


    This paper describes a new method for the simultaneous determination of heavy metal ions in tobacco and tobacco additives by ... The HPLC system consisted of a Waters 2690 Alliance separation ..... 1 Z.H. Shi and C.G. Fu, Talanta, 1997, 44, 593. ... 5 Q.F. Hu, G.Y. Yang, J.Y. Yin and Y. Yao, Talanta, 2002, 57, 751.

  5. Calycosin regulates glucocorticoid-induced apoptosis via Nrf2/ARE ...

    Lifeng Fu1, WeiLiang Wu2, Jian Zhu2, Shu Qiang2, Jansong Chen2* ... Results: CA reduced the apoptosis and accumulation of ROS in DEX-treated cells. ..... its downstream effectors (Figure 5 A-C). However .... Cao J, Chen Z, Zhu Y, Li Y, Guo C, Gao K, Chen L, Shi ... Hong W. Experimental study on the effect of Calycosin.

  6. Regional Implications of Shi’a Revival in Iraq


    From the marshes of southern Iraq to the ghettoes of Karachi, the Shi‘a have been the underdogs —oppressed and marginalized by Sunni ruling regimes and...former with “true” Is- lam—and their governments as its defenders—and branding the latter as obscurantist extremism. They dismissed Khomeini as Shi‘a... branding his vitriol against the House of Saud in the 1980s as fitna (illegitimate rebellion and sowing of disunity) against the Muslim community.7

  7. Search for heavy sterile neutrinos with SHiP

    Jacobsson, Richard

    Invited contribution to the White Paper on keV sterile neutrino Dark Matter as proceedings of the v-Dark 2015 international workshop which was held at the Institute for Advanced Study of the Technical University of Munich, Garching, Germany, 7 - 9 December 2015. White Paper will be submitted to JCAP.

  8. Iranian Influence in Iraqi Shi’a Groups


    Movement in Iraq, 254. 60 Jabar, The Shīʻite Movement in Iraq, 254. 61 Robert Fisk, The Great War For Civilisation : the Conquest of the Middle Iran in 62 Fisk, The Great War For Civilisation : the Conquest of the Middle East, 647. 63 John...U.S. soldier missing in Iraq. AAH sources indicated that the group was not behind the killing but rather just mediators in the process of returning

  9. Sunni and Shi’a Terrorism: Differences that Matter


    Upon the United States (Washington, DC: St. Martin’s Press, 2004), 88‐89.  The  report’s  language  was curiously qualified when discussing the Iranian...such a tactic cannot be ruled out in the future.  84 Poland, the Czech Republic, the  Slovak  Republic...Democratic Front for the Liberation of Palestine (DFLP)*    Hamas*    Iranian Extremists/Militants – Kuwait ( label  applied by Sunni Kuwait  government

  10. Dicty_cDB: SHI783 [Dicty_cDB

    Full Text Available 34, mRNA sequence. 42 5.0 1 DV288069 |DV288069.1 NAAHW80TF Aedes aegypti - Fat Bodie...583TR Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0... 1 DV284076 |DV284076.1 NAAG583TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) ...Aedes aegypti cDNA clone NAAG583, mRNA sequence. 42 5.0 1 DV276964 |DV276964.1 NAAFQ66TR Aedes aegypti - Fat Bodie...AAFQ66TF Aedes aegypti - Fat Bodies Normalized (NAFFB2) Aedes aegypti cDNA clone NAAFQ66, mRNA sequence. 42

  11. Dicty_cDB: SHI292 [Dicty_cDB

    Full Text Available nt alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 106 4e-22 BC1384...82_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 104 2e-21 (Q9JLC8) RecName: Full=Sacsi

  12. Multiple System Atrophy with Orthostatic Hypotension (Shy-Drager Syndrome)

    ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. x ... the onset of symptoms. A problem with the respiratory system is the most common cause of death. View ...

  13. Dicty_cDB: SHI734 [Dicty_cDB


  14. Once hurt, twice shy: Social pain contributes to social anxiety.

    Fung, Klint; Alden, Lynn E


    Social rejection has been consistently linked to the development of social anxiety. However, mechanisms underlying the relation have been largely unexplored, which presents an obstacle to fully understanding the origins of social anxiety and to the development of effective prevention and treatment strategies. Two studies were conducted to test the hypothesis that the emotion of social pain following rejection promotes the development of social anxiety in subsequent situations. In Study 1, undergraduate participants were exposed to 2 social situations (Cyberball) 2 days apart. Participants who were rejected in the first situation reported higher social anxiety before and during the second situation relative to those who were included. This effect was fully mediated by initial social pain intensity. In Study 2, all participants were initially rejected. Using double-blinded drug administration, participants were randomly assigned to ingest acetaminophen to alleviate the social pain from rejection, or a sugar placebo. As predicted, the acetaminophen group reported lower social anxiety before and during the second situation. Approximately half of the effect was mediated by reduction in social pain. Notably, the immediate effect of acetaminophen was specific to social pain rather than social anxiety. Results were discussed in the context of literature on the etiology of social anxiety and social pain. Future directions were suggested. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  15. Dicty_cDB: SHI133 [Dicty_cDB

    Full Text Available 044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering ...Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50... 0.068 1 CR034434 |CR034434.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPP142o16. 50 0.068 1 BX990136 |B...X990136.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHP

  16. Dicty_cDB: SHI542 [Dicty_cDB

    Full Text Available . 42 8.2 1 CR129751 |CR129751.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering...ion targeting and chromosome engineering clone MHPN147m24. 42 8.2 1 CR010531 |CR010531.1 Reverse strand read... from insert in 5'HPRT insertion targeting and chromosome engineering clone MHPN2...17j13. 42 8.2 1 CR103480 |CR103480.1 Reverse strand read from insert in 5'HPRT insertion targeting and chromosome engineering

  17. SHI induced damage in electrical properties of silicon NPN BJTs

    Kumar, M. Vinay, E-mail:; Krishnaveni, S. [Department of studies in Physics, University of Mysore, Mysore (India); Kumar, Santhosh [Department of Physics, Regional Institute of Education, Mysore (India); Yashoda, T. [Department of Physics, AVK College for Women, Hassan (India)


    The investigation of radiation damage in Si microelectronic circuitry and devices are being carried out by various research groups globally. In particular the Si Bipolar junction transistors are very sensitive to high energetic radiation. In the present study, radiation response of NPN Bipolar junction transistor (2N3773) has been examined for 60 MeV B{sup 4+} ion. Key electrical properties like Gummel, dc current gain and capacitance – voltage (C-V) characteristics of 60 MeV B{sup 4+} ion irradiated transistor were studied before and after irradiation. Ion irradiation and subsequent electrical characterizations were performed at room temperature. Current voltage (I-V) measurements showed the increase in collector current for V{sub BE} ≤ 0.4 V as a function of fluence, which is due to B{sup 4+} ion induced surface leakage currents. Base current is observed to be more sensitive than collector current and gain appears to be degraded with ion fluence. Also, C-V measurements shows that both built in potential and doping concentration increased significantly after irradiation.

  18. Research on the Construction and Practice of the Operation Mechanism of University-Enterprise Strategic Alliance: Taking FuJian University of Technology as Example%校企战略联盟运行机制构建与实证分析——以福建工程学院为例

    陈国铁; 张建勋


    以战略联盟思想建构校企合作运行机制,是培养应用型人才和优化地区产业结构,促进地区经济发展的需要。在引入战略联盟理论的基础上,研究了校企战略联盟的主要内容,探索了校企联盟的运行机制构建,并以福建工程学院为实证,展示了校企战略联盟的成效与前景。%Establishing the operation mechanism of university-enterprise strategic alliance based on strategic alliance ideas,is the need of training application-oriented personnel,optimizing the structure of regional industrial structure,and promoting regional economic development.Based on the strategic alliance theory,studies the main contents of university-enterprise strategic alliance,explores the construction of operation mechanism,and shows the effect and prospect with the practice of FuJian University of Technology.

  19. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-58)

    Barndt, Shawn L. [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management at the Lines Creek Microwave site. The proposed work will be accomplished within the fenced area of the facility. BPA proposes bare ground vegetation management at the microwave site. Bare ground management is needed to prevent fire damage and maintain a vegetation free environment on the site. All work will be executed in accordance with the National Electrical Safety Code and BPA standards. The site will be checked 2-3 times during the growing season. Follow-up herbicide treatment will occur to eliminate any vegetation growing.

  20. 76 FR 63923 - Notice of Availability To Distribute a Final Environmental Impact Statement (FEIS) for the...


    ... buildings; and (d) incorporation of the principles of sustainable design through the Leadership in Energy... comments during the public hearing. The public hearing was preceded by an open house to allow attendees to...

  1. 75 FR 13264 - Final Environmental Impact Statement (FEIS) for Training Land Acquisition at Fort Polk, LA


    ... lands will allow Soldiers of the JRTC to train on brigade-level combat maneuver training tasks while..., wetlands, biological resources, cultural resources, and socio-economics as a result of implementing the...

  2. Feiing og salting i Strømsås-tunnelen mars 2004: innledende analyse

    Aldrin, Magne


    I mars 2004 blei det gjennomført forsøk med vasking og salting i Strømsåstunnelen, med sikte på å redusere konsentrasjonen av svevestøv. Samtidig blei det gjort målinger av PM10, meteorologi og trafikkvolum.

  3. VizieR Online Data Catalog: New multiplet table for FeI (Nave+, 1994)

    Nave, G.; Johansson, S.; Learner, R. C. M.; Thorne, A. P.; Brault, J. W.


