WorldWideScience

Sample records for shi bo wu

  1. Wu Chien-Shiung: A brief biography

    Chiang, Tsai-Chien

    2015-12-01

    My first encounter with professor Wu Chien-Shiung, a leading experimental physicist, 31 years ago inspired me to write her biography. I received much encouragement when planning this biography, especially from Dr. Yang Chen Ning, whose biography I wrote later. The real challenges in writing Wu's biography were finding the balance between both sides of her life and overcoming the obstacle that, unlike theoretical physicists (such as Yang), experimental physicists are inclined more to deeds than to words.

  2. YUAN-BO SUN

    Home; Journals; Journal of Genetics. YUAN-BO SUN. Articles written in Journal of Genetics. Volume 97 Issue 1 March 2018 pp 173-178 RESEARCH ARTICLE. Investigating multiple dysregulated pathways in rheumatoid arthritis based on pathway interaction network · XIAN-DONG SONG XIAN-XU SONG GUI-BO LIU ...

  3. [Professor WU Zhongchao's experience of penetration needling].

    Zhang, Ning; Wang, Bing; Zhou, Yu

    2016-08-12

    Professor WU Zhongchao has unique application of penetration needling in clinical treatment. Professor WU applies penetration needling along meridians, and the methods of penetration needling include self-meridian penetration, exterior-interior meridian penetration, identical-name meridian penetration, different meridian penetration. The meridian differentiation is performed according to different TCM syndromes, locations and natures of diseases and acupoint nature, so as to make a comprehensive assessment. The qi movement during acupuncture is focused. In addition, attention is paid on anatomy and long-needle penetration; the sequence and direction of acupuncture is essential, and the reinforcing and reducing methods have great originality, presented with holding, waiting, pressing and vibrating. Based on classical acupoint, the acupoint of penetration needling is flexible, forming unique combination of acupoints.

  4. Non-minimal Wu-Yang monopole

    Balakin, A.B.; Zayats, A.E.

    2007-01-01

    We discuss new exact spherically symmetric static solutions to non-minimally extended Einstein-Yang-Mills equations. The obtained solution to the Yang-Mills subsystem is interpreted as a non-minimal Wu-Yang monopole solution. We focus on the analysis of two classes of the exact solutions to the gravitational field equations. Solutions of the first class belong to the Reissner-Nordstroem type, i.e., they are characterized by horizons and by the singularity at the point of origin. The solutions of the second class are regular ones. The horizons and singularities of a new type, the non-minimal ones, are indicated

  5. Women stereotypes in Shi Zhecun's short stories.

    Rosenmeier, Christopher

    2010-01-01

    This article analyses the representation of women in two 1933 short story collections by Shi Zhecun: An Evening of Spring Rain and Exemplary Conduct of Virtuous Women. It discusses how the New Woman image was a site of contestation in Republican China, and argues that Shi Zhecun’s short stories contain four basic stereotypes: the enigmatic woman, the estranged wife, the prostitute, and the inhibited woman. Using these narratives of women and how they were perceived by men, Shi Zhecun deconstructed the New Woman image by subverting the various ways modernity was projected onto women.

  6. Dr. Shi Hanzhang's Experience in Treating Andropathy

    2007-01-01

    @@ Dr. Shi Hanzhang (施汉章) of Dongzhimen Hospital affiliated to Beijing University of Traditional Chinese Medicine is experienced in both teaching and clinical practice, especially in treating andropathy, such as sexual disorder, infertility, and hyperplasia of the prostate. The author has the honour to follow him for study and really learned a lot from him. A brief introduction to Dr. Shi's way of thinking in treatment is as follows.

  7. On soliton solutions of the Wu-Zhang system

    Inc Mustafa

    2016-01-01

    Full Text Available In this paper, the extended tanh and hirota methods are used to construct soliton solutions for the WuZhang (WZ system. Singular solitary wave, periodic and multi soliton solutions of the WZ system are obtained.

  8. [The essence of Professor Wu Lian-Zhong's acupuncture manipulation].

    Liu, Jing; Guo, Yi; Wu, Lian-Zhong

    2014-05-01

    The painless needle insertion technique, summarized by Professor WU Lian-zhong during his decades of acupuncture clinical practice is introduced in this article, which is characterized as soft, flexible, fast, plucking and activating antipathogenic qi. The Sancai (three layers) lifting and thrusting manipulation technique is adopted by Professor WU for getting the qi sensation. And features of 10 kinds of needling sensation such as soreness, numbness, heaviness, distension, pain, cold, hot, radiation, jumping and contracture are summarized. Finger force, amplitude, speed and time length are also taken as the basis of reinforcing and reducing manipulations. Moreover, examples are also given to explain the needling technique on some specific points which further embodies Professor WU's unique experiences and understandings on acupuncture.

  9. Civil Engineering for the SHiP facility

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  10. Radiation protection studies for the SHiP facility

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  11. Dicty_cDB: SHI251 [Dicty_cDB

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  12. Dicty_cDB: SHI867 [Dicty_cDB

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  13. Dicty_cDB: SHI777 [Dicty_cDB

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  14. Dark matter at the SHiP experiment

    Timiryasov, Inar

    2016-01-01

    We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator

  15. Wu-Ling-San formula prophylaxis against recurrent calcium oxalate ...

    Wu-Ling-San (WLS) formula has been proved to prevent calcium oxalate nephrolithiasis both in vitro and in vivo. This is the first prospective, randomized and placebo-controlled clinical trial of WLS in calcium oxalate nephrolithiasis prevention. All patients who enrolled were asked to drink enough fluid to urinate at least 2 L ...

  16. Towards a Collective Intelligence: Transmediality and the Wu Ming Project

    Melina Anne Masterson

    2014-11-01

    Full Text Available Dagli albori della Seconda Repubblica in Italia,  le strategie di dominio sui mass media dell’ex premier Silvio Berlusconi hanno avuto un effetto considerevole sull’immaginario culturale italiano. In un approccio multisensoriale e multimediale alla scrittura, il collettivo Wu Ming mette in questione i paradigmi culturali che negli ultimi venti anni sono diventati egemonici. L’esperienza di un romanzo dei Wu Ming va ben oltre la parola stampata poiché cerca di stimolare tutti i cinque sensi per arricchire il modo in cui il lettore vive quello che c’è sulla pagina, dimostrando esempi chiari della «convergence culture» coniata da Henry Jenkins. Questo saggio esamina l’interazione tra parola e immagine messa in atto dal collettivo tramite il sito Pinterest e illustra come questo aspetto del loro progetto rappresenti un microcosmo di un approccio complessivo alla creazione estetica e alla pratica culturale. Inoltre, questo saggio descrive in che modo il processo collettivo di consumo portato avanti dai Wu Ming contribuisca alla formazione delle «communities of sentiment» di Arjun Appadurai e alla «intelligenza collettiva» di Jenkins. Queste sono formazioni che rivitalizzano il concetto di cultura popolare per la nostra epoca digitale e offrono un’alternativa ad un immaginario culturale italiano sovra-determinato dalle pratiche del Berlusconismo.

  17. Combinatorial interpretation of Haldane-Wu fractional exclusion statistics.

    Aringazin, A K; Mazhitov, M I

    2002-08-01

    Assuming that the maximal allowed number of identical particles in a state is an integer parameter, q, we derive the statistical weight and analyze the associated equation that defines the statistical distribution. The derived distribution covers Fermi-Dirac and Bose-Einstein ones in the particular cases q=1 and q--> infinity (n(i)/q-->1), respectively. We show that the derived statistical weight provides a natural combinatorial interpretation of Haldane-Wu fractional exclusion statistics, and present exact solutions of the distribution equation.

  18. The SHiP physics program

    De Lellis, Giovanni

    2018-05-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, which deserve an explanation that could come from the discovery of new particles. The SHiP experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment including the tau neutrino magnetic moment.

  19. Why investors shy away from coal

    Roling, D.A.

    1994-01-01

    Why do investors shy away from coal? This may sound like a strange question given the change in ownership of many major coal companies in recent years, but the ongoing consolidation within the coal industry is quite different from any actual new investment in the industry. To begin to understand why, one must return to the early '70s, a time of low-cost, abundant energy. The price of oil was about $2-4/bbl until 1973. The price of natural gas was about 60 cents/M ft 3 , and coal was approximately $7/st. This, however, was before the first Organization of the Petroleum Exporting Countries (OPEC) shock. The price of coal declined throughout the 1980s, and continues its downward path in some markets. Many coal investments have not achieved their expected return, such as the case of a 1M st/yr mine in West Virginia, which was developed in the early '80s only to be put immediately on a care-and-maintenance basis, where it languished until it was sold in 1990. Other mines, such as the large open-pit mines in the Powder River Basin in Wyoming, never reached their targeted production rates. Some of these large mines had equipment that remained in crates for years, only later to be sold at a loss. The extent of losses on investments in coal mines is discussed

  20. The SHiP project at CERN

    De Lellis, G.; SHiP Collaboration

    2016-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry, which deserve an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. Indeed, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment. Resistive Plate Chambers could play a role in the SHiP detector.

  1. The SHiP experiment at CERN

    Bonivento, Walter M.

    2017-07-01

    The discovery of the Higgs boson has fully confirmed the Standard Model of particles and fields. Nevertheless, there are still fundamental phenomena, like the existence of dark matter and the baryon asymmetry of the Universe, deserving an explanation that could come from the discovery of new particles. Searches for new physics with accelerators are performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experiment at CERN meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in different theoretical models beyond the Standard Model, is largely unexplored. A beam dump facility using high intensity 400 GeV protons is a copious source of such unknown particles in the GeV mass range. The beam dump is also a copious source of neutrinos and in particular it is an ideal source of tau neutrinos, the less known particle in the Standard Model. The neutrino detector can also search for dark matter through its scattering off the electrons. We report the physics potential of the SHiP experiment.

  2. Professor Ta-You Wu and his ideas of science

    Ye Minghan; Dai Nianzu

    2005-01-01

    The career of Professor Ta-You Wu and his contributions in the latter half of his life in Taiwan, China are briefly reviewed. The authors focus our discussion on some of his ideas in pushing forward the advancement of science and technology in Taiwan and in promoting scientific standards. These ideas include: emphasis on the importance of basic science and qualified personnel as the foundation for the development of science and technology, and while advocating applied science he pointed out that 'future profits depend on high technology'. Thus, he contributed greatly to the rise of the economy in Taiwan. His view of the dispute between Bohr and Einstein is also briefly reviewed, as well as his principles of leadership as the president of Academia Sinica, Taiwan. (author)

  3. BoA Venus is Back

    田梦园

    2010-01-01

    暌违韩国歌坛五年.BoA终于带着自己的六辑回到韩国的歌谣舞台。经历了日本.美国歌坛的洗礼,BoA以更加成熟,更具实力的形象回到自己的主场.让我们一起迎接Venus的回归。

  4. Effect of healthy Qigong “WuQinXi” exercise on peripheral blood T ...

    USER

    2010-07-19

    Jul 19, 2010 ... cell subgroups in elderly “WuQinXi” practitioners. Fifty healthy Chinese ... on health condition, diet, medical history, lifestyle and menstrual status, .... Mechanism of health-promotion of “WuQinXi” exercise created in East Hai ...

  5. We Can't Get No (Life) Satisfaction? Comment on Oswald and Wu (2010)

    Pesta, Bryan J.; McDaniel, Michael A.; Bertsch, Sharon

    2010-01-01

    Oswald and Wu (2010; "Science") recently reported life satisfaction ranks for residents of the 50 U.S. states. Their rankings were framed as measures of "well-being," but were derived from responses to only a single survey item ("In general, how satisfied are you with your life?"). Here we contrast Oswald and Wu's subjective rankings with our…

  6. Brothers or Rivals? Iran and the Shi'a of Iraq

    Hunter, Robert C

    2006-01-01

    This thesis examines the loyalty of the Shi a of Iraq. While some Sunni Arab leaders have recently accused the Shi a of Iraq of pledging loyalty to Iran, in fact the Iraqi Shi a are loyal to their own nation...

  7. Extraction and beam transfer for the SHiP facility

    Goddard, Brennan; Borburgh, Jan; Balhan, Bruno; Le Godec, Gilles; Zerlauth, Markus; Tommasini, Davide; Kain, Verena; Cornelis, Karel; Wenninger, Jorg; Jensen, Lars; Todd, Benjamin; Bauche, Jeremie; Puccio, Bruno

    2015-01-01

    This document summarises the key feasibility issues associated with the SPS extraction and beam transfer systems required for the SHiP facility. It describes the expected performance limits of the electrostatic septa, the expected beam losses during extraction and consequences, the design of the new beamline geometry and equipment systems and the expected extracted spill structure.

  8. Governing Civil Service Pay in China, by Alfred M. Wu. Copenhagen: NIAS Press, 2014. xvi+236 pp

    Brødsgaard, Kjeld Erik

    2016-01-01

    Book review of: Governing Civil Service Pay in China by Alfred M. Wu. Copenhagen: NIAS Press, 2014.......Book review of: Governing Civil Service Pay in China by Alfred M. Wu. Copenhagen: NIAS Press, 2014....

  9. Chien-Shiung Wu: An Icon of Physicist and Woman Scientist in China

    Zhu, Yuelin

    2014-03-01

    Chien-Shiung Wu, the first female president of APS, is a well-known figure in China, a figure who serves as an inspiration for youths, especially young women, to study science and particularly physics. In this presentation, a historical perspective will be used to show how such an icon was formed. Born in 1912, the year of the Republic Revolution, Wu was in the first generation of physicists in China and her college mentor was a student of Marie Curie. When Wu came to the U.S. for graduate studies in the 1930s, it was a ``golden age'' for nuclear physics, and the invention of the cyclotron by E. O. Lawrence put UC Berkeley at the frontier. Wu was trained there, with Lawrence as her advisor, and later became an expert in Beta-decay. In 1956, Wu conceived and initiated the experiment of Cobalt-60, which, together with other two experiments, eventually proved the asymmetry of parity in weak-interactions, a hypothesis proposed by T. D. Lee and C. N. Yang. The importance of the experiment gained Wu an enormous reputation which spread even to China, when this was a period of hostility in Sino-American relations, and near total isolation due to the Cold-War. Wu was the daughter of a revolutionary, and an activist in college in patriotic student movements, and she combined this background with her scientific career as the way of ``Saving China with Science,'' a common belief reflecting the Zeitgeist of her time. Although she spent most of her life in the U.S., Wu never wavered in her love for or loyalty to her motherland. Her patriotism, as well as her scientific achievement, made Wu a legend in China, being called ``the Chinese Madam Curie.'' Even during the Cultural Revolution, a novel supposedly taking Wu as the original model was very popular in underground circles, widely spread by hand-written-copies. From 1979-1988, the CUSPEA program enrolled hundreds of China's best graduate students into physics departments in American universities. Although Wu herself was not

  10. BoA The Best is Coming

    2009-01-01

    成功进军美国歌坛,迈向全新阶段的BoA,化身为双面歌姬,发行了专辑《BEST&USA》将“日文精选辑”与“美国出道专辑”2张作品结合为9年来,从韩国到日本再到美国,BoA的成长令人无法忽视。

  11. [Doctor HUANG Shi-ping's acupuncture with golden needles].

    Chen, Teng-Fei; Ma, Zeng-Bin; Xin, Si-Yuan; Zhu, Jiang

    2013-08-01

    Taking Doctor HUANG Shi-ping as the representative, the school of Huang's golden needle is based on Chinese martial art. Golden needles are adopted as main tool. Attaching great importance on the combination of acupuncture and moxibustioin, it is also characterized with penetrating needling with long needles. Through the development of three generations, it once outshone other schools in the field of acupuncture, and became famous all over the world. It made great contribution to the development of the course of acupuncture. However, with the development of the history, the form of acupuncture education as well as apparatus were all undergone an unified reform. Therefore, Doctor HUANG Shi-ping's acupuncture school be lost gradually.

  12. A SHiP to explore new routes

    Antonella Del Rosso

    2015-01-01

    SHiP (Search for Hidden Particles) is a proposed new facility for CERN's SPS accelerator. Its challenging goals include a direct search for hidden non-Standard-Model particles. Predicted by a large number of theoretical models, such particles could have slipped under the radar of the LHC experiments because of their specific features. In its first symposium held at CERN on 2 July, SHiP scientists showed the broader scientific community how they plan to unveil the hidden world.     The SHiP experiment is designed to be installed next to the SPS North Area.  Powerful accelerators like the LHC allow physicists to explore extensively the primordial phenomena at energy densities equivalent to those that existed just a few moments after the Big Bang. In this way, thanks to the high precision of the LHC experiments, scientists have been able to comprehensively confirm the predictions of the Standard Model (SM), including the existence of a Higgs boson. However, new...

  13. Interlopers, Rogues, or Cosmopolitans? Wu Jianzhang and Early Modern Commercial Networks on the China Coast

    Peter C. Perdue

    2017-12-01

    Full Text Available After the First Opium War (1839–1842, British and American merchants negotiated with Chinese officials in Shanghai to work out the framework of the new treaty port regime. One key player in these negotiations was Wu Jianzhang, a Cantonese merchant who became circuit intendant of the Shanghai region. Wu, however, also had links to Cantonese sailors and anti-Qing secret societies. When the Small Swords Society took Shanghai in 1853, he found himself entangled in conflicting responsibilities and networks. Foreign traders and Chinese officials regarded Wu, like other middlemen on the Chinese coast, with a mixture of respect and distrust. Wu’s situation, however, was not unique to the mid-nineteenth century. This article compares Wu to other intermediaries who played similar roles in the sixteenth and late nineteenth centuries, in order to show the ways in which Wu, his predecessors, and those who followed in his footsteps connected China to the wider world by navigating the treacherous waters of diplomacy, war, and commerce. The work of John K. Fairbank, who in the 1950s pioneered the study of such people as Wu Jianzhang, can find new meaning in the twenty-first century, enabling us to understand the transnational implications of China’s local social history.

  14. Lattice models and integrability: a special issue in honour of F Y Wu

    Guttmann, A. J.; Jacobsen, J. L.

    2012-12-01

    Fa Yueh (Fred) Wu was born on 5 January 1932 in Nanking (now known as Nanjing), China, the capital of the Nationalist government. Wu began kindergarten in 1937 in a comfortable setting, as his father held a relatively high government position. But the Sino-Japanese war broke out in July 1937, and Nanking fell to Japanese hands in November. Fleeing the Japanese, his parents brought Wu to their hometown in Hunan, and then to the war capital Chungking (now Chongqing) in 1938, where they lived for eight years until the end of the war. Around that time the Japanese began bombing Chungking, and Wu's childhood memories were dominated by air raids, bombings and burning not dissimilar to those experienced by Londoners during the war. At times the air raids lasted for days disrupting everyday lives in Chungking, including Wu's schooling. One day during a fierce bombing raid, a bomb fell in their garden reducing a pavilion and the surrounding pond to a huge crater; another bomb fell just a few metres from the tunnel where his family took shelter, almost sealing the only entrance. The family moved the very next day to the countryside. As a result of the war, Wu attended seven schools before finishing his primary education. Fortunately, by the time he entered junior high school in 1943, the Japanese forces were on the wane and Wu entered the elite middle school, Nankai. His early academic performance in Nankai seemed to him mediocre, but he nevertheless impressed his geometry teacher by showing bursts of talent. With hindsight, this early interest in geometry may have led to his later insights in graphical analyses of statistical systems. The family returned to Nanking in 1946 after the Victory over Japan Day. By this time his father had become elected to the Legislative Yuan, the equivalent of the US Senate. Wu entered high school in Nanking in 1946. Since he came from an elite school in Chungking, he excelled in most of his classes, especially mathematics. Notwithstanding his

  15. R and D of tritium technology as SHI (Sumitomo Heavy Industries)

    Yokogawa, N.

    1997-01-01

    Sumitomo Heavy Industries (SHI) participated in an R and D programme on tritium processing for the first time in 1967 by joining the advanced thermal reactor project. (The thermal reactor is cooled by light water and moderated by heavy water.) From that time SHI has developed various kind of tritium handling technologies. On the basis of cooperation with Sulzer (Sulzer Chemtech Ltd. Switzerland), SHI developed a system for removing waste water for fuel reprocessing plants by water distillation technology. In the field of fusion technology, SHI has developed a hydrogen isotope separation system by cryogenic distillation and thermal diffusion methods, and a tritium storage bed. Fundamental data required for the system design were obtained through the production and operation of the above prototype systems. Recently, SHI has also been taking part in the design and planning of ITER. In the future, along with ITER design, SHI will aim at developing tritium measuring technology. (author)

  16. Ray Wu as Fifth Business: Deconstructing collective memory in the history of DNA sequencing.

    Onaga, Lisa A

    2014-06-01

    The concept of 'Fifth Business' is used to analyze a minority standpoint and bring serious attention to the role of scientists who play a galvanizing role in a science but for multiple reasons appear less prominently in more common recounts of any particular development. Biochemist Ray Wu (1928-2008) published a DNA sequencing experiment in March 1970 using DNA polymerase catalysis and specific nucleotide labeling, both of which are foundational to general sequencing methods today. The scant mention of Wu's work from textbooks, research articles, and other accounts of DNA sequencing calls into question how scientific collective memory forms. This alternative history seeks to understand why a key figure in nucleic acid sequence analysis has remained less visibly connected or peripheral to solidifying narratives about the history of DNA sequencing. The study resists predictable dismissals of Wu's work in order to seriously examine the formation of his nucleic acid sequence analysis research program and how he shared his knowledge of sequencing during a period of rapid advancement in the field. An analysis of Wu's work on sequencing the cohesive ends of lambda bacteriophage in the 1960s and 1970s exemplifies how a variety of individuals and groups attempted to develop protocol for sequencing the order of nucleotide base pairs comprising DNA. This historical examination of the sociality of scientific research suggests a way to understand how Wu and others contributed to the very collective memory of DNA sequencing that Wu eventually tried to repair. The study of Wu, who was a Chinese immigrant to the United States, provides a foundation for further critical scholarship on the heterogeneous histories of Asian American bioscientists, the sociality of their scientific works, and how the resulting knowledge produced is preserved, if not evenly, in a scientific field's collective memory. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. $\\mu$-flux measurements for SHiP using NA61/SHINE

    Dijkstra, H; Korzenev, A; Mermod, P

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in june 2017.

  18. Calibrating the SHiP muon-flux using NA61/SHINE

    Van Herwijnen, Eric; Korzenev, Alexander; Mermod, Philippe

    2016-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV proton beam in front of the NA61/SHINE spectrometer. We propose to do a first measurement in 2017.