    We have recorded spectra of iron-neon and iron-argon hollow cathode lamps in the region 1700A-5um (59,000-2000cm-1), with Fourier transform (FT) spectrometers at the National Solar Observatory, Tucson, Arizona, and Imperial College, London, UK, and with a high-resolution grating spectrograph at the National Institute of Standards and Technology, Gaithersburg, Maryland. The uncertainty of the strongest lines in the FT spectra is less than 0.002cm-1 (0.2mA at 3000A; 8mA at 2um). Pressure- and current-dependent shifts are less than 0.001cm-1 for transitions between low-lying levels, increasing to 0.006cm-1 for transitions between the most highly excited levels. We report 28 new energy levels of Fe I and revised values of another 818 levels. We have identified 9501 lines as due to 9759 transitions in Fe I, and these are presented in the form of a new multiplet table and finding list. This compares with the ~5500 lines due to 467 energy levels in the multiplet tables of Moore (1950, NBS Circ., No.488 and 1959, NBS Tech. note 30). The biggest increase is in the near-ultraviolet and near infrared, and many of the new lines are present in the solar spectrum. Experimental log (gf) values are included where they are available. A further 125 unidentified lines due to Fe I are given. (4 data files).

  4. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-70)

    Hutchinson, Kenneth [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management on sections of the McNary-Ross, McNary-Horse Heaven, Horse Heaven-Harvarlum, Harvarlum-Big Eddy, and Hanford-John Day Transmission lines. The treatment areas are identified in Step 1 of the Planning Steps shown below. The work will involve the control of noxious weeds in the subject rights-of-ways (ROWs). BPA, in cooperation with the various County Noxious Weed Control Boards and associated landowners, will provide resources to assist landowners in controlling noxious weeds on the subject ROWs. The Weed Board will perform all activities on behalf of BPA.

  5. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-74)

    Howington, John [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management for five Substations in the Malin District. BPA proposes total vegetation management (bare ground) in the electrical substations, and, noxious weed management and maintenance of landscaping within the property boundaries of the listed facilities. These facilities are all located within the Malin District of the Redmond Region.

  6. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-82)

    Howington, John [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management for twenty-four Substations in the Burley District. BPA proposes total vegetation management (bare ground) in the electrical substations, and, noxious weed management and maintenance of landscaping within the property boundaries of the listed facilities. These facilities are all located within the Burley District of the Idaho Falls Region.

  7. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-78)

    Howington, John [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management for ten Substations in the Redmond District. BPA proposes total vegetation management (bare ground) in the electrical substations, and, noxious weed management and maintenance of landscaping within the property boundaries of the listed facilities. These facilities are all located within the Redmond District of the Redmond Region.

  8. The Fu Foundation School of Engineering & Applied Science - Columbia

    Engineering Mechanics Computer Science Earth and Environmental Engineering Electrical Engineering Industrial Engineering & Applied Science - Columbia University Admissions Undergraduates Graduates Distance Learning Physics and Applied Mathematics Biomedical Engineering Chemical Engineering Civil Engineering and


    Preferred Customer

    Printed in Ethiopia. © 2014 Chemical Society of Ethiopia ... 1Guangxi Key Laboratory of Chemistry and Engineering of Forest Products, Guangxi University ... The O–H···O and C–H···Cl hydrogen-bonding interactions play a significant role in.

  10. Blickverhalten bei Abseitsentscheidungen im Fußball : Eine Feldstudie

    Schnyder, Urs; Koedijker, Johan M.; Kredel, Ralf; Hossner, Ernst Joachim


    The current study aims to determine the relationship between gaze characteristics and decision-making of expert and near-expert assistant referees in judging offside in football. Six assistant referees with different levels of expertise judged set-played offside scenes on the football field, while

  11. Kung fu-film alustas 15 000 vaatajaga


    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina ja Eesti ühistöö) kogus Soome kinolevis avanädalavahetusel suhteliselt tagasihoidliku kassa

  12. Soome-ugri kung fu / Jüri Laulik

    Laulik, Jüri, 1959-


    Soome ja Hiina mütoloogiat ühendav fantaasiafilm "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi ja Eesti ühistöö) : stsenarist Iiro Küttner : režissöör Antti-Jussi Annila. Eestipoole produtsent Margus Õunapuu Eesti osast filmis

  13. 75 FR 62716 - Airworthiness Directives; Pacific Aerospace Limited Model FU24-954 and FU24A-954 Airplanes


    ... new airworthiness directive (AD) for the products listed above that would supersede two existing ADs... aviation authority of another country to identify and correct an unsafe condition on an aviation product... failsafe structure. The Civil Aviation Authority (CAA), which is the aviation authority for New Zealand...

  14. A comparison of synchronized intermittent mandatory ventilation and pressure-regulated volume control ventilation in elderly patients with acute exacerbations of COPD and respiratory failure

    Chang, Suchi; Shi, Jindong; Fu, Cuiping; Wu, Xu; Li, Shanqun


    Suchi Chang,1 Jindong Shi,2 Cuiping Fu,1 Xu Wu,1 Shanqun Li1 1Department of Respiratory Medicine, Zhongshan Hospital, Fudan University, Shanghai, 2Department of Respiratory Medicine, The Fifth People’s Hospital of Shanghai, Fudan University, Shanghai, People’s Republic of China Background: COPD is the third leading cause of death worldwide. Acute exacerbations of COPD may cause respiratory failure, requiring intensive care unit admission and mechanical ventilation. Inten...

  15. Regional new energy vision formulated for Murakami City; 2001 nendo Murakami shi chiiki shin energy vision sakutei tou jigyo. Murakami shi shin energy puran



    For promoting the introduction of new energy and for enhancing people's consciousness of such at Murakami City, Niigata Prefecture, surveys and studies were conducted involving energy consumption in the town, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The annual energy consumption of the city is estimated at 78,000 kL in terms of oil. The residential/commercial sector consumes 24,000 kL, the industrial sector 28,000 kL, and the transportation sector 26,000 kL, with the three sectors demanding similar amounts. The carbon dioxide emitted by the sectors is estimated at 223,000 t-CO2/year. New energy introduction projects were discussed, which included hot water supply, heating, road heating, and power generation, all these utilizing heat from the Senami hot spa; biogas fueled power generation and BDF (bio-diesel) bus operation in the Senami hot spa district; the introduction of a hybrid wind power/photovoltaic power generation system into Ogata Seaside Park; the introduction of a mini-scale hydroelectric power generation system into the Kamikaifu district; a large-scale wind power generation business at the Iwafune district; the introduction of wind power and photovoltaic power generation facilities into primary and junior high schools; the use of clean energy vehicles for official use; and so forth. (NEDO)

  16. Development of the ATLAS FE-I4 pixel readout IC for b-layer Upgrade and Super-LHC

    Karagounis, M


    Motivated by the upcoming upgrade of the ATLAS hybrid pixel detector, a new Front-End (FE) IC is being developed in a 130nm technology to face the tightened requirements of the upgraded pixel system. The main design goals are the reduction of material and a decrease in power consumption combined with the capability to handle the higher hit rates that will result from the upgraded machine. New technology features like the higher integration density for digital circuits, better radiation tolerance and Triple-Well transistors are used for optimization and the implementation of new concepts. A description of the ongoing design work is given, focusing more on the analog part and peripheral design blocks.

  17. Final Environmental Impact Statement (FEIS)/Final Environmental Impact Report (FEIR). Otis Air National Guard Base, Wastewater Treatment Facility


    and G.E. Ness, 1982, Survival of Vibrio cholerae and Escherichia coli in Estuarine Water and Sediments, Applied and Environmental Microbiology, 43...and publications in areas of water and wastewater treatment. David Tomasko, Ph.D., 1985. University of New Mexico . Staff Hydrogeologist. Research...Reserve in California. We are working on EIS’s for the U.S. Air Force Base Closings in realignment in California, New Mexico and Washington, and a very

  18. 75 FR 38501 - The Release of the Final Environmental Impact Statement (FEIS) for the Town of Nags Head Proposed...


    ... cubic yards of beach-quality sediment from an offshore borrow source, and deposit the material along... dredging operations and discharge the sand on the beach via submerged pipeline. The applicant's proposed borrow areas include sites identified as having beach quality material in the U.S. Army Corps of...

  19. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-62) - Rocky Reach - Maple Valley

    Martin, Mark A. [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management along the Rocky Reach – Maple Valley No. 1 Transmission Line ROW from structure 98/2 to structure 110/1. The transmission line is a 500 kV line. BPA proposes to clear targeted vegetation along access roads and around tower structures that may impede the operation and maintenance of the subject transmission line. BPA plans to conduct vegetation management along existing access road and around structure landings for the purpose of maintaining access to structures site. All work will be in accordance with the National Electrical Safety Code and BPA standards.

  20. 75 FR 49483 - Notice of Availability of the Final Environmental Impact Statement (FEIS) for Training Range and...


    ... Aerial System (UAS) facility and a 10th Engineering Battalion Complex) to be constructed over a 4-year... cantonment area to reduce unit transit time, and have fewer overall environmental impacts. Alternative C...

  1. 75 FR 19422 - Availability of a Final Environmental Impact Statement for the General Management Plan (FEIS/GMP...


    .... Alternative A is the No-Action Alternative, which would continue current management practices and trends, with no major changes in direction. Alternative B emphasizes the natural environment by keeping the site...

  2. Status and physics of the SHiP experiment at CERN

    Buonaura, Annarita


    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...

  3. New energy vision of the Gotsu city area; 2001 nendo Gotsu shi chiiki shin energy vision



    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Gotsu City, Shimane Prefecture, an investigational study was conducted of the energy consumption amount of the city, existence amount of new energy, project for new energy introduction, etc., and a new energy vision was worked out. The energy consumption amount of the city was estimated at 1,558,022 Gcal. By sector, the energy consumption amount consisted of 80.0% in the industrial sector, 11.2% of in the transportation sector, 5.8% in the residential sector and 3.0% in the business sector. In the industrial sector, the main energy consumption industries were the paper manufacturing industry and tile industry. As the project for new energy introduction, the following were studied: project for the wind farm where a lot of wind power generators are installed; park as a symbol having 1 or 2 wind power generators; introduction of solar energy use water warmer/photovoltaic power generation to public facilities; system for promotion of the introduction of solar energy use water warmer/photovoltaic power generation to households; project on CO2 reduction by installation of LNG station; refuse/waste power generation project; project on utilization of the waste heat from tile makers. (NEDO)

  4. Do Women Shy Away From Competition? Do Men Compete Too Much?

    Muriel Niederle; Lise Vesterlund


    Competitive high ranking positions are largely occupied by men, and women remain scarce in engineering and sciences. Explanations for these occupational differences focus on discrimination and preferences for work hours and field of study. We examine if absent these factors gender differences in occupations may still occur. Specifically we explore whether women and men, on a leveled playing field, differ in their selection into competitive environments. Men and women in a laboratory experimen...

  5. Learning from the Stones: A Go Approach to Mastering China's Strategic Concept, Shi

    Lai, David


    .... It is through learning the Chinese board game called go. This game is a living reflection of Chinese philosophy, culture, strategic thinking, warfare, military tactics, and diplomatic bargaining...

  6. The beam test of muon detector parameters for the SHiP experiment at CERN

    Likhacheva, V. L.; Kudenko, Yu. G.; Mefodiev, A. V.; Mineev, O. V.; Khotyantsev, A. N.


    Scintillation detectors based on extruded plastics have been tested in a 10 GeV/c beam at CERN. The scintillation signal readout was provided using optical wavelength shifting fibers Y11 Kuraray and Hamamatsu MPPC micropixel avalanche photodiodes. The light yield was scanned along and across the detectors. Time resolution was found by fitting the MPPC digitized pulse rise and other methods.

  7. A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    Anelli, M.; Arduini, G.; Back, J.J.; Bagulya, A.; Baldini, W.; Baranov, A.; Barker, G.J.; Barsuk, S.; Battistin, M.; Bauche, J.; Bay, A.; Bayliss, V.; Bellagamba, L.; Bencivenni, G.; Bertani, M.; Bezshyyko, O.; Bick, D.; Bingefors, N.; Blondel, A.; Bogomilov, M.; Boyarsky, A.; Bonacorsi, D.; Bondarenko, D.; Bonivento, W.; Borburgh, J.; Bradshaw, T.; Brenner, R.; Breton, D.; Brook, N.; Bruschi, M.; Buonaura, A.; Buontempo, S.; Cadeddu, S.; Calcaterra, A.; Calviani, M.; Campanelli, M.; Capoccia, C.; Cecchetti, A.; Chatterjee, A.; Chauveau, J.; Chepurnov, A.; Chernyavskiy, M.; Ciambrone, P.; Cicalo, C.; Conti, G.; Cornelis, K.; Courthold, M.; Dallavalle, M.G.; D'Ambrosio, N.; De Lellis, G.; De Serio, M.; Dedenko, L.; Di Crescenzo, A.; Di Marco, N.; Dib, C.; Dietrich, J.; Dijkstra, H.; Domenici, D.; Donskov, S.; Druzhkin, D.; Ebert, J.; Egede, U.; Egorov, A.; Egorychev, V.; Alaoui, M. A. El; Enik, T.; Etenko, A.; Fabbri, F.; Fabbri, L.; Fedorova, G.; Felici, G.; Ferro-Luzzi, M.; Fini, R.A.; Franke, M.; Fraser, M.; Galati, G.; Giacobbe, B.; Goddard, B.; Golinka-Bezshyyko, L.; Golubkov, D.; Golutvin, A.; Gorbunov, D.; Graverini, E.; Grenard, J-L; Guler, A.M.; Hagner, C.; Hakobyan, H.; Helo, J.C.; van Herwijnen, E.; Horvath, D.; Iacovacci, M.; Iaselli, G.; Jacobsson, R.; Kadenko, I.; Kamiscioglu, M.; Kamiscioglu, C.; Khaustov, G.; Khotjansev, A.; Kilminster, B.; Kim, V.; Kitagawa, N.; Kodama, K.; Kolesnikov, A.; Kolev, D.; Komatsu, M.; Konovalova, N.; Koretskiy, S.; Korolko, I.; Korzenev, A.; Kovalenko, S.; Kudenko, Y.; Kuznetsova, E.; Lacker, H.; Lai, A.; Lanfranchi, G.; Lauria, A.; Lebbolo, H.; Levy, J. -M.; Lista, L.; Loverre, P.; Lukiashin, A.; Lyubovitskij, V.E.; Malinin, A.; Manfredi, M.; Perillo-Marcone, A.; Marrone, A.; Matev, R.; Messomo, E.N.; Mermod, P.; Mikado, S.; Mikhaylov, Yu.; Miller, J.; Milstead, D.; Mineev, O.; Mingazheva, R.; Mitselmakher, G.; Miyanishi, M.; Monacelli, P.; Montanari, A.; Montesi, M.C.; Morello, G.; Morishima, K.; Movtchan, S.; Murzin, V.; Naganawa, N.; Naka, T.; Nakamura, M.; Nakano, T.; Nurakhov, N.; Obinyakov, B.; Ocalan, K.; Ogawa, S.; Oreshkin, V.; Orlov, A.; Osborne, J.; Pacholek, P.; Panman, J.; Paoloni, A.; Paparella, L.; Pastore, A.; Patel, M.; Petridis, K.; Petrushin, M.; Poli-Lener, M.; Polukhina, N.; Polyakov, V.; Prokudin, M.; Puddu, G.; Pupilli, F.; Rademakers, F.; Rakai, A.; Rawlings, T.; Redi, F.; Ricciardi, S.; Rinaldesi, R.; Roganova, T.; Rogozhnikov, A.; Rokujo, H.; Romaniouk, A.; Rosa, G.; Rostovtseva, I.; Rovelli, T.; Ruchayskiy, O.; Ruf, T.; Saitta, G.; Samoylenko, V.; Samsonov, V.; Ull, A. Sanz; Saputi, A.; Sato, O.; Schmidt-Parzefall, W.; Serra, N.; Sgobba, S.; Shaposhnikov, M.; Shatalov, P.; Shaykhiev, A.; Shchutska, L.; Shevchenko, V.; Shibuya, H.; Shitov, Y.; Silverstein, S.; Simone, S.; Skorokhvatov, M.; Smirnov, S.; Solodko, E.; Sosnovtsev, V.; Spighi, R.; Spinetti, M.; Starkov, N.; Storaci, B.; Strabel, C.; Strolin, P.; Takahashi, S.; Teterin, P.; Tioukov, V.; Tommasini, D.; Treille, D.; Tsenov, R.; Tshchedrina, T.; Ustyuzhanin, A.; Vannucci, F.; Venturi, V.; Villa, M.; Vincke, Heinz; Vincke, Helmut; Vladymyrov, M.; Xella, S.; Yalvac, M.; Yershov, N.; Yilmaz, D.; Yilmazer, A.U.; Vankova-Kirilova, G.; Zaitsev, Y.; Zoccoli, A.; CERN. Geneva. SPS and PS Experiments Committee; SPSC


    A new general purpose fixed target facility is proposed at the CERN SPS accelerator which is aimed at exploring the domain of hidden particles and make measurements with tau neutrinos. Hidden particles are predicted by a large number of models beyond the Standard Model. The high intensity of the SPS 400~GeV beam allows probing a wide variety of models containing light long-lived exotic particles with masses below ${\\cal O}$(10)~GeV/c$^2$, including very weakly interacting low-energy SUSY states. The experimental programme of the proposed facility is capable of being extended in the future, e.g. to include direct searches for Dark Matter and Lepton Flavour Violation. The facility will be serviced by a new dedicated beam line branched off the splitter section on the North Area. It is followed by a new target station and a magnetic shield to suppress beam induced background. The proposed orientation of the beam line and the underground complex allows reserving more than 100~m of space beyond the experiment...

  8. Development of a Summarized Health Index (SHI) for Use in Predicting Survival in Sea Turtles

    Li, Tsung-Hsien; Chang, Chao-Chin; Cheng, I-Jiunn; Lin, Suen-Chuain


    Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD) and sea turtle surviving (p turtles had significantly higher levels of aspartate aminotranspherase (AST), creatinine kinase (CK), creatinine and uric acid (UA) than surviving sea turtles (all p turtles and to improve veterinary care at rehabilitation facilities. PMID:25803431

  9. Shy Children Are Less Sensitive to Some Cues to Facial Recognition

    Brunet, Paul M.; Mondloch, Catherine J.; Schmidt, Louis A.


    Temperamental shyness in children is characterized by avoidance of faces and eye contact, beginning in infancy. We conducted two studies to determine whether temperamental shyness was associated with deficits in sensitivity to some cues to facial identity. In Study 1, 40 typically developing 10-year-old children made same/different judgments about…

  10. SI-SHY: Dysregulated Fear in Toddlerhood Predicts Kindergarten Social Withdrawal through Protective Parenting.

    Kiel, Elizabeth J; Buss, Kristin A


    Two recent advances in the study of fearful temperament (behavioral inhibition) include the validation of dysregulated fear as a temperamental construct that more specifically predicts later social withdrawal and anxiety, and the use of conceptual and statistical models that place parenting as a mechanism of development from temperament to these outcomes. The current study further advances these areas by examining whether protective parenting mediated the relation between dysregulated fear in toddlerhood and social withdrawal in kindergarten. Participants included 93 toddlers and their mothers, who engaged in laboratory tasks assessing traditional fearful temperament, dysregulated fear, and protective parenting. When children reached kindergarten, they returned to the laboratory for a multimethod assessment of social withdrawal. Results confirmed the hypothesis that dysregulated fear predicted social withdrawal through protective parenting, and this occurred above and beyond the effect of traditional fearful temperament. These findings bolster support for the use of dysregulated fear as a temperamental construct related to, but perhaps more discerning of risk than traditionally measured fearful temperament/behavioral inhibition and highlight the importance of transactional influences between the individual and the caregiving environment in the development of social withdrawal.

  11. Internet communication: an activity that appeals to shy and socially phobic people?

    Madell, Dominic; Muncer, Steven


    Shyness (or social anxiety) and social phobia can be viewed as two distinct conditions, and this study investigates whether they are related to use of the Internet generally, and for communication purposes. 362 participants from two schools, a college and a university in the Teesside area in England were asked to complete Mattick and Clarke's (1998) Social Phobia (SPS) and Social Interaction Anxiety (SIAS) scales and also answer a questionnaire which asked them about their use of the Internet generally and for communication purposes. The findings from these suggested that social anxiety and social phobia are not highly associated with use of the Internet either in general, or for communication purposes, although minor associations with certain aspects of Internet use are discussed.