  19. Clostridium botulinum strains producing BoNT/F4 or BoNT/F5.

    Raphael, Brian H; Bradshaw, Marite; Kalb, Suzanne R; Joseph, Lavin A; Lúquez, Carolina; Barr, John R; Johnson, Eric A; Maslanka, Susan E

    2014-05-01

    Botulinum neurotoxin type F (BoNT/F) may be produced by Clostridium botulinum alone or in combination with another toxin type such as BoNT/A or BoNT/B. Type F neurotoxin gene sequences have been further classified into seven toxin subtypes. Recently, the genome sequence of one strain of C. botulinum (Af84) was shown to contain three neurotoxin genes (bont/F4, bont/F5, and bont/A2). In this study, eight strains containing bont/F4 and seven strains containing bont/F5 were examined. Culture supernatants produced by these strains were incubated with BoNT/F-specific peptide substrates. Cleavage products of these peptides were subjected to mass spectral analysis, allowing detection of the BoNT/F subtypes present in the culture supernatants. PCR analysis demonstrated that a plasmid-specific marker (PL-6) was observed only among strains containing bont/F5. Among these strains, Southern hybridization revealed the presence of an approximately 242-kb plasmid harboring bont/F5. Genome sequencing of four of these strains revealed that the genomic backgrounds of strains harboring either bont/F4 or bont/F5 are diverse. None of the strains analyzed in this study were shown to produce BoNT/F4 and BoNT/F5 simultaneously, suggesting that strain Af84 is unusual. Finally, these data support a role for the mobility of a bont/F5-carrying plasmid among strains of diverse genomic backgrounds.

  20. BoA ONLY ONE ONLY DREAM

    2012-01-01

    <正>说到韩流先驱者,一定不能不提到BoA,她就像一颗恒星,在夜空中持续发光发热,不仅能让人时时刻刻都看到自己,也为后辈们照出了一条光明的道路。如今的她,已经不能仅仅被称作偶像,她已经是个能够给我们带来洗涤灵魂的音乐的专业歌者。BoA成功艺人13岁,对于很多人来说只是青春的开始,心智刚开始发育,是接受新鲜事物最快的年纪,也是最可爱的年纪。而这个年纪的BoA已经踏上了舞台,成为了一名歌手。小小年纪就作为SOLO歌手出道,是一件十分需要勇气的事情,而公司的力捧也

  1. SHI induced irradiation effect on Mo/Si interface

    Agarwal, Garima; Agarwal, Shivani; Jain, Rajkumar; Lal, Chhagan; Jain, I.P.; Kabiraj, D.; Pandey, Akhilesh

    2006-01-01

    Present parametric study investigates the characteristics of SHI induced mixed molybdenum silicide film with various ion fluences. The deposition of molybdenum thin films onto the Silicon substrate was performed using e-beam evaporation, while the heavy Au ion irradiation with energy 120 MeV was subsequently applied to form molybdenum silicide. The samples have been characterized by grazing incidence X-ray diffraction (GIXRD) for the identification of phase formation at the interface. Formation of t-Mo 5 Si 3 mixed molybdenum silicide was observed on increasing the ion irradiation fluences. (author)

  2. The Hintermann-Merlini-Baxter-Wu and the infinite-coupling-limit Ashkin-Teller models

    Huang Yuan, E-mail: huangy22@mail.ustc.edu.cn [Hefei National Laboratory for Physical Sciences at Microscale and Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Deng Youjin, E-mail: yjdeng@ustc.edu.cn [Hefei National Laboratory for Physical Sciences at Microscale and Department of Modern Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Jacobsen, Jesper Lykke, E-mail: jacobsen@lpt.ens.fr [Laboratoire de Physique Theorique, Ecole Normale Superieure, 24 rue Lhomond, 75231 Paris (France); Universite Pierre et Marie Curie, 4 place Jussieu, 75252 Paris (France); Salas, Jesus, E-mail: jsalas@math.uc3m.es [Grupo de Modelizacion, Simulacion Numerica y Matematica Industrial, Universidad Carlos III de Madrid, Avda. de la Universidad 30, 28911 Leganes (Spain); Grupo de Teorias de Campos y Fisica Estadistica, Instituto Gregorio Millan, Universidad Carlos III de Madrid, Unidad asociada al IEM-CSIC, Madrid (Spain)

    2013-03-11

    We show how the Hintermann-Merlini-Baxter-Wu model (which is a generalization of the well-known Baxter-Wu model to a general Eulerian triangulation) can be mapped onto a particular infinite-coupling-limit of the Ashkin-Teller model. We work out some mappings among these models, also including the standard and mixed Ashkin-Teller models. Finally, we compute the phase diagram of the infinite-coupling-limit Ashkin-Teller model on the square, triangular, hexagonal, and kagome lattices.

  3. Search for New Physics in SHiP and at future colliders

    AUTHOR|(CDS)2080890; Serra, Nicola; Storaci, Barbara

    2015-01-01

    SHiP is a newly proposed fixed-target experiment at the CERN SPS with the aim of searching for hidden particles that interact very weakly with SM particles. The work presented in this document investigates SHiP's physics reach in the parameter space of the Neutrino Minimal Standard Model ($\

  4. First steps towards geometry optimization for Spectrometer Straw Tracker of SHiP detector

    Solovev, Vladimir

    2017-01-01

    This report contains details of CERN Summer Student project which was performed for SHiP experiment (Search for Hidden Particles). The main aim of the project is optimization of Spectrometer Straw Tracker (SST) geometry implemented in FairSHiP simulation program.

  5. Interaction and conflict between Sufism and Shi`ism during Safavid era

    E Naghibi

    2017-10-01

    Full Text Available 14th century was considered as the conciliation of Imami Shi`ism and Sufism. But, the relation at the beginning of Safavid dynasty developed to the extent that concepts such as guardianship in a mixture of Shi’ite and Sufi themes made the situation prone to political functions. Imami Shi`ism became official for the first time by Safavids however, their reliance on the support of Turkmen to acquire power urged them to make Sufism superior to Shi`ism. Thus, Ghezelbash people representing Sufism depicted a great kinglike image of the Absent Imam which did not comply with religion and was against the claim of jurists. The perspective did not remain stable after Safavid dynasty was completely established. The idea was in conflict with the interests of the ruling authority, so Safavid rulers turned to Shi`ism from Sufism. The issue not only made Shi`ism and jurists superior to Sufism but also caused Shi`ites confront Sufism for several centuries. The aim of the present article is to investigate the process of peace and conflict between Sufism and Shi`ism during Safavid dynasty.

  6. Social surrogacy and adjustment: exploring the correlates of having a "social helper" for shy and non-shy young adolescents.

    Markovic, Andrea; Bowker, Julie C

    2015-01-01

    A social surrogate is an individual who offers help and comfort in social situations or makes social events more exciting. In this study of 157 young adolescents (55% female; Mage = 13.84 years, SD = 0.75 years), the authors examined whether the linear and curvilinear associations between self-reported social surrogate use and adjustment outcomes (social problems, loneliness, anxiety symptoms, depressive symptoms) varied as a function of shyness and gender, after accounting for the effects of positive friendship quality. Regression analyses revealed that low and high levels of social surrogate use were related to greater social problems for all adolescents. In addition, shyness emerged as a moderator for several curvilinear effects. Specifically, results indicated that (a) high levels of social surrogate use were associated with greater anxiety for adolescents high in shyness; and (b) low levels of social surrogate use were associated with greater depressive symptoms for adolescents low in shyness. Findings highlight the developmental importance of specific types of relationship experiences during early adolescence and point to different implications of social surrogate use for shy and non-shy young adolescents.

  7. Poenostavljen sistem za samodejno bočno parkiranje

    ŠTROS, MATIC

    2014-01-01

    Diplomsko delo prikazuje poenostavljen sistem bočnega parkiranja na modelu vozila. Sistemi za bočno parkiranje se že pojavljajo v avtomobilski industriji in so zmožni detekcije praznega parkirnega mesta ter vožnje v parkirni prostor. Prednost takega sistema, vgrajenega v vozilo, je v tem, da lajša bočno parkiranje, ki ga mnogi neizkušeni vozniki ne obvladajo.

  8. On the de Rham–Wu decomposition for Riemannian and Lorentzian manifolds

    Galaev, Anton S

    2014-01-01

    It is explained how to find the de Rham decomposition of a Riemannian manifold and the Wu decomposition of a Lorentzian manifold. For that it is enough to find parallel symmetric bilinear forms on the manifold, and do some linear algebra. This result will allow to compute the connected holonomy group of an arbitrary Riemannian or Lorentzian manifold. (paper)

  9. Rap and Resistance: A Social Movement of the Wu-Tang Clan.

    Chasteen, Amy L.; Shriver, Thomas

    1998-01-01

    Examines specific collective identity and political expression of the rap group the Wu-Tang Clan. Reveals a multi-layered political strategy that has been conscientiously designed and implemented to instigate a social movement. Prioritizes the voices of marginalized Black peoples and provides raw narratives about oppression. (MMU)

  10. Analysing the Wu metric on a class of eggs in Cn–II

    Home; Journals; Proceedings – Mathematical Sciences; Volume 127; Issue 3. Analysing the Wu metric on a class of eggs in C C n – I I .... G P BALAKUMAR1 PRACHI MAHAJAN2. Indian Statistical Institute, Chennai 600 113, India; Department of Mathematics, Indian Institute of Technology – Bombay, Mumbai 400 076, India ...

  11. Analysing the Wu metric on a class of eggs in ℂn – I

    G P BALAKUMAR

    An explicit description of the Wu metric on the Thullen domains (these are also ..... K(p,v), when p varies across Z. It suffices to focus attention on the case when p varies ... Substituting this into (6.3) and dividing throughout by ˜t2| ˆw|2p2. 1.

  12. Strength-based Supervision: Frameworks, Current Practice, and Future Directions A Wu-wei Method.

    Edwards, Jeffrey K.; Chen, Mei-Whei

    1999-01-01

    Discusses a method of counseling supervision similar to the wu-wei practice in Zen and Taoism. Suggests that this strength-based method and an understanding of isomorphy in supervisory relationships are the preferred practice for the supervision of family counselors. States that this model of supervision potentiates the person-of-the-counselor.…

  13. Investigation of the Livengood–Wu integral for modelling autoignition in a high-pressure bomb

    Hu, Zhixin; Somers, Bart L.M.T.; Cracknell, Roger F.; Bradley, Derek

    2016-01-01

    The reaction progress variable, which is widely used in premixed and diffusion combustion studies, comprises a set of pre-selected intermediate species to denote reaction progress. Progress towards autoignition can also be traced by the Livengood–Wu (LW) integral. Autoignition occurs when the LW

  14. La journée de Bo

    Treille, Daniel

    2014-01-01

    Après le départ de ses collègues, retournés à l’Institut, Bo se retrouve seul dans l’Observatoire, installé à très haute altitude dans un cadre grandiose, quelque part en Asie centrale, maître d’un stupéfiant champ d’antennes tournées vers le cosmos, qui scrutent l’espace à la recherche des premières sources de lumière de l’univers. Il a alors tout loisir de donner libre cours à ses pensées, laissant vagabonder son esprit au fil des événements qui l’ont amené là et des impressions qu’il retrouve. Daniel Treille nous propose de l’accompagner le temps d’une journée de travail, qui commence comme d'autres, mais va s’achever d'une manière bien singulière. Mêlant souvenirs personnels, expériences de sa vie professionnelle et regards sur le monde actuel, sa méditation prend aussi et surtout la forme d’une réflexion sur la modernité technologique, la science, la transmission du savoir, sur fond d’observations géopolitiques, faisant ainsi de La Journée de Bo u...

  15. Botulinum toxin (BoNT) and back pain.

    Porta, Mauro; Maggioni, G

    2004-02-01

    Myofascial pain syndrome is defined as subacute or chronic pain with sensory, motor and autonomic symptoms referred from active trigger points with associated painful dysfunctions. Authors present the usefulness of botulinum toxin A or B (BoNT/A or BoNT/B) injected into target muscles since the toxin is capable of controlling not only the muscular spasm but mostly the pain by alternative mechanisms of action, which are discussed. Posology of BoNT, technical aspects and results are presented. BoNT represents an interesting and useful tool for an adequate management of patients with myofascial pain.

  16. Synthetic lipophilic antioxidant BO-653 suppresses HCV replication.

    Yasui, Fumihiko; Sudoh, Masayuki; Arai, Masaaki; Kohara, Michinori

    2013-02-01

    The influence of the intracellular redox state on the hepatitis C virus (HCV) life cycle is poorly understood. This study demonstrated the anti-HCV activity of 2,3-dihydro-5-hydroxy-2,2-dipentyl-4,6-di-tert-butylbenzofuran (BO-653), a synthetic lipophilic antioxidant, and examined whether BO-653's antioxidant activity is integral to its anti-HCV activity. The anti-HCV activity of BO-653 was investigated in HuH-7 cells bearing an HCV subgenomic replicon (FLR3-1 cells) and in HuH-7 cells infected persistently with HCV (RMT-tri cells). BO-653 inhibition of HCV replication was also compared with that of several hydrophilic and lipophilic antioxidants. BO-653 suppressed HCV replication in FLR3-1 and RMT-tri cells in a concentration-dependent manner. The lipophilic antioxidants had stronger anti-HCV activities than the hydrophilic antioxidants, and BO-653 displayed the strongest anti-HCV activity of all the antioxidants examined. Therefore, the anti-HCV activity of BO-653 was examined in chimeric mice harboring human hepatocytes infected with HCV. The combination treatment of BO-653 and polyethylene glycol-conjugated interferon-α (PEG-IFN) decreased serum HCV RNA titer more than that seen with PEG-IFN alone. These findings suggest that both the lipophilic property and the antioxidant activity of BO-653 play an important role in the inhibition of HCV replication. Copyright © 2012 Wiley Periodicals, Inc.

  17. Search for hidden particles with the SHiP experiment

    Hagner, Caren; Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    Many theories beyond the standard model predict long lived neutral (hidden) particles. There might be a whole Hidden Sector (HS) of weakly interacting particles, which cannot be detected in existing high energy experiments. The SHiP experiment (Search for Hidden Particles) requires a high intensity beam dump, which could be realized by a new facility at the CERN SPS accelerator. New superweakly interacting particles with masses below O(10) GeV could be produced in the beam dump and detected in a general purpose Hidden Sector (HS) detector. In addition there will be a dedicated tau neutrino subdetector. I present the major requirements and technical challenges for the HS detector and discuss how the HS can be accessed through several portals: neutrino portal, scalar portal, vector portal and many more.

  18. The computer-assisted interview In My Shoes can benefit shy preschool children's communication

    Salari, Raziye; Eriksson, Maria; Sarkadi, Anna

    2017-01-01

    Interviewing children is a cognitively, socially, and emotionally challenging situation, especially for young and shy children. Thus, finding methods that aid rapport and increase these children’s communication is important. The present study investigated whether children’s verbal and non-verbal communicative behavior developed differently during the rapport phase, depending on whether children were situationally shy or not, and whether the interview was conducted using the computer-assisted interview In My Shoes (IMS) or a Standard verbal interview. The sample consisted of 60 children aged 4 to 5-years-old. The results showed that for the shy children in the IMS group their talkativeness increased and their answer latency decreased including the amount of encouragement the child needed to talk, while no changes were observed for the shy children in the Standard verbal interview group. There were no significant differences in the non-verbal behavior for the shy children regardless of the interview method used. For the non-shy children, overall, the interview method did not affect either the verbal or the non-verbal outcomes. Our findings indicate that IMS can be a useful tool during the rapport-building phase with shy children as it helps these children to improve their verbal communication. PMID:28813534

  19. Revolution, Modernity and (Trans)National Shi`i Islam: Rethinking Religious Conversion in Senegal.

    Leichtman, Mara A

    2009-07-01

    The establishment of a Shi`i Islamic network in Senegal is one alternative to following the country's dominant Sufi orders. I examine Senegalese conversion narratives and the central role played by the Iranian Revolution, contextualizing life stories (trans)nationally in Senegal's political economy and global networks with Iran and Lebanon. Converts localize foreign religious ideologies into a 'national' Islam through the discourse that Shi`i education can bring peace and economic development to Senegal. Senegalese Shi`a perceive that proselytizing, media technologies, and Muslim networking can lead to social, cultural and perhaps even political change through translating the Iranian Revolution into a non-violent reform movement.

  20. Mellin-Barnes regularization, Borel summation and the Bender-Wu asymptotics for the anharmonic oscillator

    Kowalenko, V.; Rawlinson, A.A.

    1998-01-01

    We introduce the numerical technique of Mellin-Barnes regularization, which can be used to evaluate both convergent and divergent series. The technique is shown to be numerically equivalent to the corresponding results obtained by Borel summation. Both techniques are then applied to the Bender-Wu formula, which represents an asymptotic expansion for the energy levels of the anharmonic oscillator. We find that this formula is unable to give accurate values for the ground state energy, particularly when the coupling is greater than 0.1. As a consequence, the inability of the Bender-Wu formula to yield exact values for the energy level of the anharmonic oscillator cannot be attributed to its asymptotic nature. (authors)

  1. The complete mitochondrial genome of a stonefly species, Kamimuria chungnanshana Wu, 1948 (Plecoptera: Perlidae).

    Wang, Kai; Ding, Shuangmei; Yang, Ding

    2016-09-01

    This study determined the complete mitochondrial (mt) genome of the stonefly, Kamimuria chungnanshana Wu, 1948. The mt genome is 15, 943 bp in size and contains 37 canonical genes which include 22 transfer RNA genes, 13 protein-coding genes, and two ribosomal RNA genes, the control region is 1062 bp in length. The phylogenetic tree shows that Kamimuria chungnanshana is sister group of Kamimuria wangi.

  2. Madame Wu Chien-Shiung the first lady of physics research

    Chiang, Tsai-Chien

    2014-01-01

    Narrating the well-lived life of the "Chinese Madame Curie" - a recipient of the first Wolf Prize in Physics (1978), the first woman to receive an honorary doctorate from Princeton University, as well as the first female president of the American Physics Society - this book provides a comprehensive and honest account of the life of Dr. Chien-Shiung Wu, an outstanding and leading experimental physicist of the 20th century.

  3. Muon-flux measurements for SHiP at H4

    van Herwijnen, E

    2017-01-01

    A major concern for the design of the SHiP experiment is the lack of a precise knowledge of the muon flux. This is a proposal to measure the expected muon flux in the SHiP experiment by installing a replica of the SHiP target in a 400 GeV/c proton beam at H4. We intend building a spectrometer using the drift tube prototypes that were constructed for OPERA. A muon tagger will be built using RPCs, which will also serve as a module-0 for SHiP. We propose to do this measurement in early 2018. Accumulating $\\sim 10^{11}$ 400 GeV/c POT will enable us to make a more realistic design of the muon shield. With some modifications, this setup can also be used to measure the charm cross section (including the cascade production). We intend to test this setup after the measurement of the muon flux.

  4. The Best Friendships of Shy/Withdrawn Children: Prevalence, Stability, and Relationship Quality

    Rubin, Kenneth H.; Wojslawowicz, Julie C.; Rose-Krasnor, Linda; Booth-LaForce, Cathryn; Burgess, Kim B.

    2013-01-01

    The mutual best friendships of shy/withdrawn and control children were examined for prevalence, stability, best friend’s characteristics, and friendship quality. Using peer nominations of shy/socially withdrawn and aggressive behaviors, two groups of children were identified from a normative sample of fifth-grade children: shy/withdrawn (n = 169) and control (nonaggressive/nonwithdrawn; n = 163). Friendship nominations, teacher reports, and friendship quality data were gathered. Results revealed that shy/withdrawn children were as likely as control children to have mutual stable best friendships. Withdrawn children’s friends were more withdrawn and victimized than were the control children’s best friends; further, similarities in social withdrawal and peer victimization were revealed for withdrawn children and their friends. Withdrawn children and their friends reported lower friendship quality than did control children. Results highlight the importance of both quantitative and qualitative measures of friendship when considering relationships as risk and/or protective factors. PMID:16485175

  5. Why I Am Not SHY: A Reply to Tononi and Cirelli

    Marcos Gabriel Frank

    2013-01-01

    Full Text Available In a recent article I reviewed an influential theory of sleep function, the “synaptic homeostasis hypothesis (SHY.” According to SHY, sleep renormalizes synapses that are potentiated during prior wakefulness. I concluded that while SHY is a seminal theory with important implications about sleep function and the brain, its underlying mechanisms are poorly defined. In an accompanying article, the authors of SHY responded at length. Their reply is thoughtful and provocative, but unfortunately many of the points I raised were not accurately represented or addressed. In this brief commentary, I attempt to clarify some points of confusion. I also explain why any theory of sleep function is incomplete without an understanding of the underlying cellular mechanisms.

  6. Sensitivity of the SHiP experiment to a light scalar particle mixing with the Higgs

    Lanfranchi, Gaia

    2017-01-01

    This conceptual study shows the ultimate sensitivity of the SHiP experiment for the search of a light scalar particle mixing with the Higgs for a dataset corresponding to 5-years of SHiP operation at a nominal intensity of 4 1013 protons on target per second. The sensitivity as a function of the length of the vessel and of its distance from the target as well as a function of the background contamination is also studied.

  7. Neutrino scattering physics with the SHiP Experiment

    AUTHOR|(CDS)2083090

    2015-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  8. The SHiP experiment at CERN SPS

    Di Crescenzoon, A

    2016-01-01

    SHiP is a new general purpose fixed target facility, whose Technical Proposal has been recently submitted to the CERN SPS Committee. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2 × 1020 pot in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c2. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. Another dedicated detector, based on the Emulsion Cloud Chamber technology already used in the OPERA experiment, will allow to perform for the first time measurements of the tau neutrino deep inelastic scattering cross section. Tau neutrinos will be distinguished from tau anti-neutrinos, thus providing the first observation of the tau anti-neutrino.

  9. Neutrino scattering physics with the SHiP Experiment

    Di Crescenzo, Antonia

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase the 400 GeV protons beam will be dumped on a heavy target with the aim of integrating $2 \\times 10^{20}$ pot in five years. A dedicated detector downstream the target will allow to probe a variety of models with the light long-lived exotic particles and masses below O(10) GeV/c2. Another dedicated detector will allow the study of active neutrino cross-sections and angular distributions. In particular, the neutrino deep-inelastic cross-sections will be performed with a statistics 1000 times larger than currently available, with the extraction of the F4 and F5 structure functions, never measured so far. Tau neutrinos will be distinguished by anti-neutrinos, thus providing the first observation of the tau anti-neutrino. With muon neutrinos it will be possible to study the strangeness content of the nucleon.

  10. Neutrino physics with the SHiP experiment

    AUTHOR|(SzGeCERN)759942

    2015-01-01

    Despite the Standard Model (SM) has been strongly confirmed by the Higgs discovery, several experimental facts are still not explained. The SHiP experiment (Search for Hidden Particles), a beam dump experiment at CERN, aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles of the GeV mass scale, foreseen in many extensions of the SM, might come from the decay of charmed hadrons produced in the collision of a 400 GeV proton beam on a target. High rates of all the three active neutrinos are also expected. For the first time the properties and the cross section of the ντ will be studied thanks to a detector based on nuclear emulsions, with the micrometric resolution needed to identify the tau lepton produced in neutrino interactions. Measuring the charge of the tau daughters, will enable the first observation of the ν ̄τ and the study of its cross section.

  11. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Shiuan-Pey Lin

    2011-01-01

    Full Text Available Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp. The results showed that Zhi Shi significantly decreased the Cmax⁡ and AUC0-t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection.

  12. Different Influences on Tacrolimus Pharmacokinetics by Coadministrations of Zhi Ke and Zhi Shi in Rats

    Lin, Shiuan-Pey; Wu, Ping-Ping; Hou, Yu-Chi; Tsai, Shang-Yuan; Wang, Meng-Ju; Fang, Shih-Hua; Chao, Pei-Dawn Lee

    2011-01-01

    Tacrolimus, an immunosuppressant with narrow therapeutic window, has been used widely in transplant patients. Grapefruit juice and pomelo have been reported to increase the blood levels of tacrolimus. Zhi Ke and Zhi Shi, the ripe peels and unripe fruits of Citrus aurantium which is chemotaxonomically related to grapefruit and pomelo, are in wide use in clinical Chinese medicine. To investigate the possible interaction of these two Citrus herbs with tacrolimus, male Sprague-Dawley rats were orally given tacrolimus (1.5 mg/kg) with and without Zhi Ke and Zhi Shi decoctions in a cross-over design. Blood samples were withdrawn via cardiopuncture at specific time and quantitated by a microparticle enzyme immunoassay. In addition, to explore the mechanism of interaction, LS 180 cell line was used for the transport study of rhodamine 123, a typical substrate of P-glycoprotein (P-gp). The results showed that Zhi Shi significantly decreased the C max and AUC0−t of tacrolimus by 72.4% and 72.0%, respectively, whereas Zhi Ke did not affect tacrolimus pharmacokinetics. LS 180 cell line study indicated that Zhi Shi increased the efflux activity of P-gp, enabling us to explain the decreased oral bioavailability of tacrolimus caused by Zhi Shi. Hence, we suggest that Zhi Shi be contraindicated for transplant patients treated with tacrolimus to reduce the risk of allograft rejection. PMID:21318106

  13. Nonempirical calculations of the LiBO molecule

    Nemukhin, A.V.; Stepanov, N.F.

    1987-01-01

    Problems of nonempirical calculations of molecule energies, related to the use of limited basis AO set and configurations were considered taking the LiBO molecule as an example. The version of optimizing parameters of basis functions of the base of the concept of ''atoms in molecules'' was suggested. It is shown that correct description of the potential surface of LiBO molecule is impossible without consideration of electron correlation; main contributions to correlation corrections were distinguished

  14. Phylogeography of Sophora moorcroftiana Supports Wu's Hypothesis on the Origin of Tibetan Alpine Flora.

    Cheng, Shanmei; Qiong, La; Lu, Fan; Yonezawa, Takahiro; Yin, Ganqiang; Song, Zhiping; Wang, Yuguo; Yang, Ji; Zhang, Wenju

    2017-06-01

    Wu hypothesized that the Tibetan flora originated mostly from the paleotropical Tertiary flora in the Hengduan Mountains by adapting to the cold and arid environments associated with the strong uplift of the Qinghai-Tibet Plateau (QTP). Here, we combine the phylogeographic history of Sophora moorcroftiana with that of Sophora davidii to explore the speciation of S. moorcroftiana to test this hypothesis. We collected 151 individuals from 17 populations and sequenced 2 chloroplast fragments and the internal transcribed spacer of rDNA. Five chlorotypes and 9 ribotypes were detected but no significant phylogeographic structure was revealed. The integrated results of phylogeographic studies of these 2 species clearly support the progenitor-derivative relationship between them. We infer that the western peripheral population of S. davidii migrated westwards from the Hengduan Mountains to the middle reaches of the Yarlung Zangbo River and differentiated from its ancestor in the process of adaptation to increasingly cold and arid environments with the uplift of the QTP and finally evolved into S. moorcroftiana during the Late Pliocene. In addition, our findings shed light on the idea that natural selection, as imposed by climate differentiation (especially mean diurnal range and precipitation seasonality), directly drove this peripatric speciation event after geographic isolation. The speciation of S. moorcroftiana is a strong case supporting Wu's hypothesis about the origin of Tibet's flora. © The American Genetic Association 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  15. Effects of electroacupuncture and electroacupuncture plus Tao Hong Si Wu Wan in treating primary dysmenorrhea.

    Miao, Edwin Yong; Miao, Miranda Yi-mo; Kildea, Daniel George; Lao, Yi-Wen

    2014-02-01

    This study investigated the efficacies of electroacupuncture and electroacupuncture combined with Tao Hong Si Wu Wan in treating primary dysmenorrhea and compared the results with those obtained using conventional medical treatment. One treatment group, group 1, was administered Tao Hong Si Wu Wan (2625 mg) while the other, group 2, was administered a placebo (2625 mg) twice daily for 3 months. Electroacupuncture was used in both treatment groups: two sessions per menstrual cycle for three menstrual cycles. The reference group, group 3, was administered ibuprofen, 600 mg, twice daily, for five menstrual cycles. Uses of the herb, placebo and ibuprofen were blinded. A ridit analysis was used for testing and interpreting the effects of treatment. Pain intensity was determined using a qualitative grading method in a blinded manner. The ridit scores in groups 1 and 2 were significantly higher than those in reference group immediately after treatment and three months later. Twelve months after the treatment, group 1 had a higher ridit score than group 2. In comparison to the reference group, groups 1 and 2 achieved better menstrual pain relief both immediately and 3 months after treatment. In addition, group 1 had better long-term pain relief than group 2. Copyright © 2014. Published by Elsevier B.V.

  16. Ignition delay time correlation of fuel blends based on Livengood-Wu description

    Khaled, Fathi

    2017-08-17

    In this work, a universal methodology for ignition delay time (IDT) correlation of multicomponent fuel mixtures is reported. The method is applicable over wide ranges of temperatures, pressures, and equivalence ratios. n-Heptane, iso-octane, toluene, ethanol and their blends are investigated in this study because of their relevance to gasoline surrogate formulation. The proposed methodology combines benefits from the Livengood-Wu integral, the cool flame characteristics and the Arrhenius behavior of the high-temperature ignition delay time to suggest a simple and comprehensive formulation for correlating the ignition delay times of pure components and blends. The IDTs of fuel blends usually have complex dependences on temperature, pressure, equivalence ratio and composition of the blend. The Livengood-Wu integral is applied here to relate the NTC region and the cool flame phenomenon. The integral is further extended to obtain a relation between the IDTs of fuel blends and pure components. Ignition delay times calculated using the proposed methodology are in excellent agreement with those simulated using a detailed chemical kinetic model for n-heptane, iso-octane, toluene, ethanol and blends of these components. Finally, very good agreement is also observed for combustion phasing in homogeneous charge compression ignition (HCCI) predictions between simulations performed with detailed chemistry and calculations using the developed ignition delay correlation.

  17. [Contribution of Professor SHI Xue-min's academic thoughts to treatment of stroke].

    Liu, Jian; Fan, Xiao-Nong; Wang, Shu

    2014-01-01

    Based on the thought of Zhishen (a kind of mind regulation), Professor SHI Xue-min, academician of the China Academy of Engineering, found the Xingnao Kaiqiao (to refresh the mind and to cause resuscitation) acupuncture method, which still plays an important role in the acupuncture treatment of wind stroke nowadays. Meanwhile, great importance is attached to the comprehensive treatment of wind stroke. Danqi Piantan capsule (see text) is developed and "wind stroke unit" is set up. In recent years, Professor SHI shifts the center of research to the treatment of hypertension, the risk factor of wind stroke. Taking Renying (ST 9) as the major acupoint, acupuncture with standard measurement and manipulations is established. And good clinical effect has been obtained as well. Therefore, this article focuses on the introduction of Professor SHI Xue-min's contribution to wind stroke treatment.

  18. The SPS beam parameters, the operational cycle, and proton sharing with the SHiP facility

    Arduini, Gianluigi; Gatignon, Lau; Cornelis, Karel

    2015-01-01

    The SHiP experiment aims at acquiring a total of 4×1019 protons on target per year. Based on demonstrated SPS performance for CNGS, the expected proton sharing between the TCC2 targets and SHiP is estimated taking into account the constraints in the super-cycle composition. We review the SPS beam parameters, the operational cycles taking into account the concurrent operation of the SPS as LHC injector and for the TCC2 experiments and the limitations on the maximum possible power dissipation and the expected sharing of the protons on target of the SHiP facility with the TCC2 targets. As a typical example this aim could be achieved while maintaining a duty cycle for the other fixed target experiments of about 18%.

  19. TianShuiShi space breeding current situation and developing trend

    Wang Fuquan; Song Jianrong; Zhang Zhongping; Guo Zhenfang

    2011-01-01

    TianShuiShi is located in xian to lanzhou among two big cities, the five space launch, has vegetables, food, grasses, flowers, rape, melon and fruit, Chinese traditional medicine, amount of 8 categories of crops, such as the 22 new material after carrying the ground breeding work. Only vegetables on identified 23 aerospace new varieties. After ten years of space breeding, summarizes the present situation of TianShuiShi space breeding, development experience, characteristic, trends, and puts forward the development space breeding TianShuiShi organization and breeding of talent from the matching policy and grow up incentive mechanism, strengthen the cooperation and all over the country, establishing fiscal policy support from the aspects such as advice. (authors)

  20. Spontaneous hemoperitoneum in pregnancy (SHiP) and endometriosis - A systematic review of the recent literature.

    Lier, Marit C I; Malik, Romana F; Ket, Johannes C F; Lambalk, Cornelis B; Brosens, Ivo A; Mijatovic, Velja

    2017-12-01

    Spontaneous Hemoperitoneum in Pregnancy (SHiP), an unprovoked (nontraumatic) intraperitoneal bleeding in pregnancy (up to 42days postpartum), is associated with serious adverse pregnancy outcomes. To evaluate the clinical consequences of SHiP and its association with endometriosis, a systematic review was conducted according to the PRISMA guidelines. PubMed, Embase.com and Thomson Reuters/Web of Science were searched for articles published since the latest review (August 2008) until September 2016. After assessment for eligibility, forty-four articles were included in this systematic review, describing 59 cases of SHiP. Endometriosis was present in 33/59 cases (55.9%), most often diagnosed prior to pregnancy. An association between the severity of SHiP and the stage of endometriosis could not be found. In the majority of cases, SHiP occurred in the third trimester of pregnancy (30/59 cases (50.8%)); women presented with (sub)acute abdominal pain (56/59 cases (94.9%)), hypovolemic shock (28/59 cases (47.5%)) and/or a decreased level of hemoglobin (37/59 cases (62.7%)). Signs of fetal distress were observed in 24/59 cases (40.7%). Imaging confirmed free peritoneal fluid in (37/59 cases (62.7%)). At time of surgery active bleeding was revealed in 51/56 cases (91,1%), originating from endometriotic implants (11/51 cases (21.6%)), ruptured utero-ovarian vessels (29/51 cases (56.8%)), hemorrhagic nodules of decidualized cells (1/51 cases (2.0%)) or a combination (10/51 cases (19.6%)). Median amount of hemoperitoneum was 1600mL (IQR 1000mL-2500mL). From the 45/59 cases (76.3%) in which surgical interventions was carried out during pregnancy, 7/45 cases (15.6%) reported a successful continuation of pregnancy. 5/59 cases reported recurrence of SHiP (recurrence rate 8.5%). The perinatal mortality rate was 26.9% (18/67 fetus), one maternal death was reported (1/59 cases (1,7%)). In conclusion, SHiP is a very serious complication of pregnancy, highly associated with adverse

  1. Preliminary Evaluation of a Social Skills Training and Facilitated Play Early Intervention Programme for Extremely Shy Young Children in China

    Li, Yan; Coplan, Robert J.; Wang, Yuemin; Yin, Jingtong; Zhu, Jingjing; Gao, Zhuqing; Li, Linhui

    2016-01-01

    The goal of this study was to provide a preliminary evaluation of a social skills and facilitated play early intervention programme to promote social interaction, prosocial behaviours and socio-communicative skills among young extremely shy children in China. Participants were a sample of n = 16 extremely shy young children attending kindergarten…

  2. Transparência: Bacen versus BoE

    Eduardo de Carvalho Andrade

    2005-12-01

    Full Text Available Transparency: Bacen versus BoE. The aim of this paper is to compare the degree of transparency of the Brazilian Central Bank (Bacen with the one verified in the Bank of England (BoE. In order to accomplish this objective, an indicator of transparency is built based on the information that each central bank provides to the public about its monetary policy, its expectation about the future of the economy, its intervention in the financial market, and if there are clear limits and restrictions to the release of information to the general public. The analysis suggests that the Bacen is less transparent and has a less individualistic Monetary Policy Committee in comparison with the BoE. Moreover, it indicates some procedures that could be adopted by the Bacen in order to make its monetary policy more transparent.

  3. Orbinia wui, a new species from China, with redescription of O. dicrochaeta Wu, 1962 (Annelida, Orbiniidae).

    Sun, Yue; Li, Xinzheng

    2018-04-04

    Two species of the genus Orbinia Quatrefages, 1865 are described including Orbinia dicrochaeta Wu, 1962 and Orbinia wui sp. n. The new species can easily be identified from other species in the genus by a combination of characters: branchiae first present from chaetiger 5, thoracic region with 14-16 chaetigers; first six thoracic neuropodia with 4-5 rows of uncini, with the last row short and curving ventral to anterior rows; subsequent thoracic neuropodia with four rows of subuluncini and one short row of uncini, arranged more densely than anterior chaetigers; both uncini and subuluncini surrounded by long sheath all of its length on concave side, sheath with developed transverse rows of barbs. This study suggests that the species of Orbinia may be divided into two groups. A taxonomic key and comparative table to all species of Orbinia is provided.

  4. Prof. Wu Xiaoqiu:China Is Striving for the World's Most Developed Capital Market

    Sun Yongjian; Zhang Yue

    2007-01-01

    @@ China's capital market is a hot issue in the new year. The best strategy to develop the Chinese capital market in the coming 15 to 20 years was discussed in the China Capital Market Forum, which was held in China at Renmin University on January 13. Government officials, scholars, and entrepreneurs commented that by 2020, the Chinese capital market will develop into one of the best capital markets in the world,not only in terms of size, but also asset quality, liquidity and dynamic trade. Is this a realistic goal? What steps should we take to pursue this target? With these questions in mind, after the forum, China's Foreign Trade interviewed Prof. Wu Xiaoqiu, Vice President of Renmin University of China,and the Director of the Finance & Securities Institute of Renmin University.

  5. Defining According to Its Essence: An Analysis on the Concept of Tong Shi Education (General Education) in the Native Chinese Context

    Lu, Yi; Xu, Yuan

    2018-01-01

    The authors review the concept of Tong Shi (Chinese characters omitted) in ancient Chinese philosophical texts, illustrate the Chinese cultural attributes unique to the characters Tong and Shi, and confirm that the name and essence of Tong Shi Education has a clear directivity and irreplaceable coverage to university general education in…

  6. Etude linguistique chez les Baráshi/Banyaambo du Rwanda ...

    Among the main African Languages spoken in Rwanda besides Kinyarwaanda: amashí in the South, olucigá in the North and ikiráshi/ikinyaambo in the East, only olucigá has been particularly described: J.-B. Murekezi (1984), F.-X. Bangamwabo (1989); others are just mentioned in global sociolinguistic studies: B.

  7. Interface reactions between Pd thin films and SiC by thermal annealing and SHI irradiation

    Njoroge, E.G., E-mail: eric.njoroge@up.ac.za [Department of Physics, University of Pretoria, Pretoria (South Africa); Theron, C.C. [Department of Physics, University of Pretoria, Pretoria (South Africa); Skuratov, V.A. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Wamwangi, D. [School of Physics, University of Witwatersrand, Johannesburg (South Africa); Hlatshwayo, T.T. [Department of Physics, University of Pretoria, Pretoria (South Africa); Comrie, C.M. [MRD, iThemba LABS, P.O. Box 722, Somerset West 7129 (South Africa); Malherbe, J.B. [Department of Physics, University of Pretoria, Pretoria (South Africa)

    2016-03-15

    The solid-state reactions between Pd thin films and 6H-SiC substrates induced by thermal annealing, room temperature swift heavy ion (SHI) irradiation and high temperature SHI irradiation have been investigated by in situ and real-time Rutherford backscattering spectrometry (RBS) and Grazing incidence X-ray diffraction (GIXRD). At room temperature, no silicides were detected to have formed in the Pd/SiC samples. Two reaction growth zones were observed in the samples annealed in situ and analysed by real time RBS. The initial reaction growth region led to formation of Pd{sub 3}Si or (Pd{sub 2}Si + Pd{sub 4}Si) as the initial phase(s) to form at a temperature of about 450 °C. Thereafter, the reaction zone did not change until a temperature of 640 °C was attained where Pd{sub 2}Si was observed to form in the reaction zone. Kinetic analysis of the initial reaction indicates very fast reaction rates of about 1.55 × 10{sup 15} at cm{sup −2}/s and the Pd silicide formed grew linear with time. SHI irradiation of the Pd/SiC samples was performed by 167 MeV Xe{sup 26+} ions at room temperature at high fluences of 1.07 × 10{sup 14} and 4 × 10{sup 14} ions/cm{sup 2} and at 400 °C at lower fluences of 5 × 10{sup 13} ions/cm{sup 2}. The Pd/SiC interface was analysed by RBS and no SHI induced diffusion was observed for room temperature irradiations. The sample irradiated at 400 °C, SHI induced diffusion was observed to occur accompanied with the formation of Pd{sub 4}Si, Pd{sub 9}Si{sub 2} and Pd{sub 5}Si phases which were identified by GIXRD analysis.

  8. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants.

    M Ashraful Islam

    Full Text Available Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants with desirable height and reduce the utilization of growth retardants, the Arabidopsis SHORT INTERNODE (AtSHI gene controlled by the cauliflower mosaic virus 35S promoter was introduced into poinsettia by Agrobacterium-mediated transformation. Three independent transgenic lines were produced and stable integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21-52% and internode lengths (31-49% were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed transgenic line (TL1. The indole-3-acetic acid (IAA content appeared lower (11-31% reduction in the transgenic lines compared to the wild type (WT controls, with the lowest level (31% reduction in TL1. Total internode numbers, bract numbers and bract area were significantly reduced in all transgenic lines in comparison with the WT controls. Only TL1 showed significantly lower plant diameter, total leaf area and total dry weight, whereas none of the AtSHI expressing lines showed altered timing of flower initiation, cyathia abscission or bract necrosis. This study demonstrated that introduction of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that AtSHI gene was overexpressed in poinsettia and transgenic poinsettia plants with compact growth were produced.

  9. Growth and characterization of acentric BaHf(BO{sub 3}){sub 2} and BaZr(BO{sub 3}){sub 2}

    Mączka, Mirosław, E-mail: m.maczka@int.pan.wroc.pl [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Szymborska-Małek, Katarzyna; Gągor, Anna [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Majchrowski, Andrzej [Institute of Applied Physics, Military University of Technology, 2 Kaliskiego Str., 00-908 Warszawa (Poland)

    2015-05-15

    Growth, single crystal X-ray diffraction, polarized Raman and infrared (IR) studies of BaHf(BO{sub 3}){sub 2} are presented. Raman and IR spectra of polycrystalline BaZr(BO{sub 3}){sub 2} are also reported to facilitate assignment of modes. BaHf(BO{sub 3}){sub 2} borate crystallizes in trigonal system, space group R3c, with lattice parameters: a=5.1540(4) Å, c=33.901(3) Å. It accommodates dolomite-like structure doubled in the c direction, which is built of alternating layers of HfO{sub 6} octahedra and BaO{sub 6} distorted trigonal prisms that are connected through borate groups. The obtained structural as well as spectroscopic data show that BaHf(BO{sub 3}){sub 2} is isostructural with BaZr(BO{sub 3}){sub 2} and the deviations from centrosymmetry is small. - Graphical abstract: Arrangement of BO{sub 3} groups in BaHf(BO{sub 3}){sub 2} along the c direction in one unit cell. Dark and light blue denote different borate groups. - Highlights: • BaHf(BO{sub 3}){sub 2} single crystals were grown. • X-ray diffraction showed that this borate crystallizes in the acentric R3c structure. • Raman and IR spectra were measured for BaHf(BO{sub 3}){sub 2} and BaZr(BO{sub 3}){sub 2}, respectively. • Assignment of modes is proposed.

  10. A Response to Professor Wu Zongjie's "Interpretation, Autonomy, and Transformation: Chinese Pedagogic Discourse in a Cross-Cultural Perspective"

    Curran, Thomas D.

    2014-01-01

    In response to an essay by Prof Wu Zongjie that was published in the "Journal of Curriculum Studies" [43(5), (2011), 569-590], I argue that, despite dramatic changes that have taken place in the language of Chinese academic discourse and pedagogy, evidence derived from the fields of psychology and the history of Chinese educational…

  11. 31 july 2014 - H. WU Ambassador Permanent Representative of the People's Republic of China to the United Nations

    Egli, Laurent

    2014-01-01

    His Excellency Mr Hailong WU Ambassador Permanent Representative of the People's Republic of China to the United Nations Office at Geneva and other international organizations in Switzerland visiting the ATLAS cavern with ATLAS Spokesperson D. Charlton and the LHC tunnel at Point 1 with Technology Department, Vacuum, Surfaces and Coatings Group P. Cruikshank.

  12. Role of bovine herpesvirus type 5 (BoHV-5) in diseases of cattle. Recent findings on BoHV-5 association with genital disease

    Favier, P.A.; Marin, M.S.; Pérez, S.E.