  12. Institucional'naja podgotovka Pol'shi k vstupleniju v Evropejskij sojuz

    Tomaszewski W.


    Full Text Available In May 2014 it was aready ten years since Poland’s accession to the European Union. The accession was preceded by a long period of political action and negotiations between the Polish and the EU institutions. The process of integration was extremely complex. It covered almost all areas of economic, legal and civil aspects of the aspiring country’s economy, in which all necessary requirements had to be met. The aim of the article was to present the institutional framework created for efficient implementation of the process of accession. The considerations involved especially an institutional method. The research resulted in poining out both the actually efficient and less efficient bodies participating in the process of integration.

  13. Status and physics of the SHiP experiment at CERN

    Buonaura, Annarita


    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERN Working group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In its initial phase, the 400GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV /c$^{2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time...

  14. Shi et al., Afr J Tradit Complement Altern Med. (2015) 12(6):169-179 ...


    ... indicating that ethyl acetate extracts of TA leaves are efficacious in attenuating oxidative stress in the liver of ... Antioxidant and antibacterial activities of polyphenolic compounds from bitter cumin (Cuminum .... functions and human disease.

  15. On dendrocincla tyrannina: Morphology, behavior and conservation of a shy lek-type insectivore

    Willis Edwin O.


    Full Text Available El trepatroncos tiranino o "churulo" (Dendrocincla tyrannina, Dendrocolaptidae de los bosques de neblina del norte de los Andes es solitario, como las otras especies del género. Se desplaza en el sotobosque lleno de epífitas, dependiendo parcialmente de los insectos que huyen de los escasos ejércitos de hormigas. Es un ave silenciosa y arisca, que se esconde después de volar cortas distancias en busca de presas, o procurándolas en musgos o troncos. La pérdida de los bosques húmedos andinos de laderas abruptas para dar lugar a la ganadería de baja productividad amenaza a la especie y aumenta el peligro de derrumbes en áreas sujetos a temblores; el uso más apropiado para tales áreas es para estudios científicos y actividades turísticas, y no para asentamientos permanentesThe Tyrannine Woodcreeper (Dendrocincla tyrannina, Dendrocolaptidae of northern Andean cloud forests is solitary, like the rest of the genus, and wanders in the epiphyte-laden forest understory, depending partly on hard-to-find swarms of army ants and on understory flocks to flush insects. It is wary and silent, hiding after flying short distan ces for prey or gleaning it from moss or trunks. As los s of sleep Andean wet forests where the woodcreepers live resulls in gretaer danger from earthquakes, study and tourism are preferable to settlements.

  16. The SHiP experiment and its detector for neutrino physics

    Buonaura, Annarita


    SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400GeV proton beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in 5 years. A detector downstream of the target will allow to search long-lived exotic particles with masses below O(10) GeV/c2 forseen in extension of the Standard Model. Another dedicated detector, that will be the focus of this talk, will allow to study active neutrino cross- sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electr...

  17. SHI induced defects in chemically synthesized graphene oxide for hydrogen storage applications

    Sharma, Preetam K., E-mail:; Sharma, Vinay; Rajaura, Rajveer Singh; Singh, M. [Department of Physics, University of Rajasthan, Jaipur-302004, India. (India); Srivastava, Subodh; Vijay, Y. K. [Department of Physics, University of Rajasthan, Jaipur-302004, India. (India); Department of Physics, Vivekananda Global University, Jaipur-303012, India. (India); Sharma, S. S. [Department of Physics, Govt. Women Engineering College, Ajmer-305002, India. (India)


    Graphene, due to its unique properties arising from the single carbon layer, is a potential candidate for applications in a variety of fields including sensors, photovoltaics and energy storage. The atomic structure and morphology of the carbon nanomaterials especially graphene can be tailored by energetic ionic irradiation. As graphene sheet is very stable, the surface have less reactivity as compared to the edges of the sheets. By surface modification with energetic ion-beams additional dangling bonds can be formed to enhance the surface activity of the graphene film which could be exploited in a variety of applications. In the present work, graphene oxide was synthesized by improved Hummers’ Method. The irradiation was done with Ag{sup +} ions carrying energy 100 MeV with the fluence of 3×10{sup 13}. Raman spectrum of graphene irradiated by Ag{sup +} beam shows additional disordered peaks of D´ and D+G bands. There is also a decrease in the intensity of D band. AFM images depict the increase in the surface roughness of the films. This can be attributed to the increase in the defects in the flakes and intermixing of adjacent layers by irradiation.

  18. Women do not play their aces: the consequences of shying away

    Claussen, J.; Czibor, E.; van Praag, M.


    The underrepresentation of women at the top of hierarchies is often explained by gender differences in preferences. We find support for this claim by analyzing a large dataset from an online card game community, a stylized yet natural setting characterized by self-selection into an uncertain,

  19. New energy vision of the Noogata city area; 2001 nendo Noogata shi chiiki shin energy vision



    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Noogata City, Fukuoka Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy, project for new energy introduction, etc., and a vision was worked out. The energy consumption amount of the city was estimated at 4,825.4 x 10{sup 6} MJ/y. It consisted of 47.1% in the industrial sector, 26.1% in the commercial/residential sector and 24.9% in the transportation sector. The rate of energy source was 65.7% of petroleum-base energy and 25.1% of electric power. As the project for new energy introduction, the following were studied: introduction of wind power generation/photovoltaic power generation to the flower park at the foot of Mt. Fukuchi and Nakanoshima park on the sandbank of the Onga river; introduction of photovoltaic power generation to library. Moreover, as future models of the introduction, the potential study was made on the following: installation of the stockbreeding waste biogas plant at the compost center; installation of fuel cell system using digestion gas from night soil treatment facilities; installation of the natural gas cogeneration system in the project on redevelopment of the urban area, etc. (NEDO)

  20. Regional new energy vision for Hita City; 2001 nendo Hita shi chiiki shin energy vision



    For promoting the introduction of new energy and for elevating people's consciousness of such in Hita City, Oita Prefecture, surveys and studies were conducted concerning the energy supply/demand trend in the city, the amount of new energy resources in existence, and new energy introduction plans, and a vision was formulated. The city's energy consumption is estimated at 16,216,376 GJ, with the industrial sector responsible for 78.23%, the transportation sector for 11.35%, and the residential and commercial sector for 9.73%. It is in the public sector, general households, forestry, and hog raising that new energy will be utilized. Key projects for new energy introduction were discussed, which covered a residence incorporating a combination of new energies such as solar heat for water heating and photovoltaic power; lumber drying facilities utilizing forestry generated biomass; cogeneration fueled by methane gas from livestock excrements and garbage; photovoltaic power for schools, the city office, etc.; use of photovoltaic power, temperature difference energy, and methane gas at purification centers, etc.; use of clean energy vehicles for official use; etc. (NEDO)

  1. SHI induced enhancement in green emission from nanocrystalline CdS thin films for photonic applications

    Kumar, Pragati; Saxena, Nupur; Chandra, Ramesh; Gao, Kun; Zhou, Shengqiang; Agarwal, Avinash; Singh, Fouran; Gupta, Vinay; Kanjilal, D.


    Intense green emission is reported from nanocrystalline CdS thin films grown by pulsed laser deposition. The effect of ion beam induced dense electronic excitation on luminescence property of CdS films is explored under irradiation using 70 MeV 58 Ni 6+ ions. It is found that swift heavy ion beam irradiation enhances the emission intensity by an order of 1 and broadens the emission range. This feature is extremely useful to enhance the performance of different photonic devices like light emitting diodes and lasers, as well as luminescence based sensors. To examine the role of energy relaxation process of swift heavy ions in creation/annihilation of different defect levels, multi-peaks are fitted in photoluminescence spectra using a Gaussian function. The variation of contribution of different emissions in green emission with ion fluence is studied. Origin of enhancement in green emission is supported by various characterization techniques like UV–visible absorption spectroscopy, glancing angle X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. A possible mechanism of enhanced GE due to ion beam irradiation is proposed on the basis of existing models. -- Highlights: • Room temperature green luminescence nanocrystalline CdS thin films grown by pulsed laser deposition. • Enhanced green emission by means of swift heavy ion irradiation. • Multipeak fitting of photoluminescence spectra using a Gaussian function. • Variation of area contributed by different emissions in green emission is studied with respect to ion fluence. • Mechanism of enhanced green emission is discussed based on creation/annihilation of defects due to ion beam irradiation

  2. SHI induced enhancement in green emission from nanocrystalline CdS thin films for photonic applications

    Kumar, Pragati, E-mail: [Department of Physics, Bareilly College, Shahmat Ganj Road, Bareilly 243005, Uttar Pradesh (India); Saxena, Nupur [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India); Chandra, Ramesh [Institute Instrumentation Centre, Indian Institute of Technology, Roorkee 247667 (India); Gao, Kun; Zhou, Shengqiang [Institute of Ion Beam Physics and Materials Research, Helmholtz-Zentrum Dresden-Rossendorf (HZDR), P.O. Box 510119, 01314 Dresden (Germany); Agarwal, Avinash [Department of Physics, Bareilly College, Shahmat Ganj Road, Bareilly 243005, Uttar Pradesh (India); Singh, Fouran [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India); Gupta, Vinay [Department of Physics and Astrophysics, Delhi University, Delhi 110007 (India); Kanjilal, D. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)


    Intense green emission is reported from nanocrystalline CdS thin films grown by pulsed laser deposition. The effect of ion beam induced dense electronic excitation on luminescence property of CdS films is explored under irradiation using 70 MeV {sup 58}Ni{sup 6+} ions. It is found that swift heavy ion beam irradiation enhances the emission intensity by an order of 1 and broadens the emission range. This feature is extremely useful to enhance the performance of different photonic devices like light emitting diodes and lasers, as well as luminescence based sensors. To examine the role of energy relaxation process of swift heavy ions in creation/annihilation of different defect levels, multi-peaks are fitted in photoluminescence spectra using a Gaussian function. The variation of contribution of different emissions in green emission with ion fluence is studied. Origin of enhancement in green emission is supported by various characterization techniques like UV–visible absorption spectroscopy, glancing angle X-ray diffraction, micro-Raman spectroscopy and transmission electron microscopy. A possible mechanism of enhanced GE due to ion beam irradiation is proposed on the basis of existing models. -- Highlights: • Room temperature green luminescence nanocrystalline CdS thin films grown by pulsed laser deposition. • Enhanced green emission by means of swift heavy ion irradiation. • Multipeak fitting of photoluminescence spectra using a Gaussian function. • Variation of area contributed by different emissions in green emission is studied with respect to ion fluence. • Mechanism of enhanced green emission is discussed based on creation/annihilation of defects due to ion beam irradiation.