    2012-01-01

    Bovine herpesvirus type 5 (BoHV-5) belongs to the family Herpesviridae, subfamily Alphaherpesvirinae, genus Varicellovirus. This virus is a major causative agent of non-suppurative meningoencephalitis in young cattle. It was first isolated in 1962 from a neurological disease outbreak in Australia. BoHV-5 is genetically and antigenically related to bovine herpesvirus type 1 (BoHV-1), a highly prevalent virus responsible for respiratory and genital disease in cattle. Initially, BoHV-5 was considered a subtype of BoHV-1 (BoHV-1.3). However, the exclusive presentation of outbreaks of neurological disease suggested that the virus was a new agent with characteristics of neuropathogenicity. Even though both are neurotropic viruses, only BoHV-5 is capable of replicating extensively in the central nervous system and inducing neurological disease. Occasionally, encephalitis caused by BoHV-1 has been reported. Like other alpha-herpesviruses, BoHV-5 can establish latency in nervous ganglia and, by stress factors or glucocorticoid treatment, latent virus can be reactivated. During episodes of reactivation, the virus is excreted in nasal, ocular and genital secretions and transmitted to other susceptible hosts. Recently, BoHV-5 has been associated with infection of the reproductive tract. The virus has been isolated and the presence of viral DNA has been demonstrated in semen samples from Brazil and Australia and natural transmission of the virus through contaminated semen has also been described. Embryos and oocytes are permissive for BoHV-5 infection and BoHV-5 DNA has been detected in the central nervous system of aborted fetuses. The objective of this review is to compile the limited information on the recent association between BoHV-5 and reproductive disorders in cattle. PMID:26623291

  13. Design of a detector to study associated charm production in the SHiP beam dump facility

    Iuliano, Antonio; Di Crescenzo, Antonia

    A dedicated experiment has been proposed by the SHiP Collaboration, to study associated charm production and decay of charmed hadrons. In this thesis we report the first design of such an experiment. This work has been carried out within the Naples neutrino group that participates to the SHiP experiment. The aim of the experiment designed in this thesis is to measure the differential associated charm production cross sections with respect to the angular and energy spectra of charmed particles. This measurement could give the acceptance of the SHiP detector for hidden particles and tau neutrinos, which are produced from charmed hadron decays.

  14. Why Study Chinese Classics and How to Go about It: Response to Zongjie Wu's "Interpretation, Autonomy, and Transformation--Chinese Pedagogic Discourse in Cross-Cultural Perspective"

    Tan, Sor-Hoon

    2011-01-01

    This response to Zongjie Wu's "Interpretation, autonomy, and interpretation" focuses on the "battle between East and West" which contextualizes Wu's proposal to counter the current Western domination of Chinese pedagogic discourse with an "authentic language" recovered from the Chinese classics. It points out that it…

  15. Dark energy fingerprints in the nonminimal Wu-Yang wormhole structure

    Balakin, Alexander B.; Zayats, Alexei E.

    2014-08-01

    We discuss new exact solutions to nonminimally extended Einstein-Yang-Mills equations describing spherically symmetric static wormholes supported by the gauge field of the Wu-Yang type in a dark energy environment. We focus on the analysis of three types of exact solutions to the gravitational field equations. Solutions of the first type relate to the model, in which the dark energy is anisotropic; i.e., the radial and tangential pressures do not coincide. Solutions of the second type correspond to the isotropic pressure tensor; in particular, we discuss the exact solution, for which the dark energy is characterized by the equation of state for a string gas. Solutions of the third type describe the dark energy model with constant pressure and energy density. For the solutions of the third type, we consider in detail the problem of horizons and find constraints for the parameters of nonminimal coupling and for the constitutive parameters of the dark energy equation of state, which guarantee that the nonminimal wormholes are traversable.

  16. Monte Carlo study of the pure and dilute Baxter-Wu model

    Schreiber, Nir; Adler, Joan

    2005-01-01

    We studied the pure and dilute Baxter-Wu (BW) models using the Wang-Landau (WL) sampling method to calculate the density-of-states (DOS). We first used the exact result for the DOS of the Ising model to test our code. Then we calculated the DOS of the dilute Ising model to obtain a phase diagram, in good agreement with previous studies. We calculated the energy distribution, together with its first, second and fourth moments, to give the specific heat and the energy fourth order cumulant, better known as the Binder parameter, for the pure BW model. For small samples, the energy distribution displayed a doubly peaked shape, and finite size scaling analysis showed the expected reciprocal scaling of the positions of the peaks with L. The energy distribution yielded the expected BW α = 2/3 critical exponent for the specific heat. The Binder parameter minimum appeared to scale with lattice size L with an exponent θ B equal to the specific heat exponent. Its location (temperature) showed a large correction-to-scaling term θ 1 = 0.248 ± 0.025. For the dilute BW model we found a clear crossover to a single peak in the energy distribution even for small sizes and the expected α = 0 was recovered

  17. ν{sub τ}-physics with the SHiP experiment

    Bick, Daniel; Bieschke, Stefan; Ebert, Joachim; Hagner, Caren; Schmidt-Parzefall, Walter [Universitaet Hamburg, Institut fuer Experimentalphysik, Luruper Chaussee 149, 22761 Hamburg (Germany)

    2016-07-01

    SHiP stands for Search for Hidden Particles and is a recently proposed new general-purpose fixed target facility at the SPS at CERN. The main aim is the search for hidden particles predicted by different models capable of explaining dark matter, neutrino masses or the origin of baryon asymmetry in the Universe. Furthermore, a huge number of (τ-)neutrinos will be produced at such a facility making it an ideal place for ν{sub τ}-physics and thus giving the opportunity for a measurement of the τ-neutrino cross-sections or a first-time experimental evidence of the anti-τ-neutrino. This talk will give an overview of the neutrino experiment at the SHiP experiment. An emphasis is given to the reconstruction of muons from interactions in the neutrino target using a magnetic spectrometer.

  18. Overexpression of the AtSHI gene in poinsettia, Euphorbia pulcherrima, results in compact plants

    Islam, M. Ashraful; Lütken, Henrik Vlk; Haugslien, Sissel

    2013-01-01

    of the AtSHI gene into poinsettia by genetic engineering can be an effective approach in controlling plant height without negatively affecting flowering time. This can help to reduce or avoid the use of toxic growth retardants of environmental and human health concern. This is the first report that At......Euphorbia pulcherrima, poinsettia, is a non-food and non-feed vegetatively propagated ornamental plant. Appropriate plant height is one of the most important traits in poinsettia production and is commonly achieved by application of chemical growth retardants. To produce compact poinsettia plants...... integration of transgene was verified by PCR and Southern blot analysis. Reduced plant height (21–52%) and internode lengths (31–49%) were obtained in the transgenic lines compared to control plants. This correlates positively with the AtSHI transcript levels, with the highest levels in the most dwarfed...

  19. Addendum to Technical Proposal: A Facility to Search for Hidden Particles (SHiP) at the CERN SPS

    SHiP Collaboration

    2015-01-01

    With the Technical Proposal submitted to the SPSC committee in April 2015, the SHiP collaboration declared its interest in proceeding towards a Comprehensive Design Study phase with the aim of preparing for the Technical Design Reports pending an approval by the CERN committees. Following the recommendation by the SPSC, it has been decided to complement the TP with this addendum that provides an update of the key aspects for the review of the SHiP project.

  20. Study of nu-tau properties with the SHiP experiment

    AUTHOR|(CDS)2209555

    The SHiP experiment (Search for Hidden Particles) is a beam dump experiment proposed at the CERN SPS with the submission of a Technical Proposal in April 2015. SHiP aims at the observation of long lived particles very weakly coupled with ordinary matter. These particles are mostly produced in the decay of charmed hadrons whose production is therefore enhanced through the definition of the characteristics of both the beam and the proton target. This makes the SHiP experiment a Standard Model neutrino factory too, in particular of tau neutrinos produced by the Ds decay chain. My studies have mainly focused on the design of the neutrino detector and on the evaluation of its performances. The Neutrino Detector is placed in a magnetic field and it exploits the Emulsion Cloud Chamber Technology with the micrometric position resolution needed to disentangle the tau lepton decay vertex from the neutrino interaction vertex. This peculiarity, together with the high electron identification efficiency, makes this det...

  1. Development of a Summarized Health Index (SHI for use in predicting survival in sea turtles.

    Tsung-Hsien Li

    Full Text Available Veterinary care plays an influential role in sea turtle rehabilitation, especially in endangered species. Physiological characteristics, hematological and plasma biochemistry profiles, are useful references for clinical management in animals, especially when animals are during the convalescence period. In this study, these factors associated with sea turtle surviving were analyzed. The blood samples were collected when sea turtles remained alive, and then animals were followed up for surviving status. The results indicated that significantly negative correlation was found between buoyancy disorders (BD and sea turtle surviving (p < 0.05. Furthermore, non-surviving sea turtles had significantly higher levels of aspartate aminotranspherase (AST, creatinine kinase (CK, creatinine and uric acid (UA than surviving sea turtles (all p < 0.05. After further analysis by multiple logistic regression model, only factors of BD, creatinine and UA were included in the equation for calculating summarized health index (SHI for each individual. Through evaluation by receiver operating characteristic (ROC curve, the result indicated that the area under curve was 0.920 ± 0.037, and a cut-off SHI value of 2.5244 showed 80.0% sensitivity and 86.7% specificity in predicting survival. Therefore, the developed SHI could be a useful index to evaluate health status of sea turtles and to improve veterinary care at rehabilitation facilities.

  2. A new species of Nemoura (Plecoptera: Nemouridae) from Jiangsu Province, China, with new illustrations for Nemoura nankinensis Wu.

    Chen, Zhi-Teng; DU, Yu-Zhou

    2017-04-12

    A new species of Nemoura (Plecoptera: Nemouridae), N. fusiformis sp. nov. from Jiangsu Province, China, is described and illustrated. The new species is characterized by a strongly sclerotized large hook formed by outer margin of the outer lobe of the paraproct and by the outer sclerite of cercus with a sub-triangular medial process. The new species is compared with similar taxa. Additionally, supplementary illustrations for N. nankinensis Wu, 1926 are also provided.

  3. PLE-wu, a new member of piggyBac transposon family from insect, is active in mammalian cells.

    Wu, Chunxiao; Wang, Shu

    2014-10-01

    piggyBac, a highly active transposon in insect and mammalian cells, is a very useful tool in genome manipulation. A new piggyBac-like element (PLE), named PLE-wu, was identified from a mutant baculovirus cultured in sf9 insect cells. This new transposon is 2931 bp in length and encodes two active forms of transposase, a 708-amino acid-long transposase and a short 576-residue-long transposase translated from a downstream in-frame initiation codon. PLE-wu has asymmetric terminal structures, containing 6-bp inverted terminal repeats, 32-bp imperfect inverted and direct sub-terminal repeats. Similar to piggyBac, PLE-wu exhibits traceless excision activity in both insect and mammalian cells, restoring the original TTAA target sequence upon excision. It also retains the insertion activity in mammalian cells with a plasmid to chromosome transposition rate about 10-fold higher than random integration. Plasmid rescue assays revealed that the TTAA target sequence was duplicated at the junctions of the insertion site. Deletion of the terminal sequences including the sub-terminal repeats decreased the transposition activity of the 708-residue-long transposase, while the transposition activity of the short form of transposase was not affected. With its low sequence similarity to piggyBac, PLE-wu will contribute to the understanding the mechanism of PLE transposition, as well as design of new transposon systems with higher activity. Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  4. Temperature dependent luminescence Cr3+doped GdAl3(BO3)4 and YAl3(BO3)4

    Malysa, B.; Meijerink, A; Jüstel, Thomas

    Chromium activated YAl3(BO3)4 (YAB) and GdAl3(BO3)4 (GAB) were synthesized and show efficient broad band near infrared emission under excitation in the UV, blue and orange spectral regions. Temperature dependent luminescence measurements for GAB:1%Cr3+ and YAB:1%Cr3+ reveal high quenching

  5. FORTRAN Code for Glandular Dose Calculation in Mammography Using Sobol-Wu Parameters

    Mowlavi A A

    2007-07-01

    Full Text Available Background: Accurate computation of the radiation dose to the breast is essential to mammography. Various the thicknesses of breast, the composition of the breast tissue and other variables affect the optimal breast dose. Furthermore, the glandular fraction, which refers to the composition of the breasts, as partitioned between radiation-sensitive glandular tissue and the adipose tissue, also has an effect on this calculation. Fatty or fibrous breasts would have a lower value for the glandular fraction than dense breasts. Breast tissue composed of half glandular and half adipose tissue would have a glandular fraction in between that of fatty and dense breasts. Therefore, the use of a computational code for average glandular dose calculation in mammography is a more effective means of estimating the dose of radiation, and is accurate and fast. Methods: In the present work, the Sobol-Wu beam quality parameters are used to write a FORTRAN code for glandular dose calculation in molybdenum anode-molybdenum filter (Mo-Mo, molybdenum anode-rhodium filter (Mo-Rh and rhodium anode-rhodium filter (Rh-Rh target-filter combinations in mammograms. The input parameters of code are: tube voltage in kV, half-value layer (HVL of the incident x-ray spectrum in mm, breast thickness in cm (d, and glandular tissue fraction (g. Results: The average glandular dose (AGD variation against the voltage of the mammogram X-ray tube for d = 4 cm, HVL = 0.34 mm Al and g=0.5 for the three filter-target combinations, as well as its variation against the glandular fraction of breast tissue for kV=25, HVL=0.34, and d=4 cm has been calculated. The results related to the average glandular absorbed dose variation against HVL for kV = 28, d=4 cm and g= 0.6 are also presented. The results of this code are in good agreement with those previously reported in the literature. Conclusion: The code developed in this study calculates the glandular dose quickly, and it is complete and

  6. BoA 全盛时代

    2015-01-01

    在准备这次专辑封面拍摄的期间,不仅你自己非常努力,你的工作团队部似乎非常团结呢!BoA:不是我刻意去创造这样的氛围(笑),不迟到,努力工作,一直一起协力到最后,工作人员失误也会减少,似乎能配合得很好。

  7. Boécio e o problema dos futuros contingentes

    William de Siqueira Piauí

    2010-09-01

    Full Text Available Esse artigo representa nossa crença de que é possível introduzir o pensamento de Boécio a partir de um dos problemas mais recorrentes da filosofia, o problema dos futuros contingentes, explicitando, a partir daquela problemática é claro, quais as ligações mais fundamentais entre três de suas obras, seus dois comentários ao De Interpretatione de Aristóteles e sua Consolaçáo da Filosofia, e, de forma bastante resumida evidentemente, como o alcance do pensamento contido nessas obras chega até pelo menos a filosofia kantiana.

  8. [A review for a traditional Chinese medical journal Shou Shi Yi Bao].

    Xiao, Mei-Hua; Sun, Wen-Zhong

    2009-06-01

    Shou Shi Yi Bao was a journal of traditional Chinese medicine (TCM) during the period from 1935 to 1937, and was originated by Chen Huan-yun, a TCM physician in Suzhou. It is mainly to transmit the knowledge of TCM and to promote the epidemic prevention capacity of local public. The editorial characteristics and historical value of the journal were explored in initial background, staff writers, editorial policies, contents and the Editor Chen's medical ideas. Shou Shi Yi Bao was supported by many famous TCM physicians, although the journal was originated from the civil society. It was an academic TCM journal with perfect practicability for orientating to the public and highlighting the academic spirit. Chen Huan-yun was a resolute defender of TCM, and had many opinions on clinical practice and lots of scientific suggestions on TCM development. Shou Shi Yi Bao reflected the main characteristics of TCM journals in 1930s. The journal was one of the important documents to study the TCM history during the period of the Republic of China in Jiangsu Province, and it also set a stage for the struggle between TCM and Western medicine at that time. The documentary information of the journal has literature and history values in reflecting the historical process of TCM self-improvement. The success of the journal was due to not only the broken-up sectarian bias and cooperation of the TCM practitioners but also the preponderant geographic and cultural circumstances of Suzhou as well as Chen Huan-yun's profound knowledge in traditional Chinese culture and medicine.

  9. 40 CFR 721.3032 - Boric acid (H3BO2), zinc salt.

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Boric acid (H3BO2), zinc salt. 721... Substances § 721.3032 Boric acid (H3BO2), zinc salt. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as boric acid (H3BO2), zinc salt (PMN P-97-553...

  10. SHiP: a new facility to search for heavy neutrinos and study $\

    De Serio, Marilisa

    2016-01-01

    SHiP (Search for Hidden Particles) is a newly designed fixed target facility, proposed at the CERN SPS accelerator, with the aim of complementing searches for New Physics at LHC by searching for light long-lived exotic particles with masses below a few GeV/c2. The sensitivity to Heavy Neutrinos will allow for the first time probing a region of the parameter space where Baryogenesis and active neutrino masses and oscillation could also be explained. A dedicated detector, based on OPERA-like bricks, will provide the first observation of the tau anti-neutrino. Moreover, $\

  11. [Shi Weishan, the pioneer of the western medicine in Hubei in the Late Qing Dynasty].

    Liu, F W

    2017-07-28

    The Englishman Shi Weishan (Frederick Porter Smith) is the first Christianity medical missionary sent to Central China, who is also the founder of the first mission hospital named 'Hospital of Universal Love' in Hubei. Arrived at Hankou in May 1864, he started medical work in July, and left Hankou in December 1870 because of health problem. In addition to medical mission, he tried to communicate with Chinese doctors in Hankou, then enlightened local people with health knowledge by written several books and articles, which brought some success. He also devoted to the translation of Chinese proper names and also wrote related book.

  12. Etude linguistique chez les Baráshi/Banyaambo du Rwanda

    User

    ont quitté le Nkóle et ont gagné le Mutára, puis le Mubarí qui est une large bande frontalière située au nord du lac Ihema jouxtant la région tanzanienne de Karágwe. Puis le mouvement s'est poursuivi vers le sud, ce qui explique donc la présence aujourd'hui d'une communauté Baráshi/Banyaambo au. Gisaká autour des ...

  13. Mixed alkali neodymium orthoborates: K_9Li_3Nd_3(BO_3)_7 and A_2LiNd(BO_3)_2 (A = Rb, Cs)

    Chen, Pengyun; Xia, Mingjun; Li, Rukang

    2016-01-01

    Crystals of mixed alkali neodymium orthoborates, K_9Li_3Nd_3(BO_3)_7 and A_2LiNd(BO_3)_2 (A = Rb, Cs) were obtained by spontaneous crystallization. K_9Li_3Nd_3(BO_3)_7 crystallizes in space group P2/c with cell parameters of a = 11.4524(7) Aa, b = 10.1266(6) Aa, c = 12.3116 (10) Aa, β = 122.0090(10) . In the structure, NdO_8 polyhedra share corners and connect with planer BO_3 groups to form infinite [Nd_3B_3O_2_1]_n chains. These chains are linked by additional BO_3 groups to produce a double layer of [Nd_6B_6O_3_8]_n blocks in the ac plane with K and Li ions filled into the cavities. A_2LiNd(BO_3)_2 (A = Rb, Cs) crystallizes in space group Pbcm, with cell parameters of a = 7.113(2) Aa, b = 9.691(3) Aa and c = 10.135(3) Aa for Rb_2LiNd(BO_3)_2, and a = 7.2113(3) Aa, b = 9.9621(4) Aa, and c = 10.3347(4) Aa for Cs_2LiNd(BO_3)_2. In the structure, NdO_8 polyhedra are corner-sharing with each other and further interlinked by BO_3 groups to comprise the infinite [Nd_4B_4O_2_4] sheets in the bc plane, with Rb/Cs and Li ions occupying the interlayered space. The compounds show effective near-IR emission and their associated lifetimes are obtained by fluorescence spectra. (Copyright copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  14. Crystal structure and magnetic properties of Mn substituted ludwigite Co 3O 2BO 3

    Knyazev, Yu. V.; Ivanova, N. B.; Kazak, N. V.; Platunov, M. S.; Bezmaternykh, L. N.; Velikanov, D. А.; Vasiliev, А. D.; Ovchinnikov, S. G.; Yurkin, G. Yu.

    2012-03-01

    The needle shape single crystals Co3-x MnxO2BO3 with ludwigite structure have been prepared. According to the X-ray diffraction data the preferable character of distinct crystallographic positions occupation by Mn ions is established. Magnetization field and temperature dependencies are measured. Paramagnetic Curie temperature value Θ=-100 K points out the predominance of antiferromagnetic interactions. Spin-glass magnetic ordering takes the onset at TN=41 K. The crystallographic and magnetic properties of Co3O2BO3:Mn are compared with the same for the isostructural analogs Co3O2BO3 and CoO2BO3:Fe.

  15. The light subunit of system bo,+ is fully functional in the absence of the heavy subunit

    Reig, Núria; Chillarón, Josep; Bartoccioni, Paola; Fernández, Esperanza; Bendahan, Annie; Zorzano, Antonio; Kanner, Baruch; Palacín, Manuel; Bertran, Joan

    2002-01-01

    The heteromeric amino acid transporters are composed of a type II glycoprotein and a non-glycosylated polytopic membrane protein. System bo,+ exchanges dibasic for neutral amino acids. It is composed of rBAT and bo,+AT, the latter being the polytopic membrane subunit. Mutations in either of them cause malfunction of the system, leading to cystinuria. bo,+AT-reconstituted systems from HeLa or MDCK cells catalysed transport of arginine that was totally dependent on the presence of one of the bo...

  16. Charge ordering and multiferroicity in Fe{sub 3}BO{sub 5} and Fe{sub 2}MnBO{sub 5} oxyborates

    Maignan, A., E-mail: antoine.maignan@ensicaen.fr [Laboratoire CRISMAT, UMR 6508 CNRS/ENSICAEN/UNICAEN, 6 bd du Maréchal Juin, 14050 CAEN Cedex 4 (France); Lainé, F.; Guesdon, A.; Malo, S. [Laboratoire CRISMAT, UMR 6508 CNRS/ENSICAEN/UNICAEN, 6 bd du Maréchal Juin, 14050 CAEN Cedex 4 (France); Damay, F. [Laboratoire Léon Brillouin, UMR 12, LLB-Saclay, 91191 GIF-SUR-YVETTE Cedex (France); Martin, C. [Laboratoire CRISMAT, UMR 6508 CNRS/ENSICAEN/UNICAEN, 6 bd du Maréchal Juin, 14050 CAEN Cedex 4 (France)

    2017-02-15

    The comparison of Fe{sub 3}BO{sub 5} and Fe{sub 2}MnBO{sub 5} reveals that the 2Fe{sup 2+}: Fe{sup 3+} charge ordering of the former is suppressed in the latter. Spin dynamics probed by ac susceptibility are strongly affected by the substitution, inducing superparamagnetism at low temperature in Fe{sub 2}MnBO{sub 5}. Interestingly, for both oxyborates, glassiness is observed in the dielectric properties at low temperature, but only Fe{sub 3}BO{sub 5} shows a magnetodielectric effect close to its lower magnetic transition. A change in the electrical polarization, measured by pyroelectric current integration, is observed in Fe{sub 3}BO{sub 5} and is even more pronounced in Fe{sub 2}MnBO{sub 5}. Such results suggest that these oxyborates behave like antiferromagnetic relaxor ferroelectrics. These features are proposed to be related to the distribution of the species (Fe{sup 3+}, Fe{sup 2+} and Mn{sup 2+}) over the four transition metal sites forming the ludwigite structure. - Graphical abstract: 90 K [010] electron diffraction patterns of Fe{sub 3}BO{sub 5}. The yellow arrows in the pattern indicate the extra-spots corresponding to the superstructure induced by the charge ordering. - Highlights: • The TEM (ED) study of the Fe{sub 3}BO{sub 5} oxyborate at 90 K reveals a superstructure related to a Fe{sup 2+}/Fe{sup 3+} ordering. • The Fe{sub 2}MnBO{sub 5}, Mn-substituted counterpart, does not show such ordering. • Our magnetic and electric measurements demonstrate that these magnetic ferrites exhibit glassiness in their charges (relaxor-type) with additional superparamagnetism at low T for Fe{sub 2}MnBO{sub 5} and magnetodielectric coupling near T{sub N2}=72 K in Fe{sub 3}BO{sub 5}. • The pyroelectric measurements confirm the existence of a ferroelectric behavior in these antiferromagnets. Accordingly, our results open the route to the study of other large class of the M{sub 2}{sup 2+}M’{sup 3+}BO{sub 5} ludwigites and to their complex magnetism and its

  17. Synthesis, structure and magnetic properties of Fe-Gd nanocapsules coated with B2O3/H3BO3 and Fe3BO5+GdBO3

    Si, P.Z.; Brueck, E.; Zhang, Z.D.; Tegus, O.; Buschow, K.H.J.; Zhang, W.S.; Klaasse, J.C.P.; Boer, F.R. de

    2004-01-01

    Nanocapsules consisting of B 2 O 3 /H 3 BO 3 encapsulating Fe-Gd cores have been synthesized by an arc-discharge process using metal-boron alloys as cathode. Most of the nanocapsules have a well-constructed shell/core structure with a uniform B 2 O 3 /H 3 BO 3 shell. Heat-treatment induces reactions between the shell and the core, resulting in the formation of a Fe 3 BO 5 +GdBO 3 matrix embedded with Fe nanoparticles, reduction of the metallic-core size and decrease of the blocking temperature T B . Above T B , the magnetization curves plotted vs. H/T overlap and show zero coercivity. Below T B , the coercivity shows a linear dependence when plotted vs. T 1/2 . However, the coercivity-T 1/2 curve below 60 K has a different slope from that above 60 K, indicating the existence of two different magnetic phases in the nanocapsules. Different from bulk Fe 3 BO 5 , nanoscale Fe 3 BO 5 particles have a lower transition temperature to the weak-ferromagnetic state, and magnetic hysteresis is absent due to size effects

  18. Do temperamentally shy children process emotion differently than nonshy children? Behavioral, psychophysiological, and gender differences in reticent preschoolers.

    Theall-Honey, Laura A; Schmidt, Louis A

    2006-04-01

    We examined regional brain electrical activity (EEG), heart rate, and subjective responses at rest and during the presentation of videoclips designed to elicit a range of emotions (e.g., sadness, anger, happiness, fear) among a sample of healthy 4-year-old children selected for temperamental shyness. We found that shy children exhibited significantly greater relative right central EEG activation at rest and during the presentation of the fear-eliciting videoclip than nonshy children. Shy females displayed greater relative right mid-frontal EEG activation during the sad, happy, and fear videoclips than shy males who displayed greater relative left mid-frontal EEG activation. These results (1) suggest that recent frontal EEG activation/emotion models might be gender-specific and (2) appear to provide the first empirical evidence for recent theoretical notions linking the origins and maintenance of temperamental shyness in children to difficulty in regulating fear responses. Copyright (c) 2006 Wiley Periodicals, Inc.

  19. Information Philosophy in China: Professor Wu Kun’s 30 Years of Academic Thinking in Information Philosophy

    Guowu Li

    2011-10-01

    Full Text Available Professor Wu Kun, from Xi'an Jiaotong University of China, has been studying information philosophy for 30 years. He thinks information conception is one of the most fundamental areas in philosophy and has founded information philosophy. He has done original and pioneering research in information ontology, epistemology, social information theory, information production theory, information evolution theory, information value, and information thinking directions. He is the first scholar to develop a completely new view of theories, systems, and methods about information philosophy.

  20. His Excellency Mr Ken WU Ambassador Extraordinary and Plenipotentiary of the People’s Republic of China to Switzerland

    Jean Claude Gadmer

    2011-01-01

    Photo 1-5:The delegation visiting the ATLAS visitor Center with P.Jenni, ATLAS Collaboration former Spokesperson Photo 6-14,15-20:visiting the ATLAS experimental area Photo 15:Y. YANG,Attaché-Q. WAN,First Secretary-Z. Ren,ATLAS Collaboration,High Energy Group,Shandong University-H.E. Mr K. Wu-P. Jenni-R. Voss,Adviser for the People’s Republic of China-H. FENG,Counsellor Photo 21-38:Signature of the Guest Book with CERN Director-General R. Heuer

  1. SHiP: a new multipurpose beam-dump experiment at the SPS.

    AUTHOR|(SzGeCERN)387671

    2016-01-01

    SHiP is an experiment to look for very weakly interacting particles at a new to be constructed beam-dum p facility at the CERN SPS. The SHiP Technical Proposal has been submitted to the CERN SPS Committee in April 2015. The 400 GeV/c proton beam extracted from the SPS will be dumped on a heavy target with the aim of integ rating $2\\times 10^{20}$ proton on target in five years. A detector located downstream of the target, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below a few GeV/c$^2$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons (HNL). The sensitivity to HNL will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained...

  2. Personality Development Within a Generational Context: Life Course Outcomes of Shy Children.

    Schmidt, Louis A; Tang, Alva; Day, Kimberly L; Lahat, Ayelet; Boyle, Michael H; Saigal, Saroj; Van Lieshout, Ryan J

    2017-08-01

    Studies have shown that shy children born in the 1920s and 1950s had delayed marriage and parenthood, less stable careers, and lower occupational attainment as adults than other children. Do these effects still hold true? We examined demographic and social outcomes of children born between 1977 and 1982 in a prospective longitudinal study. We assessed shyness in childhood (age 8), adolescence (age 12-16), young adulthood (age 22-26), and adulthood (age 30-35), and derived three shyness trajectories (i.e., decreasing, increasing, and low-stable). Social and demographic outcomes for shy children who outgrew their shyness (i.e., decreasing trajectory) were indistinguishable from those who were consistently low on shyness measures. However, a shyness trajectory beginning in adolescence and increasing to adulthood was associated with poorer outcomes, similar to previous studies. These findings highlight the importance of multiple assessments in long-term longitudinal studies and the need to consider personality development within a generational context.

  3. [Brief discussion on acupuncture technique "controlling Qihai to regulate blood pressure" proposed by academician SHI Xuemin].

    Yu, Liang; Xu, Xifa; Liu, Jian; Fan, Xiaonong

    2017-08-12

    According to Qihai theory, academician SHI Xuemin established the acupuncture technique "controlling Qihai to regulate blood pressure" which focused on Renying (ST 9), and achieved favorable effects in clinical application. In this paper, based on the Qihai theory, from aspects of Yuan qi , Zong qi , Ying qi and Wei qi and relations among qi , blood and veins in TCM, and cardiac output, sympathetic nerve activity and blood vessels in modern medicine, the understanding on hypertension was explained. As a result, both TCM and modern medicine had consistency in the understanding of hypertension, reflecting the scientificity and practicability of this acupuncture technique. Besides, according to Qihai theory and "wind leading to vertigo" theory, academician SHI Xuemin brought forward the key pathogenesis of hypertension was "dysfunction of Qihai ", and the acupoint selected Renying (ST 9), Quchi (LI 11), Hegu (LI 4), Zusanli (ST 36) and Taichong (LR 3). At the same time, the operation specification of each acupoint was mainly discussed, and the references of acupoint selection was explained based on TCM theory and modern clinical research.

  4. Association between Genes BoLA-DRB3.2*8 and BoLA-DRB3.2*12 with Resistance and BoLA-DRB3.2*16 with Susceptibility to Infection by Bovine Leukemia Virus

    C Úsuga-Monroy*, JJ Echeverri Zuluaga and A López-Herrera

    2016-11-01

    Full Text Available The Bovine Leukemia Virus (BLV is a retrovirus that affects the immune system of cattle as their target cells are B lymphocytes. Some polymorphisms at the BoLA-DRB 3.2 gene have been associated with resistance/susceptibility to diseases. The objective of this research was to determine the polymorphisms at the BoLA-DRB 3.2 gene and associate them with resistance (R, neutrality (N or susceptibility (S to BLV in a Holstein cow population.500 blood samples were taken. Nested PCR was performed for detecting BLV virus and PCR-RFLP was performed to identify alleles of gene BoLA-DRB 3.2. Susceptibility was determined using odds ratio (OR and P value. According to their genotype, cows were classified in homozygous (R/R, N/N, or S/S and heterozygous (R/N, R/S, N/S. BLV molecular prevalence was 44%. The most frequent allele was BoLA-DRB3.2*22 (16.8%, alleles associated with resistance to BLV were BoLA-DRB3.2*8 (OR=1.489; P<0.10 and BoLA-DRB3.2*12 (OR=3.897; P<0.10 and allele BoLA-DRB3.2*16 (OR=0.710; P<0.10 was associated with susceptibility. Allele BoLA-DRB3.2*8 had the highest allelic frequency for negative cows (0.19. 63.7% of cows with genotype RN and 70% of cows with genotype RR were resistant to infection by BLV. Alleles R and S have a dominant effect on allele N (P<0.05. The use of reliable diagnostic techniques in conjunction with identification of resistant or susceptible animals can monitor the progress of the disease in dairy herds. Alleles BoLA-DRB3.2*8 and *12 were positively related to the disease and therefore cows have low risk of infection, unlike allele BoLA-DRB3.2*16 which was negatively related and animals have high risk for the disease.

  5. [Professor WU Zhongchao's experience in the treatment of bi syndrome with fire needling therapy at lower he-sea points].

    Zhou, Yu; Chen, Zhongjie; Liu, Chun; Wang, Bing; Zhang, Ning; Li, Caifen; Xie, Qian

    2016-07-12

    Bi syndrome is classified into five categories. Based on the syndrome differentiation of meridians and collaterals and zangfu theories, Professor WU Zhongchao proposed the fire needling therapy at the lower he -sea points for five types of bi syndromes. Professor WU stresses on the flexible application of fire needling therapy for bi syndrome at the lower he -sea points and innovated the unique five techniques of fire needling therapy, named lifting and threating needle of small amplitude at the lower he -sea points, the stimulation along the relevant meri-dians before fire needling, detecting the sensitive sites by gentle pressing the relevant lower he -sea points, combining the movement of affected upper limb or joint during fire needling, or combining with contralateral needling technique, and controlling the depth of fire needling based on the duration of sickness and depth of affected site. He pointed out that Shangjuxu (ST 37) is for skin bi syndrome, Zusanli (ST 36) for muscle bi syndrome, Yanglingquan (GB 34) for tendon bi syndrome, Weizhong (BL 40) for bone bi syndrome and Xiajuxu (ST 39) for vessel bi syndrome.

  6. A novel UV-emitting phosphor: LiSr4(BO3)3: Pb2+

    Pekgözlü, İlhan

    2013-01-01

    Pure and Pb 2+ doped LiSr 4 (BO 3 ) 3 materials were prepared by a solution combustion synthesis method. The phase analysis of all synthesized materials were determined using the powder XRD. The synthesized materials were investigated using spectrofluorometer at room temperature. The excitation and emission bands of LiSr 4 (BO 3 ) 3 : Pb 2+ were observed at 284 and 328 nm, respectively. The dependence of the emission intensity on the Pb 2+ concentration for the LiSr 4 (BO 3 ) 3 were studied in detail. It was observed that the concentration quenching of Pb 2+ in LiSr 4 (BO 3 ) 3 is 0.005 mol. The Stokes shifts of LiSr 4 (BO 3 ) 3 : Pb 2+ phosphor was calculated to be 4723 cm –1 . -- Highlights: • A novel UV-emitting phosphor: LiSr 4 (BO 3 ) 3 : Pb 2+ ” synthesized for the first time. • The emission band of LiSr 4 (BO 3 ) 3 : Pb 2+ was observed at 328 nm upon excitation with 284 nm. • LiSr 4 (BO 3 ) 3 : Pb 2+ is a good phosphor for broadband UV application

  7. Anomalous property of Ag(BO2)2 hyperhalogen: does spin-orbit coupling matter?

    Chen, Hui; Kong, Xiang-Yu; Zheng, Weijun; Yao, Jiannian; Kandalam, Anil K; Jena, Puru

    2013-10-07

    Hyperhalogens were recently identified as a new class of highly electronagative species which are composed of metals and superhalogens. In this work, high-level theoretical calculations and photoelectron spectroscopy experiments are systematically conducted to investigate a series of coinage-metal-containing hyperhalogen anions, Cu(BO(2))(2)(-), Ag(BO(2))(2)(-), and Au(BO(2))(2)(-). The vertical electron detachment energy (VDE) of Ag(BO(2))(2)(-) is anomalously higher than those of Au(BO(2))(2)(-) and Cu(BO(2))(2)(-). In quantitative agreement with the experiment, high-level ab initio calculations reveal that spin-orbit coupling (SOC) lowers the VDE of Au(BO(2))(2)(-) significantly. The sizable magnitude of about 0.5 eV of SOC effect on the VDE of Au(BO(2))(2)(-) demonstrates that SOC plays an important role in the electronic structure of gold hyperhalogens. This study represents a new paradigm for relativistic electronic structure calculations for the one-electron-removal process of ionic Au(I)L(2) complexes, which is characterized by a substantial SOC effect. Copyright © 2013 WILEY‐VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. A facility to search for hidden particles at the CERN SPS: the SHiP physics case.

    Alekhin, Sergey; Altmannshofer, Wolfgang; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristóbal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvêa, André; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P S; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Björn; Gavela, Belen; Giudice, Gian F; Goodsell, Mark D; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N; Morrissey, David E; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W; Zurek, Kathryn M

    2016-12-01

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (search for hidden particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, [Formula: see text] and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the standard model and describe interactions between new particles and four different portals-scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed. We demonstrate that the SHiP experiment has a unique potential to discover new physics and can directly probe a number of solutions of beyond the standard model puzzles, such as neutrino masses, baryon asymmetry of the Universe, dark matter, and inflation.

  9. Understanding Relations among Children's Shy and Antisocial/Aggressive Behaviors and Mothers' Parenting: The Role of Maternal Beliefs

    Evans, Cortney A.; Nelson, Larry J.; Porter, Christin L.; Nelson, David A.; Hart, Craig H.

    2012-01-01

    This study assesses the relationships between children's shy and antisocial/aggressive behaviors and maternal beliefs, and concomitant parenting behaviors. Structural equation models examined 199 mothers' perceptions of aggression and shyness in their preschool-age children (average age = 59.63 months); maternal beliefs (i.e., locus of control,…

  10. First reliability test of a surface micromachined microengine using SHiMMeR

    Tanner, D.M.; Smith, N.F.; Bowman, D.J. [and others

    1997-08-01

    The first-ever reliability stress test on surface micromachined microengines developed at Sandia National Laboratories (SNL) has been completed. We stressed 41 microengines at 36,000 RPM and inspected the functionality at 60 RPM. We have observed an infant mortality region, a region of low failure rate (useful life), and no signs of wearout in the data. The reliability data are presented and interpreted using standard reliability methods. Failure analysis results on the stressed microengines are presented. In our effort to study the reliability of MEMS, we need to observe the failures of large numbers of parts to determine the failure modes. To facilitate testing of large numbers of micromachines. The Sandia High Volume Measurement of Micromachine Reliability (SHiMMeR) system has computer controlled positioning and the capability to inspect moving parts. The development of this parallel testing system is discussed in detail.

  11. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta) in Southern Australia.

    Thomson, Robin B; Alderman, Rachael L; Tuck, Geoffrey N; Hobday, Alistair J

    2015-01-01

    The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta) breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch) and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling) during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as environmental data

  12. Effects of Climate Change and Fisheries Bycatch on Shy Albatross (Thalassarche cauta in Southern Australia.

    Robin B Thomson

    Full Text Available The impacts of climate change on marine species are often compounded by other stressors that make direct attribution and prediction difficult. Shy albatrosses (Thalassarche cauta breeding on Albatross Island, Tasmania, show an unusually restricted foraging range, allowing easier discrimination between the influence of non-climate stressors (fisheries bycatch and environmental variation. Local environmental conditions (rainfall, air temperature, and sea-surface height, an indicator of upwelling during the vulnerable chick-rearing stage, have been correlated with breeding success of shy albatrosses. We use an age-, stage- and sex-structured population model to explore potential relationships between local environmental factors and albatross breeding success while accounting for fisheries bycatch by trawl and longline fisheries. The model uses time-series of observed breeding population counts, breeding success, adult and juvenile survival rates and a bycatch mortality observation for trawl fishing to estimate fisheries catchability, environmental influence, natural mortality rate, density dependence, and productivity. Observed at-sea distributions for adult and juvenile birds were coupled with reported fishing effort to estimate vulnerability to incidental bycatch. The inclusion of rainfall, temperature and sea-surface height as explanatory variables for annual chick mortality rate was statistically significant. Global climate models predict little change in future local average rainfall, however, increases are forecast in both temperatures and upwelling, which are predicted to have detrimental and beneficial effects, respectively, on breeding success. The model shows that mitigation of at least 50% of present bycatch is required to offset losses due to future temperature changes, even if upwelling increases substantially. Our results highlight the benefits of using an integrated modeling approach, which uses available demographic as well as

  13. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D.K.; Aggarwal, Shruti

    2015-01-01

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO 2 :F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In 2 O 3 :Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag +9 ions at fluences ranging from 3.0 × 10 11 ions/cm 2 to 3.0 × 10 13 ions/cm 2 . The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications

  14. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr. [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India); Avasthi, D.K. [Inter University Accelerator Center, Post Box 10502, New Delhi (India); Aggarwal, Shruti, E-mail: shruti.al@gmail.com [University School of Basic and Applied Sciences, Guru Gobind Singh Indraprastha University, New Delhi (India)

    2015-06-15

    Highlights: •The objective is to study the effect of swift heavy ion (SHI) irradiation on photoanode of DSSC for better efficiency. •This work presents the effect of SHI irradiation on various Transparent conducting oxides (TCOs). •Effects are studied in terms of conductivity and transmittance of TCOs. •ITO-PET gives best results in comparison to ITO and FTO for DSSC application under SHI irradiation. -- Abstract: Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO{sub 2}:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In{sub 2}O{sub 3}:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag{sup +9} ions at fluences ranging from 3.0 × 10{sup 11} ions/cm{sup 2} to 3.0 × 10{sup 13} ions/cm{sup 2}. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV–Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  15. SHI/STY Genes Affect Pre- and Post-meiotic Anther Processes in Auxin Sensing Domains in Arabidopsis

    Leandro H. Estornell

    2018-02-01

    Full Text Available In flowering plants, mature sperm cells are enclosed in pollen grains formed in structures called anthers. Several cell layers surrounding the central sporogenous cells of the anther are essential for directing the developmental processes that lead to meiosis, pollen formation, and the subsequent pollen release. The specification and function of these tissues are regulated by a large number of genetic factors. Additionally, the plant hormone auxin has previously been shown to play important roles in the later phases of anther development. Using the R2D2 auxin sensor system we here show that auxin is sensed also in the early phases of anther cell layer development, suggesting that spatiotemporal regulation of auxin levels is important for early anther morphogenesis. Members of the SHI/STY transcription factor family acting as direct regulators of YUC auxin biosynthesis genes have previously been demonstrated to affect early anther patterning. Using reporter constructs we show that SHI/STY genes are dynamically active throughout anther development and their expression overlaps with those of three additional downstream targets, PAO5, EOD3 and PGL1. Characterization of anthers carrying mutations in five SHI/STY genes clearly suggests that SHI/STY transcription factors affect anther organ identity. In addition, their activity is important to repress periclinal cell divisions as well as premature entrance into programmed cell death and cell wall lignification, which directly influences the timing of anther dehiscence and the pollen viability. The SHI/STY proteins also prevent premature pollen germination suggesting that they may play a role in the induction or maintenance of pollen dormancy.

  16. Biodesulfurization of Naphthothiophene and Benzothiophene through Selective Cleavage of Carbon-Sulfur Bonds by Rhodococcus sp. Strain WU-K2R

    Kirimura, Kohtaro; Furuya, Toshiki; Sato, Rika; Ishii, Yoshitaka; Kino, Kuniki; Usami, Shoji

    2002-01-01

    Naphtho[2,1-b]thiophene (NTH) is an asymmetric structural isomer of dibenzothiophene (DBT), and in addition to DBT derivatives, NTH derivatives can also be detected in diesel oil following hydrodesulfurization treatment. Rhodococcus sp. strain WU-K2R was newly isolated from soil for its ability to grow in a medium with NTH as the sole source of sulfur, and growing cells of WU-K2R degraded 0.27 mM NTH within 7 days. WU-K2R could also grow in the medium with NTH sulfone, benzothiophene (BTH), 3-methyl-BTH, or 5-methyl-BTH as the sole source of sulfur but could not utilize DBT, DBT sulfone, or 4,6-dimethyl-DBT. On the other hand, WU-K2R did not utilize NTH or BTH as the sole source of carbon. By gas chromatography-mass spectrometry analysis, desulfurized NTH metabolites were identified as NTH sulfone, 2′-hydroxynaphthylethene, and naphtho[2,1-b]furan. Moreover, since desulfurized BTH metabolites were identified as BTH sulfone, benzo[c][1,2]oxathiin S-oxide, benzo[c][1,2]oxathiin S,S-dioxide, o-hydroxystyrene, 2-(2′-hydroxyphenyl)ethan-1-al, and benzofuran, it was concluded that WU-K2R desulfurized NTH and BTH through the sulfur-specific degradation pathways with the selective cleavage of carbon-sulfur bonds. Therefore, Rhodococcus sp. strain WU-K2R, which could preferentially desulfurize asymmetric heterocyclic sulfur compounds such as NTH and BTH through the sulfur-specific degradation pathways, is a unique desulfurizing biocatalyst showing properties different from those of DBT-desulfurizing bacteria. PMID:12147483

  17. Home birth and hospital birth trends in Bo, Sierra Leone.

    Jacobsen, Kathryn H; Abdirahman, Hafsa A; Ansumana, Rashid; Bockarie, Alfred S; Bangura, Umaru; Jimmy, David Henry; Malanoski, Anthony P; Sundufu, Abu James; Stenger, David A

    2012-06-01

    As of April 2010, all maternity care at government healthcare facilities in Sierra Leone is provided at no cost to patients. In late 2010, we conducted a community health census of 18 sections of the city of Bo (selected via randomized cluster sampling from 68 total sections). Among the 3421 women with a history of pregnancy who participated in the study, older women most often reported having a history of both home and hospital deliveries, while younger women showed a preference for hospital births. The proportion of lastborn children delivered at a healthcare facility increased from 71.8% of offspring 10-14 years old to 81.1% of those one to nine years old and 87.3% of infants born after April 2010. These findings suggest that the new maternal healthcare initiative has accelerated an existing trend toward a preference for healthcare facility births, at least in some urban parts of Sierra Leone. © 2012 The Authors Acta Obstetricia et Gynecologica Scandinavica© 2012 Nordic Federation of Societies of Obstetrics and Gynecology.