  3. Do gays shy away from competition? Do lesbians compete too much?

    Buser, T.; Geijtenbeek, L.; Plug, E.

    It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible

  4. Do Gays Shy Away from Competition? Do Lesbians Compete Too Much?

    Buser, Thomas; Geijtenbeek, Lydia; Plug, Erik


    It is an established fact that gay men earn less than other men and lesbian women earn more than other women. In this paper we study whether differences in competitive preferences, which have emerged as a likely determinant of labour market differences between men and women, can provide a plausible explanation. We conduct an experiment on a Dutch online survey panel to measure the competitiveness of gay, lesbian and straight panel members. For differences in competitiveness to partially expla...

  5. New energy vision of Kanazawa City; 2001 nendo Kanazawa shi shin energy vision



    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Kanazawa City, Ishikawa Prefecture, an investigational study was conducted of the energy demand amount of the city, existence amount of new energy and project for new energy introduction, and a vision was worked out. The energy demand amount of the city was approximately 42 million GJ. The amount of CO2 emitted from this was estimated at approximately 880,000 t-C. The rate of energy source was 65.3% of petroleum-base energy, 24.7% of electric power and 10.0% of gas. As viewed by sector, the energy demand amount consisted of 38.1% in the commercial/residential sector, 32.2% in the transportation sector and 29.7% in the industrial sector. As the project for new energy introduction, the following were studied: introduction of wind power generation to the sport recreation zone of the mountain area; introduction of natural gas cogeneration to the city hospital; introduction of hydroelectric power generation using the idle head of filtration plant; utilization of the sewage heat and sewage digestion gas at the water quality control center, introduction of clean energy vehicle to official vehicle; introduction of photovoltaic power generation to park light/school, etc. (NEDO)

  6. Shy and Ticklish Truths as Species of Scientific and Artistic Perception

    ... recognize a 'gay science' (Nietzsche) not as an eccentric construction of merely poetic insights and expressions, but as a necessary part of the fundamentals of knowledge. It is a truth of the human condition that its truths are grounded in a personal embodiment of individuality, ontogeny, momentariness and situationality.

  7. New energy vision of the Akita city area; 2001 nendo Akita shi chiiki shin energy vision



    For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Akita City, an investigational study was conducted of the energy demand of the town, existence amount of new energy, project on new energy introduction, etc., and a new energy vision was worked out. The population of Akita City was 317,868 as of December 31, 2000, which is continuously on the increase. The amount of energy demand of the whole city was 990,000 kL/y. The energy demand consists of fossil fuels such as petroleum, coal and propane gas (77.7%) and electric power (22.3%). The CO2 emissions from these are 2,908,000 t-CO2. As the project on the new energy introduction, study was made on the installation of the photovoltaic power system and wind power system at base centers and introduction of the waste power system at the Goshono Works. As the model project, study was made on the introduction of the photovoltaic power generation and wind power generation to street light and public facilities, road snow melting/space heating and cooling using soil heat, introduction of clean energy vehicles, BDF introduction using waste cooking oil and rate blossoms, etc. (NEDO)

  8. Search for Hidden Particles (SHiP): a new experiment proposal

    De Lellis, G.


    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. We propose a new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been observed so far. We therefore propose an experiment to search for hidden particles and study tau neutrino physics at the same time.

  9. Current status of X-ray system at SHI Tsukuba facility

    Washio, Masakazu; Kato, Hiroo; Yamase, Yutaka; Odera, Masatoshi; Thompson, C.C.; Cleland, M.R.


    Many studies have been carried out on X-ray converter system, characteristics of the X-rays and its applications. In this paper, following items will be described. 1. Characteristics of electron beam obtained from 5 MeV Dynamitron, 2. Design and status of the X-ray converter, 3. Characteristics of converted X-ray, 4. Preliminary results of sterilization of certain microbiological reference standard. (J.P.N.)

  10. SI-SHY: Dysregulated Fear in Toddlerhood Predicts Kindergarten Social Withdrawal through Protective Parenting

    Kiel, Elizabeth J.; Buss, Kristin A.


    Two recent advances in the study of fearful temperament (behavioral inhibition) include the validation of dysregulated fear as a temperamental construct that more specifically predicts later social withdrawal and anxiety, and the use of conceptual and statistical models that place parenting as a mechanism of development from temperament to these outcomes. The current study further advances these areas by examining whether protective parenting mediated the relation between dysregulated fear in toddlerhood and social withdrawal in kindergarten. Participants included 93 toddlers and their mothers, who engaged in laboratory tasks assessing traditional fearful temperament, dysregulated fear, and protective parenting. When children reached kindergarten, they returned to the laboratory for a multimethod assessment of social withdrawal. Results confirmed the hypothesis that dysregulated fear predicted social withdrawal through protective parenting, and this occurred above and beyond the effect of traditional fearful temperament. These findings bolster support for the use of dysregulated fear as a temperamental construct related to, but perhaps more discerning of risk than traditionally measured fearful temperament/behavioral inhibition and highlight the importance of transactional influences between the individual and the caregiving environment in the development of social withdrawal. PMID:25242893

  11. Effect of Language Context on Ratings of Shy and Unsociable Behaviors in English Language Learner Children

    Ash, Andrea C.; Rice, Mabel L.; Redmond, Sean M.


    Purpose: The primary goal of this study was to explore the effect of language context on the socially withdrawn behaviors of school-age-children who are English language learners (ELLs) from middle- to high-socioeconomic status (SES) backgrounds. This is one of the 1st studies to address the frequently confused concepts of shyness and…

  12. SHiP: a new facility with a dedicated detector for studying $\

    Buonaura, Annarita


    SHIP is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In five years, $2\\times 10^{20}$ protons of 400 GeV/c momentum will be dumped on a Molybdenum target. A detector downstream of the target will allow a search to made for long-lived particles with masses below O(10) GeV/c$^2$ foreseen in several extensions of the Standard Model. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. The neutrino detector consists of an emulsion target, based on the Emulsion Cloud Chamber technology fruitfully employed in the OPERA experiment. The Emulsion Cloud Chamber will be placed in a magnetic field, with the so-called Compact Emulsion Spectrometer, a few cm thick chamber for the charge and momentum measurement of hadrons. This will provide the leptonic number measurement also in the hadronic tau decay channels. The detector will be hybrid, using nuclear emulsions and electronic detectors for the time stamp of the events and the m...

  13. Regional new energy vision for Joetsu City; 2001 nendo Joetsu shi chiiki shin energy vision



    For promoting the introduction of new energy and for enhancing people's consciousness of such at Joetsu City, Niigata Prefecture, surveys and studies were conducted involving energy consumption of the city, the amount of new energy resources in existence, and new energy introduction projects, and a vision was formulated. The city consumes 3,593 times 10{sup 9} kcal in energy, with the industrial sector responsible for 47.5%, the transportation sector 28.1%, and the residential/commercial sector 24.3%. As for the energy type, oil based fuel accounts for 58.3%, electric power 26.8%, and town gas 8.6%. The amount of carbon dioxide emissions due to energy consumption is estimated at 1,160 kt-CO2. Studies conducted for new energy introduction covered the supply of photovoltaic power to a project on municipal housing construction and a project on promoting the buildup of environment preservation facilities; the installation of a photovoltaic power generation system for a Citizens' Forest buildup project; the installation of a wind power generation system at the Minowadai Square of Recreation and Relaxation for the citizens; the installation of eco-stations to deal with gasoline, propane gas, and natural gas; the extension of financial support for the purchase of low-pollution vehicles; and so forth. (NEDO)

  14. Deputat Riigikogu v bojevike v stilje kung-fu / Alina Zelimhanova

    Zelimhanova, Alina


    Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Armuvalus sõdalane" (eelarve ca 40 milj. krooni, tootjad Soome, Holland, Hiina ja Eesti) võtted algavad täna Vihterpalu rabas. Kaasa teeb ka Elle Kull, lavastab debütant AJ Annila

  15. Eesti teeb koos soomlaste ja hiinlastega kung-fu filmi / Mari Rebane

    Rebane, Mari


    Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Armuvalus sõdalane" (eelarve 39 milj. krooni) tootjad on Soome, Holland, Hiina ja Eesti (3,9 milj. krooni). Kaasa teeb ka Elle Kull, lavastab debütant AJ Annila

  16. Eestis algasid kung-fu-filmi võtted / Andri Maimets

    Maimets, Andri, 1979-


    Soome ja Hiina mütoloogiat ühendava fantaasiafilmi "Armuvalus sõdalane" (eelarve ca 40 milj. krooni, tootjad Soome, Holland, Hiina ja Eesti) võtted algavad täna Vihterpalu rabas. Kaasa teeb ka Elle Kull, lavastab debütant AJ Annila

  17. Zugang zu neuen FuE-Konzepten durch innovative Verfahren der Pflanzenphänotypisierung

    Altmann, Thomas


    Full Text Available The development and use of automated procedures of non- or minimal invasive monitoring of plant traits and features opens new opportunities for the identification of genetic factors determining plant characteristics and performance parameters, for the investigation of environmental effects on trait expression, for the selection of individuals or lines with preferred features from large populations, for the optimization of plant production systems, and for the recognition of novel uses of plants. This is achieved through development and application of precise and unbiased measurement procedures (not influenced by human perception, which (ideally are amenable to high-throughput approaches. They enable more accurate and much larger scale investigations or screenings than hitherto possible, they allow the detection of features that previously could not be assessed, and they offer access to monitoring and quantification of dynamic processes through repeated measurements over time. To this end, (novel sensor and detection systems have to be developed and an implemented, automation procedures have to be adapted and established, corresponding facilities have to be constructed and installed, which support monitoring and/or simulation of certain environmental parameters (in addition to the measurement of plant features and effective data analysis tools have to be developed and implemented.