  18. Combustion synthesis of red emitting borate host PDP phosphor YCaBO4: Eu3+

    Ingle, J.T.; Hargunani, S.P.; Sonekar, R.P.; Nagpure, P.A.; Omanwar, S.K.; Moharil, S.V.

    2012-01-01

    The red emitting borate host phosphor YCaBO 4 : Eu 3+ has been prepared by a novel solution combustion technique. The synthesis is based on the exothermic reaction between the fuel (Urea) and Oxidizer (Ammonium nitrate). The photoluminescence properties of the powder samples of YCaBO 4 : Eu 3+ has been investigated under UV and VUV excitation. The phosphor shows strong absorption in UV and VUV region and exhibits intense red emission upon excited by 254 nm UV and 173 nm VUV radiation. Under UV 254 nm excitation, YCaBO 4 : Eu 3+ exhibits intense red emission around 610 nm. Under VUV excitation of 173 nm, the phosphor emits intense red emission around 610 nm and few weak emissions. These weak emissions could be suppressed by annealing the sample repeatedly at proper temperature and the borate phosphor YCaBO 4 : Eu 3+ could be a good red emitting phosphor for PDP display and mercury free lamps. (author)

  19. Evidence that Na+-pumping occurs through the D-channel in Vitreoscilla cytochrome bo

    Kim, Seong K.; Stark, Benjamin C.; Webster, Dale A.

    2005-01-01

    The operon (cyo) encoding the Na + -pumping respiratory terminal oxidase (cytochrome bo) of the bacterium Vitreoscilla was transformed into Escherichia coli GV100, a deletion mutant of cytochrome bo. This was done for the wild type operon and five mutants in three conserved Cyo subunit I amino acids known to be crucial for H + transport in the E. coli enzyme, one near the nuclear center, one in the K-channel, and one in the D-channel. CO-binding, NADH and ubiquinol oxidase, and Na + -pumping activities were all substantially inhibited by each mutation. The wild type Vitreoscilla cytochrome bo can pump Na + against a concentration gradient, resulting in a transmembrane concentration differential of 2-3 orders of magnitude. It is proposed that Vitreoscilla cytochrome bo pumps four Na + through the D-channel to the exterior and transports four H + through the K-channel for the reduction of each O 2

  20. Yoga in cyberspace? The web pages of yoga studios in Turku/Åbo

    Måns Broo

    2012-12-01

    Full Text Available In this article, I will offer some comments on the websites of the nine yoga schools which are active in the city of Turku/Åbo at the present moment (see sources for the links. This work is part of a larger, ongoing research project on yoga in this city within the PCCR or Post Secular Society and a Changing Religious Landscape Centre of Excellence research project at the Department of Comparative Religion, Åbo Akademi University.

  1. 40 CFR 721.3031 - Boric acid (H3BO3), zinc salt (2=3).

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Boric acid (H3BO3), zinc salt (2=3). 721.3031 Section 721.3031 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT SIGNIFICANT NEW USES OF CHEMICAL SUBSTANCES Significant New Uses for Specific Chemical Substances § 721.3031 Boric acid (H3BO...

  2. Identification and comparative quantification of bio-active phthalides in essential oils from si-wu-tang, fo-shou-san, radix angelica and rhizoma chuanxiong.

    Tang, Yuping; Zhu, Min; Yu, Sheng; Hua, Yongqing; Duan, Jin-Ao; Su, Shulan; Zhang, Xu; Lu, Yin; Ding, Anwei

    2010-01-15

    Phthalides are important bio-active constituents in Si-Wu-Tang and Fo-Shou-San, two commonly used Traditional Chinese Medicine (TCM) combined prescriptions mainly derived from Radix Angelica and Rhizoma Chuanxiong. In this paper, the contents of eight phthalides, including Z-ligustilide, E-ligustilide, Z-butylenephthalide, E-butylene-phthalide, 3-butylphthalide, neocnidilide and senkyunolide A were determined or estimated by gas chromatography-mass spectrometry (GC-MS). The results showed GC-MS was a simple, rapid, and high sensitive method for analyzing phthalides in Si-Wu-Tang, Fo-Shou-San, Radix Angelica and Rhizoma Chuanxiong, and the extractable contents of each phthalides including Z-ligustilide, E-ligustilide, Z-butylenephthalide, etc. varied after Radix Angelica, Rhizoma Chuanxiong were combined into a formulation, such as Si-Wu-Tang and Fo-Shou-San. Furthermore, inhibition activity of essential oils from Si-Wu-Tang, Fo-Shou-San, Radix Angelica and Rhizoma Chuanxiong on uterine contraction was tested in an in vitro assay, and the results showed that the activity of the essential oil is higher as the content of the phthalides increase, which demonstrated that phthalides are possibly main active components inhibiting mice uterine contraction in vitro. All of the results suggested that comparative analysis of chemical components and pharmacological activities of each herb and formula is possibly helpful to elucidate the active components in traditional Chinese medicine, and to reveal the compatibility mechanism of TCM formulae.

  3. I Know You Are, But What Am I? : Anti-Individualism in the Development of Intellectual Humility and Wu-Wei

    Robinson, Brian; Alfano, M.R.

    2016-01-01

    Virtues are acquirable, so if intellectual humility is a virtue, it’s acquirable. But there is something deeply problematic—perhaps even paradoxical—about aiming to be intellectually humble. Drawing on Edward Slingerland’s analysis of the paradoxical virtue of wu-wei in Trying Not To Try, we argue

  4. Low Temperature Solid-State Synthesis and Characterization of LaBO3

    Azmi Seyhun KIPÇAK

    2016-11-01

    Full Text Available Rare earth (lanthanide series borates, possess high vacuum ultraviolet (VUV transparency, large electronic band gaps, chemical and environmental stability and exceptionally large optical damage thresholds and used in the development of plasma display panels (PDPs. In this study the synthesis of lanthanum borates via solid-state method is studied. For this purpose, lanthanum oxide (La2O3 and boric acid (H3BO3 are used for as lanthanum and boron sources, respectively. Different elemental molar ratios of La to B (between 3:1 to 1:6 as La2O3:H3BO3 were reacted by solid-state method at the reaction temperatures between 500°C - 700°C with the constant reaction time of 4 h. Following the synthesis, characterizations of the synthesized products are conducted by X-ray diffraction (XRD, Fourier transform infrared spectroscopy (FT-IR, Raman spectroscopy and scanning electron microscope (SEM. From the results of the experiments, three types of lanthanum borates of; La3BO6, LaBO3 and La(BO23 were observed at different reaction parameters. Among these three types of lanthanum borates LaBO3 phase were obtained as a major phase.

  5. BoS: a large and diverse family of short interspersed elements (SINEs) in Brassica oleracea.

    Zhang, Xiaoyu; Wessler, Susan R

    2005-05-01

    Short interspersed elements (SINEs) are nonautonomous non-LTR retrotransposons that populate eukaryotic genomes. Numerous SINE families have been identified in animals, whereas only a few have been described in plants. Here we describe a new family of SINEs, named BoS, that is widespread in Brassicaceae and present at approximately 2000 copies in Brassica oleracea. In addition to sharing a modular structure and target site preference with previously described SINEs, BoS elements have several unusual features. First, the head regions of BoS RNAs can adopt a distinct hairpin-like secondary structure. Second, with 15 distinct subfamilies, BoS represents one of the most diverse SINE families described to date. Third, several of the subfamilies have a mosaic structure that has arisen through the exchange of sequences between existing subfamilies, possibly during retrotransposition. Analysis of BoS subfamilies indicate that they were active during various time periods through the evolution of Brassicaceae and that active elements may still reside in some Brassica species. As such, BoS elements may be a valuable tool as phylogenetic makers for resolving outstanding issues in the evolution of species in the Brassicaceae family.

  6. BoHV-4-based vector delivering Ebola virus surface glycoprotein

    Alfonso Rosamilia

    2016-11-01

    Full Text Available Abstract Background Ebola virus (EBOV is a Category A pathogen that is a member of Filoviridae family that causes hemorrhagic fever in humans and non-human primates. Unpredictable and devastating outbreaks of disease have recently occurred in Africa and current immunoprophylaxis and therapies are limited. The main limitation of working with pathogens like EBOV is the need for costly containment. To potentiate further and wider opportunity for EBOV prophylactics and therapies development, innovative approaches are necessary. Methods In the present study, an antigen delivery platform based on a recombinant bovine herpesvirus 4 (BoHV-4, delivering a synthetic EBOV glycoprotein (GP gene sequence, BoHV-4-syEBOVgD106ΔTK, was generated. Results EBOV GP was abundantly expressed by BoHV-4-syEBOVgD106ΔTK transduced cells without decreasing viral replication. BoHV-4-syEBOVgD106ΔTK immunized goats produced high titers of anti-EBOV GP antibodies and conferred a long lasting (up to 6 months, detectable antibody response. Furthermore, no evidence of BoHV-4-syEBOVgD106ΔTK viremia and secondary localization was detected in any of the immunized animals. Conclusions The BoHV-4-based vector approach described here, represents: an alternative antigen delivery system for vaccination and a proof of principle study for anti-EBOV antibodies generation in goats for potential immunotherapy applications.

  7. Spin-glass behavior of warwickite MgFeBO{sub 4} and CoFeBO{sub 4} crystals observed by Mössbauer spectroscopy

    Lyubutin, I.S.; Korotkov, N. Yu.; Frolov, K.V. [Shubnikov Institute of Crystallography, RAS, 119333 Moscow (Russian Federation); Kazak, N.V.; Platunov, M.S. [Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Knyazev, Yu. V. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Bezmaternykh, L.N. [Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Ovchinnikov, S.G. [Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Siberian State Aerospace University, 660014 Krasnoyarsk (Russian Federation); Arauzo, A. [Servicio de Medidas Físicas, Universidad de Zaragoza, Pedro Cerbuna 12, 50009 Zaragoza (Spain); Bartolomé, J. [Instituto de Ciencia de Materiales de Aragón, CSIC-Universidad de Zaragoza and Departamento de Física de la Materia Condensada, 50009 Zaragoza (Spain)

    2015-09-05

    Highlights: • Spin-glass behavior of MgFeBO{sub 4} and CoFeBO{sub 4} observed by Mössbauer spectroscopy. • Transition temperature T{sub SG} increases strongly with Co substitution. • Dynamical scaling theory near T{sub SG} is fulfilled. • Spin-glass behavior is explained as due to short range correlations. • Inclusion of Co increases exchange interaction and magnetocrystalline anisotropy. - Abstract: Single crystals of MgFeBO{sub 4} and CoFeBO{sub 4} warwickites were obtained. The effects of charge ordering and magnetic properties were investigated by Mössbauer spectroscopy. Cation distribution over M1 and M2 nonequivalent sites and the average charge at the metal positions were established. Low temperature Mössbauer spectra reveal spin-glass behavior, with spin-freezing temperatures T{sub SG} of 15.2 and 33.2 K for Mg- and Co-warwickites, respectively, higher than that observed from the d.c. and a.c. magnetic susceptibility measurements. The difference is explained in terms of dynamical scaling theory. The specific shape of the Mössbauer spectra in the vicinity of the magnetic transition at T{sub SG} shows the difference between spin-glass and superparamagnetic behavior and demonstrates an overwhelming role of the exchange anisotropy in the properties of Mg-warwickite. In Co-warwickite the increase of magnetocrystalline anisotropy provokes an increase in magnetic viscosity.

  8. A facility to Search for Hidden Particles at the CERN SPS: the SHiP physics case

    Alekhin, Sergey; Asaka, Takehiko; Batell, Brian; Bezrukov, Fedor; Bondarenko, Kyrylo; Boyarsky, Alexey; Choi, Ki-Young; Corral, Cristobal; Craig, Nathaniel; Curtin, David; Davidson, Sacha; de Gouvea, Andre; Dell'Oro, Stefano; deNiverville, Patrick; Bhupal Dev, P.S.; Dreiner, Herbi; Drewes, Marco; Eijima, Shintaro; Essig, Rouven; Fradette, Anthony; Garbrecht, Bjorn; Gavela, Belen; Giudice, Gian F.; Goodsell, Mark D.; Gorbunov, Dmitry; Gori, Stefania; Grojean, Christophe; Guffanti, Alberto; Hambye, Thomas; Hansen, Steen H.; Helo, Juan Carlos; Hernandez, Pilar; Ibarra, Alejandro; Ivashko, Artem; Izaguirre, Eder; Jaeckel, Joerg; Jeong, Yu Seon; Kahlhoefer, Felix; Kahn, Yonatan; Katz, Andrey; Kim, Choong Sun; Kovalenko, Sergey; Krnjaic, Gordan; Lyubovitskij, Valery E.; Marcocci, Simone; Mccullough, Matthew; McKeen, David; Mitselmakher, Guenakh; Moch, Sven-Olaf; Mohapatra, Rabindra N.; Morrissey, David E.; Ovchynnikov, Maksym; Paschos, Emmanuel; Pilaftsis, Apostolos; Pospelov, Maxim; Reno, Mary Hall; Ringwald, Andreas; Ritz, Adam; Roszkowski, Leszek; Rubakov, Valery; Ruchayskiy, Oleg; Schienbein, Ingo; Schmeier, Daniel; Schmidt-Hoberg, Kai; Schwaller, Pedro; Senjanovic, Goran; Seto, Osamu; Shaposhnikov, Mikhail; Shchutska, Lesya; Shelton, Jessie; Shrock, Robert; Shuve, Brian; Spannowsky, Michael; Spray, Andy; Staub, Florian; Stolarski, Daniel; Strassler, Matt; Tello, Vladimir; Tramontano, Francesco; Tripathi, Anurag; Tulin, Sean; Vissani, Francesco; Winkler, Martin W.; Zurek, Kathryn M.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2016-10-24

    This paper describes the physics case for a new fixed target facility at CERN SPS. The SHiP (Search for Hidden Particles) experiment is intended to hunt for new physics in the largely unexplored domain of very weakly interacting particles with masses below the Fermi scale, inaccessible to the LHC experiments, and to study tau neutrino physics. The same proton beam setup can be used later to look for decays of tau-leptons with lepton flavour number non-conservation, $\\tau\\to 3\\mu$ and to search for weakly-interacting sub-GeV dark matter candidates. We discuss the evidence for physics beyond the Standard Model and describe interactions between new particles and four different portals - scalars, vectors, fermions or axion-like particles. We discuss motivations for different models, manifesting themselves via these interactions, and how they can be probed with the SHiP experiment and present several case studies. The prospects to search for relatively light SUSY and composite particles at SHiP are also discussed....

  9. THE SUNNI-SHI'ITE RIVALRY AND ITS INFLUENCE ON THE GEOPOLITICAL SITUATION OF THE MIDDLE EAST

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  10. The Sunni-Shi'ite Rivalry And Its Influence On The Geopolitical Situation Of The Middle East

    Alexander A. Kuznetsov

    2014-01-01

    Full Text Available The article "The Sunni-Shi'ite rivalry and its influence on the geopolitical situation of the Middle East" is dedicated to the sectarian conflicts in the Middle East region in last 30 years. Author considers the Islamic revolution of 1979 in Iran as the point of departure of this conflict. Author of the article makes a difference between the Shi'ite Islamic revolutionary doctrine of Khomeini and the Salafi Islamic fundamentalism of Saudi Arabia. Author realizes the analysis of the war between Iran and Iraq in 1980-1988. This analysis is emphasized on the regional geopolitical situation and positions of the outside actors (Saudi Arabia, USA, France, Germany. Then it is covered the American invasion of Iraq in 2003 and its geopolitical consequences. To the author's mind this aggression and further empowerment of the Shi'ite majority reduced to the civil war in Iraq and exacerbation of the sectarian conflict. Author of the article considers these events as a part of the geopolitical rivalry between Iran and Saudi Arabia to unfold in the areas of Iraq, Syria and Lebanon.

  11. SHI induced modification in structural, optical, dielectric and thermal properties of poly ethylene oxide films

    Patel, Gnansagar B.; Bhavsar, Shilpa [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, N.L., E-mail: nl.singh-phy@msubaroda.ac.in [Department of Physics, The M.S. University of Baroda, Vadodara 390002 (India); Singh, F.; Kulriya, P.K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110067 (India)

    2016-07-15

    Poly ethylene oxide (PEO) films were synthesized by solution cast method. These self-standing films were exposed with 60 MeV C{sup +5} ion and 100 MeV Ni{sup +7} ion at different fluences. SHI induced effect was investigated by employing various techniques. The crystalline size decreased upon irradiation as observed from XRD analysis. FTIR analysis reveals the decrement in the peak intensity upon irradiation. Tauc’s method was used to determine the optical band gap (E{sub g}), which shows decreasing trends with increase of fluence. The dielectric properties were investigated in the frequency range 10 Hz to 10 MHz for unirradiated and irradiated films. The dielectric constant remains same for the broad-spectrum of frequency and increases at lower frequency. The dielectric loss also moderately influence as a function of frequency due to irradiation. DSC analysis validated the results of XRD. Scanning electron microscopy (SEM) reveals that there is significant change in the surface morphology due to irradiation.

  12. Shi Cihang 航慈釋. The First Case of Mummified Buddhist in Taiwan

    Stefania Travagnin

    2006-01-01

    Full Text Available Shi Cihang 航慈釋 (1895-1954, is one of the eminent figures in the so-called Modern Buddhism in Taiwan. Engaged in improving education and training of Buddhist monks and nuns, and promoter of the so-called renjian fojiao 教佛間人 (Buddhism for the Human Realm, which refuses any sort of superstitious understanding and practice of Buddhism and calls for the return to the original and pure essence of the Dharma, Cihang is also the first Buddhist monk in Taiwan who attempted to, and eventually succeeded in, preserving his body afterdeath. Nowadays, the gilded relic-body of Cihang is enshrined and venerated in Xizhi, Taipei county, as well as being included in the list of the roushen pusa 薩菩身肉 (flesh-body Bodhisattvas who appeared in the history of Chinese Buddhism. This paper analyses Cihang’s relic-body as case-study of Chinese mummified Buddhist in the scene of contemporary Taiwan and modern Taiwanese Buddhim, discussing the Buddhist significance, sociological implications and eventual impact of mummification within the reality of the new renjian fojiao.

  13. The Variation of Riverbed Material due to Tropical Storms in Shi-Wen River, Taiwan

    Chin-Ping Lin

    2014-01-01

    Full Text Available Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65% and increase (50% in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  14. The variation of riverbed material due to tropical storms in Shi-Wen River, Taiwan.

    Lin, Chin-Ping; Wang, Yu-Min; Tfwala, Samkele S; Chen, Ching-Nuo

    2014-01-01

    Taiwan, because of its location, is a flood prone region and is characterised by typhoons which brings about two-thirds to three quarters of the annual rainfall amount. Consequently, enormous flows result in rivers and entrain some fractions of the grains that constitute the riverbed. Hence, the purpose of the study is to quantify the impacts of these enormous flows on the distribution of grain size in riverbeds. The characteristics of riverbed material prior to and after the typhoon season are compared in Shi-Wen River located at southern Taiwan. These include grain size variation, bimodality, and roughness coefficient. A decrease (65%) and increase (50%) in geometric mean size of grains were observed for subsurface and surface bed material, respectively. Geometric standard deviation decreased in all sites after typhoon. Subsurface material was bimodal prior to typhoons and polymodal after. For surface material, modal class is in the gravel class, while after typhoons it shifts towards cobble class. The reduction in geometric mean resulted to a decrease in roughness coefficient by up to 30%. Finally, the relationship of Shields and Froude numbers are studied and a change in the bed form to antidunes and transition form is observed, respectively.

  15. Neurologic deterioration with progressive CT changes in a child with Kearns-Shy syndrome

    Yoda, Satoru; Kitahara, Fuminori; Akabane, Taro; Terauchi, Akiko.

    1984-01-01

    A case of the rare juvenile form of Kearns-Shy syndrome with progressive external ophthalmoplegia and lid ptosis, carditis, skeletal muscle weakness, seizures, mental subnormality, short stature, EEG abnormality and deafness is presented. Electromyography revealed a myopathic pattern. Histochemical studies on quadriceps biopsy specimens showed atrophy of type II fibers and ''ragged-red fibers.'' On electron microscopy these muscle cells were seen to contain an increased amount of glycogen particles and abnormal mitochondria were increased in number and size. It is of interest that abrupt deterioration of neurological findings such as seizures, mental subnormality, speech disturbance and deafness was present in our case. Computed tomographic scanning showed progressive changes of cerebral atrophy, low density of cerebral white matter and basal ganglia calcification, which were well associated with the clinical deterioration. A review of the literature also indicated that some patients with this syndrome showed abrupt neurological deterioration in childhood. Involvement of the central nervous system in this syndrome has to be considered as the cause of sudden deterioration and death in childhood. (author)

  16. Prevalence of consanguineous marriages among shi'a populations of Lebanon.

    El-Kheshen, Ghadir; Saadat, Mostafa

    2013-09-01

    In genetics, a consanguineous marriage means union between couples who are related as second cousins or closer. The present cross-sectional study was carried out in order to illustrate the prevalence and types of consanguineous marriages in the Shi'a population living in widespread territories in Lebanon including the Bekaa Valley, the south of Lebanon and the southern suburb of Beirut. Data on types of marriages were collected using a simple questionnaire. The total number of couples in the study was 1203. Consanguineous marriage was classified by the degree of relationship between couples. The overall frequency of consanguinity was found to be 28.4%, with first cousin marriages (21.3%) being the most common type followed by first cousins once removed (5.5%), then double first cousins (0.8%). The frequencies of second cousin and beyond second cousin marriages were the same at 0.4% of all the marriages. The mean inbreeding coefficient (α) was estimated at about 0.0161 for the population. There were no significant differences between the three studied territories for frequencies of different types of marriages (p>0.1), nor were there significant differences between the rural and urban areas (p>0.1).

  17. CATS, continuous automated testing of seismological, hydroacoustic, and infrasound (SHI) processing software.

    Brouwer, Albert; Brown, David; Tomuta, Elena

    2017-04-01

    To detect nuclear explosions, waveform data from over 240 SHI stations world-wide flows into the International Data Centre (IDC) of the Comprehensive Nuclear-Test-Ban Treaty Organization (CTBTO), located in Vienna, Austria. A complex pipeline of software applications processes this data in numerous ways to form event hypotheses. The software codebase comprises over 2 million lines of code, reflects decades of development, and is subject to frequent enhancement and revision. Since processing must run continuously and reliably, software changes are subjected to thorough testing before being put into production. To overcome the limitations and cost of manual testing, the Continuous Automated Testing System (CATS) has been created. CATS provides an isolated replica of the IDC processing environment, and is able to build and test different versions of the pipeline software directly from code repositories that are placed under strict configuration control. Test jobs are scheduled automatically when code repository commits are made. Regressions are reported. We present the CATS design choices and test methods. Particular attention is paid to how the system accommodates the individual testing of strongly interacting software components that lack test instrumentation.

  18. arXiv Search for new physics with the SHiP experiment at CERN

    Lantwin, Oliver

    2017-12-01

    SHiP is a new general purpose fixed target experiment at the CERN SPS designed to complement LHC experiments in the search for new physics. In its initial phase, the $400$ GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating $2\\times10^{20}$ pot in 5 years. Shielded by an active muon shield, a dedicated detector, based on a long decay volume followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles with masses below $\\mathcal{O}(10)\\; \\mathrm{GeV}/{c^2}$. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutral Leptons. The sensitivity to Heavy Neutral Leptons will allow for the first time to probe, in the mass range above the kaon mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. A dedicated emulsion-based detector will allow detection of ...

  19. Wu-Tou Decoction Inhibits Chronic Inflammatory Pain in Mice: Participation of TRPV1 and TRPA1 Ion Channels

    Chao Wang

    2015-01-01

    Full Text Available Wu-tou decoction (WTD is a classic traditional Chinese medicine formula and has been used effectively to treat joint diseases clinically. Previous reports indicated that WTD possesses anti-inflammatory activity; however, its actions on pain have not been clarified. Here, we investigated the antinociceptive activity of WTD in CFA-induced mice, and its possible mechanism of the action associated with transient receptor potential (TRP ion channels was also explored. Our results showed that 1.58, 3.15, and 6.30 g/kg WTD significantly attenuated mechanical, cold, and heat hypersensitivities. Moreover, WTD effectively inhibited spontaneous nociceptive responses to intraplantar injections of capsaicin and cinnamaldehyde, respectively. WTD also effectively suppressed jumping and wet-dog-shake behaviors to intraperitoneal injection of icilin. Additionally, WTD significantly reduced protein expression of TRPV1 and TRPA1 in dorsal root ganglia and skins of injured paw. Collectively, our data demonstrate firstly that WTD exerts antinociceptive activity in inflammatory conditions by attenuating mechanical, cold, and heat hypersensitivities. This antinociceptive effect may result in part from inhibiting the activities of TRPV1, TRPA1, and TRPM8, and the suppression of TRPV1 and TRPA1 protein by WTD was also highly effective. These findings suggest that WTD might be an attractive and suitable therapeutic agent for the management of chronic inflammatory pain.

  20. The complete mitochondrial genome and its remarkable secondary structure for a stonefly Acroneuria hainana Wu (Insecta: Plecoptera, Perlidae).

    Huang, Mingchao; Wang, Yuyu; Liu, Xingyue; Li, Weihai; Kang, Zehui; Wang, Kai; Li, Xuankun; Yang, Ding

    2015-02-15

    The Plecoptera (stoneflies) is a hemimetabolous order of insects, whose larvae are usually used as indicators for fresh water biomonitoring. Herein, we describe the complete mitochondrial (mt) genome of a stonefly species, namely Acroneuria hainana Wu belonging to the family Perlidae. This mt genome contains 13 PCGs, 22 tRNA-coding genes and 2 rRNA-coding genes that are conserved in most insect mt genomes, and it also has the identical gene order with the insect ancestral gene order. However, there are three special initiation codons of ND1, ND5 and COI in PCGs: TTG, GTG and CGA, coding for L, V and R, respectively. Additionally, the 899-bp control region, with 73.30% A+T content, has two long repeated sequences which are found at the 3'-end closing to the tRNA(Ile) gene. Both of them can be folded into a stem-loop structure, whose adjacent upstream and downstream sequences can be also folded into stem-loop structures. It is presumed that the four special structures in series could be associated with the D-loop replication. It might be able to adjust the replication speed of two replicate directions. Copyright © 2014 Elsevier B.V. All rights reserved.

  1. NH4 Be2 BO3 F2 and γ-Be2 BO3 F: Overcoming the Layering Habit in KBe2 BO3 F2 for the Next-Generation Deep-Ultraviolet Nonlinear Optical Materials.

    Peng, Guang; Ye, Ning; Lin, Zheshuai; Kang, Lei; Pan, Shilie; Zhang, Min; Lin, Chensheng; Long, Xifa; Luo, Min; Chen, Yu; Tang, Yu-Huan; Xu, Feng; Yan, Tao

    2018-05-12

    KBe 2 BO 3 F 2 (KBBF) is still the only practically usable crystal that can generate deep-ultraviolet (DUV) coherent light by direct second harmonic generation (SHG). However, applications are hindered by layering, leading to difficulty in the growth of thick crystals and compromised mechanical integrity. Despite efforts, it is still a great challenge to discover new nonlinear optical (NLO) materials that overcome the layering while keeping the DUV SHG available. Now, two new DUV NLO beryllium borates have been successfully designed and synthesized, NH 4 Be 2 BO 3 F 2 (ABBF) and γ-Be 2 BO 3 F (γ-BBF), which not only overcome the layering but also can be used as next-generation DUV NLO materials with the shortest type I phase-matching second-harmonic wavelength down to 173.9 nm and 146 nm, respectively. Significantly, γ-BBF is superior to KBBF in all metrics and would be the most outstanding DUV NLO crystal. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. A new method for simultaneous detection and discrimination of Bovine herpesvirus types 1 (BoHV-1) and 5 (BoHV-5) using real time PCR with high resolution melting (HRM) analysis.

    Marin, M S; Quintana, S; Leunda, M R; Recavarren, M; Pagnuco, I; Späth, E; Pérez, S; Odeón, A

    2016-01-01

    Bovine herpesvirus types 1 (BoHV-1) and 5 (BoHV-5) are antigenically and genetically similar. The aim of this study was to develop a simple and reliable one-step real time PCR assay with high resolution melting (HRM) analysis for the simultaneous detection and differentiation of BoHV-1 and BoHV-5. Optimization of assay conditions was performed with DNA from reference strains. Then, DNA from field isolates, clinical samples and tissue samples of experimentally infected animals were studied by real time PCR-HRM. An efficient amplification of real time PCR products was obtained, and a clear melting curve and appropriate melting peaks for both viruses were achieved in the HRM curve analysis for BoHV type identification. BoHV was identified in all of the isolates and clinical samples, and BoHV types were properly differentiated. Furthermore, viral DNA was detected in 12/18 and 7/18 samples from BoHV-1- and BoHV-5-infected calves, respectively. Real time PCR-HRM achieved a higher sensitivity compared with virus isolation or conventional PCR. In this study, HRM was used as a novel procedure. This method provides rapid, sensitive, specific and simultaneous detection of bovine alpha-herpesviruses DNA. Thus, this technique is an excellent tool for diagnosis, research and epidemiological studies of these viruses in cattle. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. MiToBo - A Toolbox for Image Processing and Analysis

    Birgit Möller

    2016-04-01

    Full Text Available MiToBo is a toolbox and Java library for solving basic as well as advanced image processing and analysis tasks. It features a rich collection of fundamental, intermediate and high-level image processing operators and algorithms as well as a couple of sophisticated tools for specific biological and biomedical applications. These tools include operators for elucidating cellular morphology and locomotion as well as operators for the characterization of certain intracellular particles and structures. MiToBo builds upon and integrates into the widely-used image analysis software packages ImageJ and Fiji [11, 10], and all of its operators can easily be run in ImageJ and Fiji via a generic operator runner plugin. Alternatively MiToBo operators can directly be run from command line, and using its functionality as a library for developing own applications is also supported. Thanks to the Alida library [8] forming the base of MiToBo all operators share unified APIs fostering reusability, and graphical as well as command line user interfaces for operators are automatically generated. MiToBo is available from its website http://www.informatik.uni-halle.de/mitobo, on Github, via an Apache Archiva Maven repository server, and it can easily be activated in Fiji via its own update site.

  4. Identification and expression analysis of BoMF25, a novel polygalacturonase gene involved in pollen development of Brassica oleracea.

    Lyu, Meiling; Liang, Ying; Yu, Youjian; Ma, Zhiming; Song, Limin; Yue, Xiaoyan; Cao, Jiashu

    2015-06-01

    BoMF25 acts on pollen wall. Polygalacturonase (PG) is a pectin-digesting enzyme involved in numerous plant developmental processes and is described to be of critical importance for pollen wall development. In the present study, a PG gene, BoMF25, was isolated from Brassica oleracea. BoMF25 is the homologous gene of At4g35670, a PG gene in Arabidopsis thaliana with a high expression level at the tricellular pollen stage. Collinear analysis revealed that the orthologous gene of BoMF25 in Brassica campestris (syn. B. rapa) genome was probably lost because of genome deletion and reshuffling. Sequence analysis indicated that BoMF25 contained four classical conserved domains (I, II, III, and IV) of PG protein. Homology and phylogenetic analyses showed that BoMF25 was clustered in Clade F. The putative promoter sequence, containing classical cis-acting elements and pollen-specific motifs, could drive green fluorescence protein expression in onion epidermal cells. Quantitative RT-PCR analysis suggested that BoMF25 was mainly expressed in the anther at the late stage of pollen development. In situ hybridization analysis also indicated that the strong and specific expression signal of BoMF25 existed in pollen grains at the mature pollen stage. Subcellular localization showed that the fluorescence signal was observed in the cell wall of onion epidermal cells, which suggested that BoMF25 may be a secreted protein localized in the pollen wall.

  5. BoALMT1, an Al-Induced Malate Transporter in Cabbage, Enhances Aluminum Tolerance in Arabidopsis thaliana

    Lei Zhang

    2018-01-01

    Full Text Available Aluminum (Al is present in approximately 50% of the arable land worldwide and is regarded as the main limiting factor of crop yield on acidic soil. Al-induced root malate efflux plays an important role in the Al tolerance of plants. Here, the aluminum induced malate transporter BoALMT1 (KF322104 was cloned from cabbage (Brassica oleracea. BoALMT1 showed higher expression in roots than in shoots. The expression of BoALMT1 was specifically induced by Al treatment, but not the trivalent cations lanthanum (La, cadmium (Cd, zinc (Zn, or copper (Cu. Subcellular localization studies were performed in onion epidermal cells and revealed that BoALMT1 was localized at the plasma membrane. Scanning Ion-selective Electrode Technique was used to analyze H+ flux. Xenopus oocytes and Arabidopsis thaliana expressing BoALMT1 excreted more H+ under Al treatment. Overexpressing BoALMT1 in transgenic Arabidopsis resulted in enhanced Al tolerance and increased malate secretion. The results suggested that BoALMT1 functions as an Al-resistant gene and encodes a malate transporter. Expressing BoALMT1 in Xenopus oocytes or A. thaliana indicated that BoALMT1 could increase malate secretion and H+ efflux to resist Al tolerance.

  6. [A Study on the quotations in the Wu xing da yi (The Gist of Five Phases) cited from Nei jing (Inner Canon)].

    Wang, Zheng-Shan; Zhang, Qi-Cheng

    2013-07-01

    In the Wu xing da yi (The Gist of Five Phases), written by Xiao Ji of the Sui Dynasty, there were 9 quotations cited from Huang di nei jing (Inner Canon of Huangdi). By comparison with current version of Huang di nei jing, most of the descriptions are similar, yet still with some differences, such as yin-yang nature of the five zang visceras, the liver being the root of "pi ji", the spleen being the root of "cang lin" etc. Wu xing da yi epitomizes the books about yin-yang and five phases before the Sui Dynasty, while Xiao Ji's quotations from Huang di nei jing interpreted from the views of yin-yang and five phases, are different from the annotations of later ages.

  7. Hydrothermal Formation of the Head-to-Head Coalesced Szaibelyite MgBO2(OH Nanowires

    Zhu Wancheng

    2009-01-01

    Full Text Available Abstract The significant effect of the feeding mode on the morphology and size distribution of the hydrothermal synthesized MgBO2(OH is investigated, which indicates that, slow dropping rate (0.5 drop s−1 and small droplet size (0.02 mL d−1 of the dropwise added NaOH solution are favorable for promoting the one-dimensional (1D preferential growth and thus enlarging the aspect ratio of the 1D MgBO2(OH nanostructures. The joint effect of the low concentration of the reactants and feeding mode on the hydrothermal product results in the head-to-head coalesced MgBO2(OH nanowires with a length of 0.5–9.0 μm, a diameter of 20–70 nm, and an aspect ratio of 20–300 in absence of any capping reagents/surfactants or seeds.

  8. Synthesis and crystal structure of the rare earth borogermanate EuGeBO{sub 5}

    Chi, Yang; Zhuang, Yan; Guo, Sheng-Ping [Yangzhou Univ., Jiangsu (China). College of Chemistry and Chemical Engineering

    2017-03-01

    The synthesis and crystal structure of the rare earth borogermanate EuGeBO{sub 5} are reported. It is synthesized by high-temperature solid-state reaction and crystallizes in the monoclinic space group P2{sub 1}/c (no. 14) with the unit cell parameters a=4.8860(5), b=7.5229(8), c=9.9587(10) Aa, and β=91.709(3) . Its crystal structure features a polyanion-type layer (GeBO{sub 5}){sup 3-} constructed by BO{sub 4} and GeO{sub 4} tetrahedra connected alternatingly. Eu{sup 3+} ions are located in cavities and are coordinated by eight O atoms. Various structures of the related compounds REMM'O{sub 5} (RE=rare earth metal; M=Si, Ge, and Sn; M'=B, Al, and Ga) are also discussed.

  9. Role of Asp544 in subunit I for Na+ pumping by Vitreoscilla cytochrome bo

    Chung, Yeon T.; Stark, Benjamin C.; Webster, Dale A.

    2006-01-01

    The conserved Glu540 in subunit I of Escherichia coli cytochrome bo (a H + pump) is replaced by Asp544 in the Vitreoscilla enzyme (a Na + pump). Site-directed mutagenesis of the Vitreoscilla cytochrome bo operon changed this Asp to Glu, and both wild type and mutant cyo's were transformed into E. coli strain GV100, which lacks cytochrome bo. Compared to the wild type transformant the Asp544Glu transformant had decreased ability to pump Na + as well as decreased stimulation in respiratory activity in the presence of Na + . Preliminary experiments indicated that this mutant also had increased ability to pump protons, suggesting that this single change may provide cation pumping specificity in this group of enzymes

  10. The role of BoFLC2 in cauliflower (Brassica oleracea var. botrytis L.) reproductive development.

    Ridge, Stephen; Brown, Philip H; Hecht, Valérie; Driessen, Ronald G; Weller, James L

    2015-01-01

    In agricultural species that are sexually propagated or whose marketable organ is a reproductive structure, management of the flowering process is critical. Inflorescence development in cauliflower is particularly complex, presenting unique challenges for those seeking to predict and manage flowering time. In this study, an integrated physiological and molecular approach was used to clarify the environmental control of cauliflower reproductive development at the molecular level. A functional allele of BoFLC2 was identified for the first time in an annual brassica, along with an allele disrupted by a frameshift mutation (boflc2). In a segregating F₂ population derived from a cross between late-flowering (BoFLC2) and early-flowering (boflc2) lines, this gene behaved in a dosage-dependent manner and accounted for up to 65% of flowering time variation. Transcription of BoFLC genes was reduced by vernalization, with the floral integrator BoFT responding inversely. Overall expression of BoFT was significantly higher in early-flowering boflc2 lines, supporting the idea that BoFLC2 plays a key role in maintaining the vegetative state. A homologue of Arabidopsis VIN3 was isolated for the first time in a brassica crop species and was up-regulated by two days of vernalization, in contrast to findings in Arabidopsis where prolonged exposure to cold was required to elicit up-regulation. The correlations observed between gene expression and flowering time in controlled-environment experiments were validated with gene expression analyses of cauliflowers grown outdoors under 'natural' vernalizing conditions, indicating potential for transcript levels of flowering genes to form the basis of predictive assays for curd initiation and flowering time. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  11. Three enzymatically active neurotoxins of Clostridium botulinum strain Af84: BoNT/A2, /F4, and /F5.

    Kalb, Suzanne R; Baudys, Jakub; Smith, Theresa J; Smith, Leonard A; Barr, John R

    2014-04-01

    Botulinum neurotoxins (BoNTs) are produced by various species of clostridia and are potent neurotoxins which cause the disease botulism, by cleaving proteins needed for successful nerve transmission. There are currently seven confirmed serotypes of BoNTs, labeled A-G, and toxin-producing clostridia typically only produce one serotype of BoNT. There are a few strains (bivalent strains) which are known to produce more than one serotype of BoNT, producing either both BoNT/A and /B, BoNT/A and /F, or BoNT/B and /F, designated as Ab, Ba, Af, or Bf. Recently, it was reported that Clostridium botulinum strain Af84 has three neurotoxin gene clusters: bont/A2, bont/F4, and bont/F5. This was the first report of a clostridial organism containing more than two neurotoxin gene clusters. Using a mass spectrometry based proteomics approach, we report here that all three neurotoxins, BoNT/A2, /F4, and /F5, are produced by C. botulinum Af84. Label free MS(E) quantification of the three toxins indicated that toxin composition is 88% BoNT/A2, 1% BoNT/F4, and 11% BoNT/F5. The enzymatic activity of all three neurotoxins was assessed by examining the enzymatic activity of the neurotoxins upon peptide substrates, which mimic the toxins' natural targets, and monitoring cleavage of the substrates by mass spectrometry. We determined that all three neurotoxins are enzymatically active. This is the first report of three enzymatically active neurotoxins produced in a single strain of Clostridium botulinum.

  12. Violence against women in the context of war: experiences of Shi'i women and Palestinian refugee women in Lebanon.

    Holt, Maria

    2013-03-01

    In times of war, women are likely to experience, in addition to the "normal" violence of peacetime, random cruelties perpetrated by the enemy against all members of the community. During research conducted with Palestinian refugees and Shi'i Muslims in Lebanon, women described various forms of violence and, in this article, I examine violence suffered by women in the context of conflict from three perspectives: victimization, trauma, and resistance. I argue that traumatic events have the effect of obliterating identity, but they can also strengthen the resolve to resist.

  13. Chromatographic isolation of nanoparticles from Ma-Xing-Shi-Gan-Tang decoction and their characterization.

    Zhou, Jianwu; Gao, Guanzhen; Chu, Qiuping; Wang, Huiqin; Rao, Pingfan; Ke, Lijing

    2014-02-12

    The herbal decoction is a complex dispersion system containing solutes, colloid, aggregates, emulsions and precipitates. In which phase bioactive phytochemicals are dispersed determines their delivery, action and metabolism. This study took ephedrine, a well-studied and widely used phytochemical, as an example to elucidate its exact distribution in the phases of Ma-Xing-Shi-Gan-Tang decoction (MXSGT), which is an Ephedra sinica Stapf. containing traditional Chinese medicinal formula, and the biological meaning of this distribution correspondingly. It may provide an important update to the safety and efficacy assessment of the herbal decoction and its active phytochemicals. In this study, the decoction was fractionated with size-exclusion chromatography coupled with multi-angle laser light scattering detector. The morphology of fractionated nanoparticles was observed with AFM and SEM. The bioactivities of the decoction, the ephedrine alkaloids loaded NPs (prepared by chromatography isolation) and the synthetic ephedrine were assessed by cell proliferation tests using five cell lines, namely Caco-2, L-02, Hep-G2, NR-8383, and Hela-229. Nanoparticles with radii of gyration ranged from 50 to 150 nm were isolated, in spherical shape. Further analysis of nanoparticles on the subsequent reversed phase chromatography revealed that the majority of ephedrine (99.7%) and pseudoephedrine (95.5%) were associated with these nanoparticles, rather than dispersed freely in the real solution. The addition of both the herbal decoction and the separated ephedrine-loaded nanoparticles reserved higher cell viability/proliferation than that of the sole synthetic ephedrine among the Caco-2, L-02, Hep-G2, and NR-8383 cells. In contrast, the nanoparticles reduced the proliferating power of ephedrine on Hela-229 cells. In general, the ephedrine-loaded NPs conducted the intermediate influences on the cell viability, in either way. The colloidal nanoparticles were separated from the decoction

  14. Gauging the Auditory Dimensions of Dysarthric Impairment: Reliability and Construct Validity of the Bogenhausen Dysarthria Scales (BoDyS)

    Ziegler, Wolfram; Staiger, Anja; Schölderle, Theresa; Vogel, Mathias

    2017-01-01

    Purpose: Standardized clinical assessment of dysarthria is essential for management and research. We present a new, fully standardized dysarthria assessment, the Bogenhausen Dysarthria Scales (BoDyS). The measurement model of the BoDyS is based on auditory evaluations of connected speech using 9 scales (traits) assessed by 4 elicitation methods.…

  15. Synthesis and photoluminescence properties of GdBO3:Ln3+ (Ln = Eu, Tb) nanofibers by electrospinning

    Shen, Hongzhi; Feng, Shuo; Wang, Ying; Gu, Yipeng; Zhou, Jing; Yang, Hang; Feng, Guanlin; Li, Liang; Wang, Wenquan; Liu, Xiaoyang; Xu, Dapeng

    2013-01-01

    Highlights: ► GdBO 3 :Ln 3+ nanofibers were synthesized successfully by electrospinning. ► The samples have the average diameter of 150 nm and the flexible morphology. ► The GdBO 3 : Eu 3+ nanofibers have the stronger orange emission. ► The luminescence properties are different from the reported bulk material. ► We describe the energy transform process of GdBO 3 :Ln 3+ system. - Abstract: GdBO 3 :Ln 3+ (Ln = Eu, Tb) nanofibers were synthesized using electrospinning combined with heat treatment. The synthesized nanofibers were characterized by X-ray diffraction, Raman spectroscopy, field emission-scanning electron microscopy, thermogravimetric and differential thermal analyses, and photoluminescence. The experimental results show that the flexible synthesized nanofibers have an average diameter of approximately 150 nm. The nanofibers consist of crystalline grains with diameters of about 40 nm and have a vaterite-type structure of GdBO 3 . The GdBO 3 :Eu 3+ nanofibers exhibit strong orange and weak red emissions with a low ratio of red to orange emission intensities, which is different from those of the reported bulk materials and nanoparticles. The luminescence properties of the synthesized GdBO 3 :Tb 3+ nanofibers are essentially consistent with those of the synthesized GdBO 3 :Tb 3+ powders by solid-state reaction.