  18. Giant planet migration during FU Orionis outbursts: 1D disc models

    Dunhill, A. C.


    I present the results of semi-analytic calculations of migrating planets in young, outbursting circumstellar discs. Formed far out in the disc via gravitational fragmentation early on in its lifetime, these planets typically migrate at very slow rates and are therefore mostly expected to remain at large radii (such as is the case in HR 8799). I show that changes in the disc structure during FUor outbursts affect the planet's ability to maintain a gap and can allow a massive giant planet's semimajor axis to reduce by almost 5 per cent in a single outburst under the most optimistic conditions. Given that a single disc will likely undergo ˜10 such outbursts this process can significantly alter the expected radial distribution for GI-formed planets.

  19. Cardioprotective effects of Dan-Yang-Fu-Xin decoction on chronic ...

    Tropical Journal of Pharmaceutical Research May 2016; 15 (5): 945-950 ... After intragastric administration for 8 weeks, several functional cardiac ... include the suppression of expression of inflammatory mediators and myocardial enzymes.

  20. Antropogenní transformace reliéfu v oblasti dolu Jeroným

    Kirchner, Karel; Roštínský, Pavel


    Roč. 18, č. 1 (2011), s. 92-98 ISSN 1803-1447 R&D Projects: GA ČR GA105/09/0089 Institutional research plan: CEZ:AV0Z30860518 Keywords : geomorphology * anthropogenic transformation * Slavkovský les Forest Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  1. Investigation of compressive strength of concrete with slag and silica fu

    Mostofinejad, D.; Mirtalee, K.; Sadeghi, M.


    Without doubt, concrete has special place in construction of different types of structures, and used as one of the most important materials in construction industry. Today, with development and modernization of human knowledge in construction industry, it is possible to reach h igh performance concrete . Mechanical properties and durability of high performance concrete is quite better than that of conventional concrete. In present, the use of supplementary cementitious materials, mainly silica fume, fly ash and blast furnace slag has become increasingly common for reasons of economy and technical benefits imparted by these materials. The aim of present research is investigation and comparison compressive strength of concrete specimens due to variation of water to cementitious materials ratio (W/C M), silica fume and slag percent and their proportions as cement replacement. Furthermore, it is intended to determine best combination of these materials with cement in concrete (optimum percent) to reach to maximum compressive strength. In the current study, specimens were made in 0.5,0.4 and 0.3 W/C M ratio contained 0,20,35 and 50 percent of slag as cement replacement, where in each slag replacement percent, 0, 5, 10 and 15 percent of of silica fume were used as cement replacement. Results of the current study show that the combination effect of slag and silica fume replacement in concrete leads to the maximum compressive strength in concrete; also there are some optimum percents for replacement of slag and silica fume to cement to get the best results

  2. Die Fußnote über Geognosia in Humboldts Florae Fribergensis specimen

    Herbert Pieper


    Full Text Available Article in German, Abstracts in English and GermanHumboldt distinguished between three disciplines dealing with the inquiring of the earth: geognosia, historia telluris, physiografia. In 1793, he used the notion of “Geognosie” for the first time. He explained the notion in a footnote that was reprinted in 1815, 1817, and again in 1845. The paper analyses the meaning attributed by Humboldt to the notion of “Geognosie” and gives a new German translation of the Latin texts of the footnote.

  3. Summary report of Japan-US joint project. JUPITER-II. FuY 2001 - 2006

    Abe, K.; Kohyama, A.; Tanaka, S.; Muroga, T.; Namba, C.; Sze, D.K.


    This report summarizes the scientific accomplishments achieved through the JUPITER-II Japan-US Collaboration Program. The JUPITER-II collaboration (Japan-USA Program of Irradiation/Integration Test for Fusion Research -II) has been carried out through six years (2001-2006) under Phase 4 of the collaboration implemented by Amendment 4 of Annex I to the MEXT (Ministry of Education, Culture, Sports, Science and Technology)-DOE (United States Department of Energy) Cooperation. This program followed the RTNS-II Program (Phase 1: 1982-1986), the FFTF/MOTA Program (Phase 2: 1987-1994) and the JUPITER Program (Phase 3: 1995-2000). The JUPITER-II collaboration was established to provide the scientific foundations for understanding the integrated behavior of blanket materials combinations operating under conditions characteristic of fusion reactors, including interactive neutron irradiation effects, high temperature coolant flow phenomena, heat and mass transport in blanket materials, and coolant chemistry and its interactions with surrounding materials. The scientific concept of this program is to study the key technology in macroscopic system integration for advanced blanket based on an understanding of the relevant mechanics at the microscopic level. The 44 of the presented papers are indexed individually. (J.P.N.)

  4. A Peer-Assessment Mobile Kung Fu Education Approach to Improving Students' Affective Performances

    Kuo, Fon-Chu; Chen, Jun-Ming; Chu, Hui-Chun; Yang, Kai-Hsiang; Chen, Yi-Hsuan


    Peer-assessment and video comment-sharing are effective learning strategies for students to receive feedback on their learning. Researchers have emphasized the need for well-designed peer involvement in order to improve students' abilities in the cognitive and affective domains. Although student perceptions of peer-assessment have been studied…


    Mason, Cordelia


    The remarkable growth of China in the last decade catapults it rapidly into one of the most prominent players in international business. Thus, it is not surprising that many studies have been undertaken to explore various business phenomena relating to China such as how Chinese companies explore global business opportunities and how companies from all over enter the Chinese market. A review of the literature shows that many of these studies focus on corporations and SMEs (Yang and Lee, 2002, ...

  6. γ-Rays Radiation of High Redshift Fermi Blazars WG Liu1, SH Fu2 ...

    FSRQs), which is from the second Fermi-LAT AGNs catalogue. (2LAC), we studied the correlation between flux densities (FR,FK,Fγ ) in the radio, infrared and γ-ray wave bands. We found that there is a significant positive correlation between Fγ ...

  7. *J.S., Ogeh and E. Ukodo Fu ll L eng th R esearch A rticle

    Results showed that BL had the highest organic carbon content with a range values of (6.00 – 30.30g/kg ) and. US had the lowest organic carbon ... forest or agricultural field, soil properties vary from the summit of a hill down to the bottom slope. ..... crop production in five ecological zones of. Western Nigeria. Proceedings of ...

  8. Research on Foreign Background and Musical Thought of Teng Gu

    Bo Zhang


    Full Text Available TENG Gu is a famous art historian in Republic of China. Together with early Chinese scholars studying abroad like ZONG Bai-hua, ZHU Guang-qian, DENG Yi-zhe, MA Cai and FU Bao-shi, he constructed a framework of early Chinese Art. We still know his influence after a century. In his artistic thought, the essential music idea occupies 1/3.He had given music the highest position among all arts and cultures. In his view, culture won’t have any value if art is removed. And all arts follow the rhythm of music.

  9. Subpixel mapping and test beam studies with a HV2FEI4v2 CMOS-Sensor-Hybrid Module for the ATLAS inner detector upgrade

    Bisanz, T.; Große-Knetter, J.; Quadt, A.; Rieger, J.; Weingarten, J.


    The upgrade to the High Luminosity Large Hadron Collider will increase the instantaneous luminosity by more than a factor of 5, thus creating significant challenges to the tracking systems of all experiments. Recent advancement of active pixel detectors designed in CMOS processes provide attractive alternatives to the well-established hybrid design using passive sensors since they allow for smaller pixel sizes and cost effective production. This article presents studies of a high-voltage CMOS active pixel sensor designed for the ATLAS tracker upgrade. The sensor is glued to the read-out chip of the Insertable B-Layer, forming a capacitively coupled pixel detector. The pixel pitch of the device under test is 33× 125 μm2, while the pixels of the read-out chip have a pitch of 50× 250 μm2. Three pixels of the CMOS device are connected to one read-out pixel, the information of which of these subpixels is hit is encoded in the amplitude of the output signal (subpixel encoding). Test beam measurements are presented that demonstrate the usability of this subpixel encoding scheme.

  10. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-146-Custer-Ingledow No. 1 & 2)

    Shurtliff, Aaron [Bonneville Power Administration, Portland, OR (United States)


    Vegetation Management for portion of the Custer-Ingledow No.1&2 500 kV transmission line located from tower structure 1/4 to 9/6. BPA proposes to clear unwanted vegetation in the rights-of-ways and around tower structures that may impede the operation and maintenance of the subject transmission line. Also, access road clearing will be conducted.

  11. Optical Properties of Malachite Green Dye Doped SiO2 Glasses: Effect of Transition Metal (Fe-I Used as a Codopant

    Dulen Bora


    Full Text Available Enhanced luminescence properties of Malachite Green (MG (oxalate in Fe-MG codoped SiO2 glasses compared to its values in MG doped SiO2 glasses are reported here. The enhancement is chiefly attributed to a resonance nonradiative energy transfer between Fe and MG. The quantum yield of Malachite Green (MG, in presence of Iron, trapped in sol-gel derived SiO2 glass increases by an order of ~103 compared to that in low viscous solvent while a lifetime of 3.29 ns is reported.

  12. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-60) - Rocky Reach - Maple Valley No. 1

    Martin, Mark A. [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management along the Rocky Reach – Maple Valley No. 1 Transmission Line ROW from structure 110/1 to the Maple Valley Substation. The transmission line is a 500 kV line. BPA proposes to clear targeted vegetation along access roads and around tower structures that may impede the operation and maintenance of the subject transmission line. BPA plans to conduct vegetation management along existing access road and around structure landings for the purpose of maintaining access to structures site. All work will be in accordance with the National Electrical Safety Code and BPA standards.

  13. MT3FT-15OR0204122: Report on the acquisition and installation of FEI Talos F200X S/TEM

    Parish, Chad M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)


    This document describes the installation, performance, and early results from the FCRD-funded acquisition of a new advanced analytical scanning / transmission electron microscopy (S/TEM) at the Oak Ridge National Laboratory Low Activation Materials Development and Analysis (LAMDA) facility.

  14. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-106)SnoKing Tap to Monroe-Samamish Line

    Martin, Mark A. [Bonneville Power Administration, Portland, OR (United States)


    Vegetation Management along the SnoKing Tap to the Monroe-Samamish transmission line from structure 8/1 through structure 20/6. BPA proposes to remove unwanted vegetation along the right-of-way, access roads and around tower structures along the subject transmission line corridor. The right-of-way will be treated using selective and non-selective methods that include hand cutting, mowing and herbicide treatments. Approximately 12 miles of access roads will be cleared using selective and non-selective methods that include hand cutting, mowing and herbicide treatments. Approximately 65 tower sites will be treated using selective and non-selective methods that include hand cutting, mowing and herbicide treatments. Vegetation management is required for unimpeded operation and maintenance of the subject transmission line. See Section 1of the attached checklist for a complete description of the proposal.

  15. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-124 (Echo Lake-Maple Valley #1 [Mile 9-16], Adno 8258)

    Shurtliff, Aaron [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management for portion of the Echo Lake – Maple Valley #1 500 kV transmission line located from tower structure 9/2 to 16/5. BPA proposes to clear targeted vegetation within the Right-of-Ways along access roads and around towers that may impede the operation and maintenance of the subject transmission lines. See Section 1.4 of the attached checklists for a complete description of the proposed action.

  16. Supplement Analysis for the Transmission System Vegetation Management Program FEIS (DOE/EIS-0285/SA-125 (Echo Lake-Maple Valley #1 [Mile 1-9], Adno 8258)

    Shurtliff, Aaron [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management for portion of the Echo Lake – Maple Valley #1 500 kV transmission line located from tower structure 1/1 to 9/2. BPA proposes to clear targeted vegetation within the Right-of-Ways along access roads and around towers that may impede the operation and maintenance of the subject transmission lines. See Section 1.4 of the attached checklists for a complete description of the proposed action.

  17. Supplement Analysis for the Transmission System Vegetation Management Program FEIS DOE/EIS-0285/SA-110-Covington-Columbia No. 3

    Hermeston, Mark W. [Bonneville Power Administration (BPA), Portland, OR (United States)


    Vegetation Management along the Covington-Columbia No. 3, 230kV transmission lines from structure 1/1 through structure 12/1. Corridor width varies from 150 feet to 537.5 feet. The project area is located within King County, Washington. BPA proposes to remove unwanted vegetation along the right-of-way, access roads and around tower structures along the subject transmission line corridor. Approximately 568.4 acres of the right-of-way will be treated using selective and non-selective methods that include hand cutting, mowing and herbicide treatments. Vegetation management is required for unimpeded operation and maintenance of the subject transmission line. See Section 1 of the attached checklist for a complete description of the proposal.

  18. AIR PRESSURE and Other Data from SHI YAN 3 From Antarctic and Others from 19921109 to 19930224 (NODC Accession 9600025)

    National Oceanic and Atmospheric Administration, Department of Commerce — The accession contains Surface Wave data and Sea Surface Temperature (SST) data collected as part of Tropical Ocean Global Atmosphere (TOGA) and Coupled...

  19. "But at school … I became a bit shy": Korean immigrant adolescents' discursive participation in science classrooms

    Ryu, Minjung


    In reform-based science curricula, students' discursive participation is highly encouraged as a means of science learning as well as a goal of science education. However, Asian immigrant students are perceived to be quiet and passive in classroom discursive situations, and this reticence implies that they may face challenges in discourse-rich science classroom learning environments. Given this potentially conflicting situation, the present study aims to understand how and why Asian immigrant students participate in science classroom discourse. Findings from interviews with seven Korean immigrant adolescents illustrate that they are indeed hesitant to speak up in classrooms. Drawing upon cultural historical perspectives on identity and agency, this study shows how immigrant experiences shaped the participants' othered identity and influenced their science classroom participation, as well as how they negotiated their identities and situations to participate in science classroom and peer communities. I will discuss implications of this study for science education research and science teacher education to support classroom participation of immigrant students.

  20. The Shi'ites, the West and the Future of Democracy: Reframing Political Change in a Religio-secular World

    John A Rees


    Full Text Available The present article critically reviews Paul McGeough’s important analysis of the most recent Iraq war within a broader consideration of secular-religious relations in international affairs. The thesis of Mission Impossible: The Sheikhs, the US and the Future of Iraq (2004 can be summarised around two ideas: that the US strategy in Iraq was flawed because it wilfully bypassed the traditional power structures of Iraqi society; and that these structures, formed around the tribe and the mosque, are anti-democratic thus rendering attempts at democratisation impossible. The article affirms McGeough’s argument concerning the inadequacy of the US strategy, but critically examines the author’s fatalism toward the democratic capacity of Iraqi structures, notably the structure of the mosque. By broadening the notion of democracy to include religious actors and agendas, and by an introductory interpretation of the Shi’ite community as vital players in an emerging Iraqi democracy, the article attempts to deconstruct the author’s secularist view that the world of the mosque exists in a ‘parallel universe’ to the liberal democratic West. Reframing the Shi’ites as essential actors in the democratic project thus situates political discourse in a ‘religio-secular world’ and brings the ‘other worlds’ of religion and secularism together in a sphere of interdependence. Such an approach emphasises the importance of post-secular structures in the discourses on democratic change.

  1. SHiP: a new facility with a dedicated detector to search for new long-lived neutral particles



    SHIP is a new fixed target experiment whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector, based on a long empty decay volume followed by a spectrometer and particle identi- fication detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the D meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could also be performed in an un...

  2. Once bitten, twice shy? Medically-attended injuries can sensitise parents to children's risk of injuries on playgrounds.

    Morrongiello, B A; Howard, A W; Rothman, L; Sandomierski, M


    To compare risk perceptions of parents whose child sustained a medically attended playground injury (cases) with those of parents whose child had not (controls) to address two questions. Does having a child experience a medically attended injury: (1) sensitise parents to children's injury vulnerability and severity; (2) influence parents' appraisal of the injury mechanism (child's behaviour), attributions for injuries or beliefs about strategies for prevention? Each case-control parent dyad was assigned to one of two conditions: (1) being presented with 10 common injury-risk playground behaviours specific to the equipment on which their child had been hurt, and asked to appraise injury vulnerability and severity; or (2) being presented with scenarios about playground injuries that varied in severity but were all based on the same child behaviour, and asked questions about this behaviour, attributions for injury and strategies for prevention. The results support the occurrence of a sensitisation process. Compared with control parents, case parents showed higher ratings of injury severity and children's vulnerability to injury, made fewer attributions for injuries to bad luck, and endorsed a greater diversity of prevention strategies, including parent (closer supervision), child (teaching rules about safe play on playgrounds) and environmental (modifications to playgrounds). A child's medically attended injury can create a "teachable moment" for the parent. Linking injury-prevention programming to this teachable moment may increase the likelihood of evoking changes in parental supervisory behaviour and their setting of rules limiting their child's risk behaviours to reduce the occurrence of childhood injury.

  3. Shy and bold great tits (Parus major): body temperature and breath rate in response to handling stress

    Carere, C.; Van Oers, K.


    A standard handling protocol was used to test the hypothesis that boldness predicts stress responsiveness in body temperature and breath rate. Great tit (Parus major) nestlings were taken from the field, hand reared until independence, and their response to a novel object was assessed. At the age of

  4. Shy and bold great tits (Parus major) : body temperature and breath rate in response to handling stress

    Carere, C; van Oers, K


    A standard handling protocol was used to test the hypothesis that boldness predicts stress responsiveness in body temperature and breath rate. Great tit (Parus major) nestlings were taken from the field, hand reared until independence, and their response to a novel object was assessed. At the age of

  5. Turning shy on a winter's day : Effects of season on personality and stress response in Microtus arvalis

    Gracceva, Giulia; Herde, Antje; Groothuis, Ton G. G.; Koolhaas, Jaap M.; Palme, Rupert; Eccard, Jana A.

    Animal personalities are by definition stable over time, but to what extent they may change during development and in adulthood to adjust to environmental change is unclear. Animals of temperate environments have evolved physiological and behavioural adaptations to cope with the cyclic seasonal

  6. Direct determination of absolute configuration: a vibrational circular dichroism study on dimethyl-substituted phenyloxiranes synthesized by Shi epoxidation

    Fristrup, Peter; Lassen, Peter Rygaard; Tanner, David Ackland


    obtained using DFT/B3LYP calculations, and the differences between experiment and theory are discussed. The absolute configuration at the benzylic position was established as being (R), (S) and (R) for the cis, trans and geminal dimethylsubstituted phenyloxiranes, respectively. In all three cases...

  7. Regional new energy vision formulation for Nichinan City. Fiscal 2001 report; 2001 nendo Nichinan shi chiiki shin energy vision sakuteisho



    For promoting the introduction of new energy and for elevating people's consciousness of such in Nichinan City, Miyazaki Prefecture, surveys and studies were conducted concerning the energy demand of the city, the amount of new energy resources in existence, and new energy introduction plans, and then a vision was formulated. The city's energy demand is estimated to be approximately 4,028-million MJ/year, which includes 46% for the transportation sector, 30% for the people's livelihood-related business sector, 17% for the residential sector, and 7% for the industrial sector. The energy demand is covered 62% by oil-based fuels and 30% by electric power. Projects discussed for new energy introduction included the introduction of photovoltaic power into a lifelong learning center, a comprehensive center for health and welfare, and primary schools; introduction of solar hot water supply systems into school meal providing facilities; introduction of medium-size wind power systems (five systems); medium- or small-scale hydroelectric power generation on the Sakatani river; use of street light lighted by photovoltaic/wind hybrid power systems; introduction of clean energy vehicles; power generation utilizing livestock excrement; introduction of photovoltaic, hydroelectric, and methane gas power generation into a sewage treatment plant; and the use of RPF (refuse paper and plastic fuel) at the Nichinan plant of Oji Paper Co., Ltd. (NEDO)

  8. Temperament, disordered attachment and parental sensitivity in foster care: Differential findings on attachment security for shy children

    de Schipper, J.C.; Oosterman, M.; Schuengel, C.


    In a foster care sample, the moderating effect of temperamental shyness on the association between parental sensitivity and attachment quality was tested. The foster parents of 59 foster children (age M=57 months, SD=16.4) filled out the Child Behavior Questionnaire. To control for confounds,

  9. Focal points of future FuE work concerning the final disposal of radioactive wastes (2011-2014); Schwerpunkte zukuenftiger FuE-Arbeiten bei der Endlagerung radioaktiver Abfaelle (2011-2014)



    The present Federal support concept is the basis for applied fundamental research concerning final disposal of heat generating radioactive wastes. The use-oriented fundamental research is aimed to the development of a scientific-technical basis for the realization of a final repository for heat-generating radioactive wastes and spent nuclear fuel, to the continuous advancement of the state of science and technology with respect to final waste disposal and a substantial contribution to the constitution, development and preservation of scientific-technological competence in the field of nuclear waste management in Germany. The concept includes research and development work concerning final disposal in the host rock salt, clays and crystalline rocks (granite). The research and development main issues are the final disposal system, the system behavior, further topics in relation to final disposal and nuclear materials surveillance.

  10. Studien zur Eignung von Silizium Photomultipliern für den Einsatz im erweiterten CMS Detektor am SLHC

    Rennefeld, Joerg


    Silicon photomultipliers (SiPMs) are modern semiconductor based detectors that have the potential to replace conventional photomultiplier tubes (PMTs) in many fields of application. In the course of research and development for upgrades of the CMS detector their potential for usage in different components is evaluated. The paper at hand deals with the temperature dependency of SiPMs. Their dark current is an important operating parameter. His temperature dependency is investigated using current-voltage characteristics. Furthermore a method for obtaining temperature independent output pulses is presented. To unleash the full potential of the sensors one has to make use of customized electronics for the readout. Therefore a custom printed circuit board developed by the electronics departments of our institute (III. Physikalisches Institut B, RWTH Aachen University) is used in this thesis. Finally the results of measurements on two commercially available MPPC modules from Hamamatsu Photonics K. K. are presented.

  11. Density measurements of H- and D- for fusion applications (final scientific report contract FU-CT-2000-50001)

    Boilson, D


    The main topic of this contract is the implementation of the Cavity Ring-down Spectroscopy (CRS) technique proposed for quantitative measurement of negative H{sup -} and D{sup -} densities in the Kamaboko III ion source on the MANTIS test bed in the DRFC, CEA Cadarache. MANTIS is used for the development of high density negative ion current beams for use in NBI systems in proposed nuclear fusion reactors. The source used at the MANTIS test stand is a scale version of the source designed for the ITER neutral beam injection system called the Kamaboko III ion source. This report outlines the performance of the KAMABOKO source when operated in caseiated mode. The effect of plasma grid temperature, Cs seeding, Cs consumption, and long pulse, 1000 s, beam extraction are discussed, and the limitations observed with the MANTIS system are identified and further objectives outlined. (author)

  12. Focal points of future FuE work concerning the final disposal of radioactive wastes (2011-2014)


    The present Federal support concept is the basis for applied fundamental research concerning final disposal of heat generating radioactive wastes. The use-oriented fundamental research is aimed to the development of a scientific-technical basis for the realization of a final repository for heat-generating radioactive wastes and spent nuclear fuel, to the continuous advancement of the state of science and technology with respect to final waste disposal and a substantial contribution to the constitution, development and preservation of scientific-technological competence in the field of nuclear waste management in Germany. The concept includes research and development work concerning final disposal in the host rock salt, clays and crystalline rocks (granite). The research and development main issues are the final disposal system, the system behavior, further topics in relation to final disposal and nuclear materials surveillance.

  13. Tumor lysis syndrome in a patient with metastatic colon cancer after treatment with oxaliplatin and 5-Fu

    Ruo-Han Tseng


    Full Text Available Tumor lysis syndrome in solid tumors is a rare occurrence, with a poor prognosis. We present the case of a patient of recurrent colon cancer who received chemotherapy with FOLFOX regimen (lencovorin, fluorouracil, and oxaliplatin with subsequent tumor lysis. We present a recurrent rectal cancer patient suffered from tumor lysis syndrome after salvage FOLFOX regimen. After treat with CVVH with improved conscious status. In this case report, we had review the tumor lysis in solid tumor.

  14. Altered characteristics of cancer stem/initiating cells in a breast cancer cell line treated with persistent 5-FU chemotherapy



    Drug resistance of cancer stem/initiating cells has been considered to be one of the main reasons for tumor relapse. However, knowledge concerning the changes in stem/ initiating cells during chemotherapy is limited. In the present study, the breast cancer cell line MDA-MB-468 was cultured with 5-fluorouracil and serially passaged. Six cell generations were collected. Semi-quantitative RT-PCR and flow cytometric techniques were used to evaluate the protein and mRNA expression of stem/initiati...

  15. Leistungsvergleich und Emotionalität: Die mediale Präsentation von Fußball

    Stauff, M.


    With its plentiful displays of emotions, football participates in many fields of meaning. Television in particular creates clearly defined images of emotions; their status, however, is ambivalent: They contribute to very specific communications on sports, at the same time alluding to discourses and

  16. The Cornella Health Interview Survey Follow-Up (CHIS.FU Study: design, methods, and response rate

    Perez Gloria


    Full Text Available Abstract Background The aim of this report is to describe the main characteristics of the design, including response rates, of the Cornella Health Interview Survey Follow-up Study. Methods The original cohort consisted of 2,500 subjects (1,263 women and 1,237 men interviewed as part of the 1994 Cornella Health Interview Study. A record linkage to update the address and vital status of the cohort members was carried out using, first a deterministic method, and secondly a probabilistic one, based on each subject's first name and surnames. Subsequently, we attempted to locate the cohort members to conduct the phone follow-up interviews. A pilot study was carried out to test the overall feasibility and to modify some procedures before the field work began. Results After record linkage, 2,468 (98.7% subjects were successfully traced. Of these, 91 (3.6% were deceased, 259 (10.3% had moved to other towns, and 50 (2.0% had neither renewed their last municipal census documents nor declared having moved. After using different strategies to track and to retain cohort members, we traced 92% of the CHIS participants. From them, 1,605 subjects answered the follow-up questionnaire. Conclusion The computerized record linkage maximized the success of the follow-up that was carried out 7 years after the baseline interview. The pilot study was useful to increase the efficiency in tracing and interviewing the respondents.

  17. VizieR Online Data Catalog: Li enrichment histories of the thick/thin disc (Fu+, 2018)

    Fu, X.; Romano, D.; Bragaglia, A.; Mucciarelli, A.; Lind, K.; Delgado Mena, E.; Sousa, S. G.; Randich, S.; Bressan, A.; Sbordone, L.; Martell, S.; Korn, A. J.; Abia, C.; Smiljanic, R.; Jofre, P.; Pancino, E.; Tautvaisiene, G.; Tang, B.; Lanzafame, A. C.; Magrini, L.; Carraro, G.; Bensby, T.; Damiani, F.; Alfaro, E. J.; Flaccomio, E.; Morbidelli, L.; Zaggia, S.; Lardo, C.; Monaco, L.; Frasca, A.; Donati, P.; Drazdauskas, A.; Chorniy, Y.; Bayo, A.; Kordopatis, G.


    To investigate the Galactic lithium enrichment history we se- lect well-measured main sequence field stars with UVES spectra from the GES iDR4 catalogue. In our selection, 1884 UVES stars are marked as field stars, including those of the Galactic disc and halo designated as MW (GEMW) fields, standard CoRoT (GES D_CR) field, standard radial velocity (GES DRV) field, and stars to the Galactic Bulge direction (GEMWBL). (1 data file).

  18. “Your Kung Fu is very good, Master Fiore!” Asian and European fight books in comparison

    Wetzler Sixt


    Full Text Available The phenomenon of the fight book is not restricted to the European tradition. Similar artefacts, usually combining text and image to describe the techniques of close quarter combat with and without weapons, exist also in various Asian cultures, in China, Japan, Korea, and India. In the article, the question shall be raised in how far and to which end fight books of different cultures can be taken into one perspective, and be compared. To do so, similarities and dissimilarities between European and early Chinese fight books will be pointed out, and preliminary areas for comparison will be introduced. The aim of the article is to raise awareness for the topic, and to lay the ground for further discussion between specialists on the respective European and Chinese fields.

  19. “Your Kung Fu is very good, Master Fiore!” Asian and European fight books in comparison

    Wetzler Sixt


    The phenomenon of the fight book is not restricted to the European tradition. Similar artefacts, usually combining text and image to describe the techniques of close quarter combat with and without weapons, exist also in various Asian cultures, in China, Japan, Korea, and India. In the article, the question shall be raised in how far and to which end fight books of different cultures can be taken into one perspective, and be compared. To do so, similarities and dissimilarities between Europea...

  20. Evaluations of dielectric property and drug release profile of 5-FU patches based on plasma charged electrets

    Wang, YUAN; Hejuan, LIANG; Ping, HUANG; Xiaoqiang, AN; Jian, JIANG; Lili, CUI


    In the present study, the electret 5-fluorouracil patch was developed, the effective surface potential, piezoelectric coefficient d 33, open-circuit thermally stimulated discharge (TSD) current spectra and shear adhesion of the patch were measured. The drug release profile of the patch was determined by using high performance liquid chromatography method. A stable potential difference which was positively dependent on the surface potential of the electret was generated on two sides of the patch. The measurements of d 33 coefficient, TSD current spectra and adhesion performance showed that the electrostatic field of the electret could cause polarization and cohesive strength decreasing of the matrix molecules, change the distribution and interaction of the drug molecules in patch, therefore to increase the release of drug from the transdermal patch.