  16. Structure, electronic properties, luminescence and chromaticity investigations of rare earth doped KMgBO{sub 3} phosphors

    Zheng, Jianghui; Cheng, Qijin [School of Energy Research, Xiamen University, Xiamen 361005 (China); Wu, Shunqing [Department of Physics, Xiamen University, Xiamen, 361005 (China); Zhuang, Yixi [College of Materials, Xiamen University, Xiamen 361005 (China); Guo, Ziquan; Lu, Yijun [Department of Electronic Science, Fujian Engineering Research Center for Solid-state Lighting, Xiamen University, Xiamen 361005 (China); Chen, Chao, E-mail: cchen@xmu.edu.cn [School of Energy Research, Xiamen University, Xiamen 361005 (China); Department of Physics, Xiamen University, Xiamen, 361005 (China); Department of Electronic Science, Fujian Engineering Research Center for Solid-state Lighting, Xiamen University, Xiamen 361005 (China)

    2015-09-01

    In this work, the optimization of the geometry and the electronic properties of the host matrix KMgBO{sub 3} were investigated using density functional theory, and the comprehensive photoluminescence and chromaticity properties on five rare earth ion-doped (RE = Ce{sup 3+}, Tm{sup 3+}, Tb{sup 3+}, Eu{sup 3+}, Dy{sup 3+}) KMgBO{sub 3} phosphors were also studied. By introducing RE ions into the KMgBO{sub 3} host, excellent purple, blue, green, red and white emitting light could be obtained under the near-ultraviolet light excitation. The results suggest that rare earth doped KMgBO{sub 3} phosphors are potential luminescence materials for the application in the near-ultraviolet white light-emitting diodes. - Highlights: • The electronic properties of the host matrix KMgBO{sub 3} were investigated. • The PL properties on rare earth ions doped KMgBO{sub 3} phosphors were studied. • The chromaticity properties on rare earth ions doped KMgBO{sub 3} samples were studied. • Tm{sup 3+} and Eu{sup 3+} doped KMgBO{sub 3} samples show higher color purity than commercial phosphors.

  17. [A molecular epidemiological study of KI polyomavirus and WU polyomavirus in children with acute respiratory infection in Tianjin, China].

    Lin, Shu-Xiang; Wang, Wei; Guo, Wei; Yang, Hong-Jiang; Ma, Bai-Cheng; Fang, Yu-Lian; Xu, Yong-Sheng

    2017-07-01

    To investigate the relationship of KI polyomavirus (KIPyV) and WU polyomavirus (WUPyV) with acute respiratory infection in children in Tianjin, China. A total of 3 730 nasopharyngeal secretions were collected from hospitalized children with acute respiratory infection in Tianjin Children's Hospital from January 2011 to December 2013. Viral nucleic acid was extracted, and virus infection (KIPyV and WUPyV) was determined by PCR. Some KIPyV-positive and WUPyV-positive PCR products were subjected to sequencing. Sequencing results were aligned with the known gene sequences of KIPyV and WUPyV to construct a phylogenetic tree. Amplified VP1 fragments of KIPyV were inserted into the cloning vector (PUCm-T) transformed into E. coli competent cells. Positive clones were identified by PCR and sequencing. The nucleotide sequences were submitted to GenBank. In addition, another seven common respiratory viruses in all samples were detected by direct immunofluorescence assay. In the 3 730 specimens, the KIPyV-positive rate was 12.14% (453/3 730) and the WUPyV-positive rate was 1.69% (63/3 730). The mean infection rate of KIPyV was significantly higher in June and July, while the mean infection rate of WUPyV peaked in February and March. Most of the KIPyV-positive or WUPyV-positive children were infections with KIPyV, WUPyV, and other respiratory viruses were observed in the children. The co-infection rate was 2.31% (86/3 730) and there were nine cases of co-infections with WUPyV and KIPyV. Thirty-five KIPyV-positive and twelve WUPyV-positive PCR products were sequenced and the alignment analysis showed that they had high homology with the known sequences (94%-100% vs 95%-100%). The VP1 gene sequences obtained from two KIPyV strains in this study were recorded in GenBank with the accession numbers of KY465925 and KY465926. For some children with acute respiratory infection in Tianjin, China, the acute respiratory infection may be associated with KIPyV and WUPy

  18. When people in close relationships are not prepared to listen to emotional disclosures. The role of social constraints in shy people’s functioning

    Irena Dzwonkowska

    2007-12-01

    Full Text Available The following article comprises a presentation of research carried out on a group of 268 adults. The survey aimed at finding answers to questions posed about the meditative role played by social constraints in the relationship between shyness and certain aspects of emotional and social functioning. The results indicate that social constraints are a destructive factor in the everyday functioning of those facing everyday problems. Many shy people experience social constraints - people in close relationships: family, relatives, and friends react inadequately and negatively, demonstrating a lack of empathy, thus discouraging people who are shy from expressing their personal thoughts and emotions. Regression analyses, conducted in order to detect the meditative effects of social constraints, show that their destructive influence is particularly severe in the case of shy people leading to their low self-esteem, a high level of depressive symptoms and a low perception of social support.

  19. Thermodynamic study of gaseous CsBO2 by Knudsen effusion mass spectrometry

    Nakajima, K.; Takai, T.; Furukawa, T.; Osaka, M.

    2017-08-01

    One of the main chemical forms of cesium in the gas phase during severe light-water reactor accidents is expected to be cesium metaborate, CsBO2, according to thermodynamic equilibrium calculations considering its reaction with boron. However, the accuracy of the thermodynamic data of the gaseous metaborate, CsBO2(g), has been judged as poor. Thus, Knudsen effusion mass spectrometric measurements of CsBO2 were carried out to obtain reliable thermodynamic data. The evaluated values of the standard enthalpy of formation of CsBO2(g), obtained by the 2nd and 3rd-law treatments, are -700.7 ± 10.7 kJ/mol and -697.0 ± 10.6 kJ/mol, respectively, and agree with each other within the experimental errors, which indicates that our data are reliable. Furthermore, it was found that the existing data of the Gibbs energy function and the standard enthalpy of formation agreed well with the values evaluated in this study, which indicates that the existing thermodynamic data are also reliable.

  20. Liberální matka Božena Němcová?

    Bahenská, Marie

    2012-01-01

    Roč. 99, č. 3 (2012), s. 307-318 ISSN 0009-0794 Institutional support: RVO:67985921 Keywords : Němcová, Božena * biography Subject RIV: AB - History Impact factor: 0.094, year: 2012 http://www.jstor.org/stable/42640493

  1. Prevalence and gene frequencies of A1A2BO and Rh(D) blood ...

    Ruqaiya Hussain

    2012-08-03

    Aug 3, 2012 ... Human Genetics and Toxicology Lab, Section of Genetics, Department of Zoology ... alence and gene frequencies of A1A2BO and Rh(D) blood groups among the Muslim populations of ..... The principal bio-clinical significance of the erythrocytic ... (CST), UP, which funded the major project, titled '' Genomic.

  2. Hana Bořkovcová, Záznamy z Wohlau

    Kosák, Michal

    2010-01-01

    Roč. 25, č. 81 (2010), s. 209-220 ISSN 1210-2881 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * Bořkovcová, Hana * holocaust Subject RIV: AJ - Letters, Mass-media, Audiovision

  3. Mapping Boron Dioxide (BO2) Light Emission During Ballistic Initiation of Boron

    2016-03-03

    cameras (Vision Research, Inc.) looking through a glass plate beam splitter ( Edward Scientific) along a common line of sight. The cameras were run...Research Laboratory (US); 1992. Report No.: BRL-TR-3387. 17. Snowden BS Jr. The emission spectrum of the BO2 molecule [thesis 64-4757]. [Nashville

  4. Interferon-τ increases BoLA-I for implantation during early pregnancy in dairy cows.

    Zhu, Zhe; Li, Binbin; Wu, Yue; Wang, Xiao; Deng, GanZhen

    2017-11-10

    Interferon-τ (IFN-τ) signals pregnancy recognition in ruminants. We investigated the effects of IFN-τ produced by embryo trophoblastic cells (ETCs) on expression of bovine leukocyte antigen-I (BoLA-I), a bovine analogue of human MHC-I, in endometrial luminal epithelial cells (EECs) during early pregnancy in dairy cows. Expression of IFN-τ and BoLA-I was increased in endometrial tissues during early pregnancy. Expression of the anti-inflammatory cytokine IL-10 was increased in endometrial tissues, while expression of the pro-inflammatory cytokine IL-6 was decreased, indicating immunosuppression. Progesterone increased IFN-τ expression in EECs. IFN-τ increased p-STAT1 and p-STAT3 levels in EECs, but reduced TRAF3 levels. In addition, IFN-τ increased expression of BoLA-I and IL-10, but decreased expression of IL-6 in EECs. These results indicate that IFN-τ enables stable implantation in dairy cows by increasing expression of BoLA-I, and by immunosuppression mediated by increased IL-10 and decreased IL-6 expression.

  5. Transgenic tobacco plants expressing BoRS1 gene from Brassica ...

    Water stress is by far the leading environmental stress limiting crop yields worldwide. Genetic engineering techniques hold great promise for developing crop cultivars with high tolerance to water stress. In this study, the Brassica oleracea var. acephala BoRS1 gene was transferred into tobacco through ...

  6. Centers of sustainable co-created products by BoP: Development inspired by social entrepreneurs.

    Jauregui Becker, Juan Manuel; Franco Garcia, Maria Maria; Groen, Arend J.

    2012-01-01

    This paper frames the main components required to set-up Product Co-Creation Centers (PC3) within (rural or urban) BoP environments as a method to (1) identify creative and entrepreneur individuals; (2) aid the process of generating new ideas; (3) support the co-creation of products and services as

  7. TanZamBo Capacity Building for HIV Prevention Research Network ...

    This grant will support the development of HIV/AIDS prevention trial expertise in Botswana, Tanzania and Zambia using existing collaborations between Africa, Canada and the United States. The Botswana-Tanzania-Zambia Capacity Building Network (TanZamBo) is composed of two African institutions with fairly well ...

  8. Scientific Drilling with the Sea Floor Drill Rig MeBo

    Gerold Wefer

    2007-09-01

    Full Text Available In March 2007 the sea floor drill rig MeBo (short for “Meeresboden-Bohrgerät”, ‘sea floor drill rig’ in German returned from a 17-day scientific cruise with the new German research vessel Maria S. Merian. Four sites between 350 m and 1700 m water depth were sampled at the continental slope off Morocco by push coring and rotary drilling. Up to 41.5-m-long sediment cores were recovered from Miocene, Pliocene, and Pleistocene marls. MeBo bridges the gapbetween conventional sampling methods from standard multipurpose research vessels (gravity corer, piston corer, dredges and drill ships. Most bigger research vessels will be able to support deployment of the MeBo. Since the drill system can be easily transported within 20-ft containers, worldwide operation from vessels of opportunity is possible. With the MeBo a new system is available for marine geosciences that allows the recovery of high quality samples from soft sediments and hard rock from the deep sea withoutrelying on the services of expensive drilling vessels.

  9. SHI induced effects on the electrical and optical properties of HfO_2 thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P.

    2016-01-01

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO_2 as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO_2 is the only alternative to reduce the leakage current. HfO_2 is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO_2 thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO_2/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  10. Effect of swift heavy ion (SHI) irradiation on transparent conducting oxide electrodes for dye-sensitized solar cell applications

    Singh, Hemant Kr.; Avasthi, D. K.; Aggarwal, Shruti

    2015-06-01

    Transparent conducting oxides (TCOs) are used as electrodes in dye-sensitized solar cells (DSSCs) because of their properties such as high transmittance and low resistivity. In the present work, the effects of swift heavy ion (SHI) irradiation on various types of TCOs are presented. The objective of this study is to investigate the effect of SHI on TCOs. For the present study, three different types of TCOs are considered, namely, (a) FTO (fluorine-doped tin oxide, SnO2:F) on a Nippon glass substrate, (b) ITO (indium tin oxide, In2O3:Sn) coated on polyethylene terephthalate (PET) on a Corning glass substrate, and (c) ITO on a Corning glass substrate. These films are irradiated with 120 MeV Ag+9 ions at fluences ranging from 3.0 × 1011 ions/cm2 to 3.0 × 1013 ions/cm2. The structural, morphological, optical and electrical properties are studied via X-ray diffraction (XRD), atomic force microscopy (AFM), UV-Vis absorption spectroscopy and four-probe resistivity measurements, respectively. The ITO-PET electrode is found to exhibit superior conductivity and transmittance properties in comparison with the others after irradiation and, therefore, to be the most suitable for solar cell applications.

  11. Characterization of the regulatory network of BoMYB2 in controlling anthocyanin biosynthesis in purple cauliflower.

    Chiu, Li-Wei; Li, Li

    2012-10-01

    Purple cauliflower (Brassica oleracea L. var. botrytis) Graffiti represents a unique mutant in conferring ectopic anthocyanin biosynthesis, which is caused by the tissue-specific activation of BoMYB2, an ortholog of Arabidopsis PAP2 or MYB113. To gain a better understanding of the regulatory network of anthocyanin biosynthesis, we investigated the interaction among cauliflower MYB-bHLH-WD40 network proteins and examined the interplay of BoMYB2 with various bHLH transcription factors in planta. Yeast two-hybrid studies revealed that cauliflower BoMYBs along with the other regulators formed the MYB-bHLH-WD40 complexes and BobHLH1 acted as a bridge between BoMYB and BoWD40-1 proteins. Different BoMYBs exhibited different binding activity to BobHLH1. Examination of the BoMYB2 transgenic lines in Arabidopsis bHLH mutant backgrounds demonstrated that TT8, EGL3, and GL3 were all involved in the BoMYB2-mediated anthocyanin biosynthesis. Expression of BoMYB2 in Arabidopsis caused up-regulation of AtTT8 and AtEGL3 as well as a subset of anthocyanin structural genes encoding flavonoid 3'-hydroxylase, dihydroflavonol 4-reductase, and leucoanthocyanidin dioxygenase. Taken together, our results show that MYB-bHLH-WD40 network transcription factors regulated the bHLH gene expression, which may represent a critical feature in the control of anthocyanin biosynthesis. BoMYB2 together with various BobHLHs specifically regulated the late anthocyanin biosynthetic pathway genes for anthocyanin biosynthesis. Our findings provide additional information for the complicated regulatory network of anthocyanin biosynthesis and the transcriptional regulation of transcription factors in vegetable crops.

  12. Facile controlled synthesis different morphologies of LuBO3:Ln3+ (Ln = Eu, Tb) phosphors and tunable luminescent properties

    Leng, Zhihua; Xiong, Hailong; Li, Linlin; Zhang, Nannan; Liu, Yali; Gan, Shucai

    2015-01-01

    Sphere-like and cauliflower-like hexagonal-vaterite LuBO 3 have been successfully synthesized for the first time via a chemical conversion route using Lu(OH)CO 3 colloid spheres as sacrificial precursor and H 3 BO 3 as boron source without any additional surfactant. FTIR analysis provides an additional evidence of the formation of vaterite-type LuBO 3 in this method. It was found that, an appropriate amount ethanol in the hydrothermal process has a great effect on the products' morphology and crystallinity. Time-dependent experiments indicate that the formation of LuBO 3 crystals went through a two-stage growth process, which involves a fast nucleation of primary particles followed by a slow aggregation and crystallization of primary particles. An investigation on the photoluminescence (PL) properties of LuBO 3 :Eu 3+ phosphors with different morphologies indicates that their PL intensity are dependent on their crystallinity. The effect of Eu 3+ and Tb 3+ doping concentration on PL intensity were also investigated and the quenching concentration of LuBO 3 :Eu 3+ and LuBO 3 :Tb 3+ is 0.25 and 0.20, respectively. Moreover, for Eu 3+ /Tb 3+ doped LuBO 3 phosphors, the color tones can be tuned from green, through green–yellow and yellow, and then to red by simply adjusting the relative doping concentrations of the Tb 3+ and Eu 3+ ions. - Highlights: • Sphere-like and cauliflower-like LuBO 3 were obtained by a conversion route. • This method used Lu(OH)CO 3 and H 3 BO 3 as the precursors for the first time. • Ethanol can control the products' morphology, crystallinity and PL intensity. • The emitting color tones vary with Tb 3+ /Eu 3+ doped concentration

  13. Ultraviolet and near-infrared luminescence of LaBO3:Ce3+,Yb3+

    Wei, Heng-Wei; Shao, Li-Ming; Jiao, Huan; Jing, Xi-Ping

    2018-01-01

    Ce3+ or Yb3+ singly doped LaBO3 and Ce3+-Yb3+ co-doped LaBO3 were prepared by conventional solid state reactions at 1100 °C and their photoluminescence (PL) properties were investigated. The emission spectrum of LaBO3:Ce3+,Yb3+ contains both the Ce3+ ultraviolet (UV) emissions (355 nm and 380 nm) and the Yb3+ near infrared (NIR) emission (975 nm) when excited by the UV light at 270 nm. By using the data of the Ce3+ decay curves and the PL intensities of both Ce3+ and Yb3+, the energy transfer efficiency (η) from Ce3+ to Yb3+, the actual energy transfer efficiency (AE) and the quantum efficiency (Q) of the Yb3+ emission were calculated. In the Ce3+-Yb3+ co-doped LaBO3, Ce3+ can transfer its absorbed energy to Yb3+ efficiently (η can be over 60%), and Yb3+ shows the Q value over 50% when it accepts the energy from Ce3+, which results in the low AE value ∼30%. The energy transfer process from Ce3+ to Yb3+ may be understood by the charge transfer mechanism: Ce3+ + Yb3+ ↔ Ce4+ + Yb2+. Particularly the Ce3+-Yb3+ co-doped LaBO3 phosphor gives the emissions mainly in the UV range and the NIR range with a portion of visible emissions in eye-insensitive range. This unique property may be suitable for applications in anti-counterfeiting techniques and public security affairs.

  14. Ultra high performance liquid chromatography coupled with electrospray ionization/quadrupole time-of-flight mass spectrometry for the rapid analysis of constituents in the traditional Chinese medicine formula Wu Ji Bai Feng Pill.

    Duan, Shengnan; Qi, Wen; Zhang, Siwen; Huang, Kunkun; Yuan, Dan

    2017-10-01

    An ultra high performance liquid chromatography coupled with electrospray ionization quadrupole time-of-flight mass spectrometry method in both positive and negative ion modes was established in order to comprehensively investigate the major constituents in Wu Ji Bai Feng Pill. Briefly, a Waters ACQUITY UPLC HSS C 18 column was used to separate the aqueous extract of Wu Ji Bai Feng Pill. A total of 0.1% formic acid in acetonitrile and 0.1% aqueous formic acid v/v were used as the mobile phase. All analytes were determined using quadrupole time-of-flight mass spectrometry with electrospray ionization source in positive and negative ion modes. At length, a total of 173 components including flavones and their glycosides, monoterpene glycosides, triterpene saponins, phenethylalchohol glycosides, iridoid glycosides, phthalides, tanshinones, phenolic acids, sesquiterpenoids and cyclopeptides were identified or tentatively characterized in Wu Ji Bai Feng Pill in an analysis of 16.0 min based on the accurate mass and tandem mass spectrometry behaviors. The developed method is rapid and highly sensitive to characterize the chemical constituents of Wu Ji Bai Feng Pill, which could not only be used for chemical standardization and quality control of Wu Ji Bai Feng Pill, but also be helpful for further study in vivo metabolism of Wu Ji Bai Feng Pill. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Temporal Courses in EEG Theta and Alpha Activity in the Dynamic Health Qigong Techniques Wu Qin Xi and Liu Zi Jue

    Diana Henz

    2018-01-01

    Full Text Available Health Qigong is a common technique of Traditional Chinese Medicine applied to strengthen mental and physical health. Several studies report increases in EEG theta and alpha activity after meditative Qigong techniques indicating a relaxed state of mind. To date, little is known on the effects of dynamic Health Qigong techniques that comprise bodily movements on brain activity. In the current study, we compared effects of two dynamic Health Qigong techniques on EEG brain activity. Subjects performed the techniques Wu Qin Xi (five animals play and Liu Zi Jue (six healing sounds in a within-subjects design. Eyes-open and eyes-closed resting EEG was recorded before and immediately after each 15-min practice block. Additionally, the Profile of Mood States (POMS questionnaire was administered at pretest, and after each 15-min practice block. Results show a decrease in alpha activity after 15 min, followed by an increase after 30 min in the Health Qigong technique Liu Zi Jue. Theta activity was decreased after 15 min, followed by an increase after 30 min in the technique Wu Qin Xi. Results of the POMS indicated an increased vigor-activity level with decreased fatigue and tension-anxiety levels in both techniques after 30 min of practice. Our results demonstrate different temporal dynamics in EEG theta and alpha activity for the Health Qigong techniques Wu Qin Xi and Liu Zi Jue. We hypothesize that the found brain activation patterns result from different attentional focusing styles and breathing techniques performed during the investigated Health Qigong techniques.

  16. A triple gene mutant of BoHV-1 administered intranasally in lambs replicates efficiently in the nasal epithelium and induces neutralizing antibody

    Bovine herpes virus 1 (BoHV-1) causes respiratory infections and abortions in cattle, and is an important component of Bovine respiratory disease complex (BRDC). BoHV-1 has also been isolated from sheep with respiratory disorder. Experimentally, sheep and goats are infected productively with BoHV-1...

  17. Bo Xilai :China will honor its World Trade Organization(WTO) commitments. Banking and telecommunications market sectors would be opened in time

    2006-01-01

    @@ Minister of Commerce Bo Xilai promised on September 4 that China will honor its WTO commitments. At a ceremony to mark China's five-year WTO partnership, Bo Xilai promised this to commercial leaders of Europe present again. Bo said all market sectors would be opened in time, referring especially to banking and telecommunications.

  18. Enzymatic characterization and gene identification of aconitate isomerase, an enzyme involved in assimilation of trans-aconitic acid, from Pseudomonas sp. WU-0701.

    Yuhara, Kahori; Yonehara, Hiromi; Hattori, Takasumi; Kobayashi, Keiichi; Kirimura, Kohtaro

    2015-11-01

    trans-Aconitic acid is an unsaturated organic acid that is present in some plants such as soybean and wheat; however, it remains unclear how trans-aconitic acid is degraded and/or assimilated by living cells in nature. From soil, we isolated Pseudomonas sp. WU-0701 assimilating trans-aconitic acid as a sole carbon source. In the cell-free extract of Pseudomonas sp. WU-0701, aconitate isomerase (AI; EC 5.3.3.7) activity was detected. Therefore, it seems likely that strain Pseudomonas sp. WU-0701 converts trans-aconitic acid to cis-aconitic acid with AI, and assimilates this via the tricarboxylic acid cycle. For the characterization of AI from Pseudomonas sp. WU-0701, we performed purification, determination of enzymatic properties and gene identification of AI. The molecular mass of AI purified from cell-free extract was estimated to be ~ 25 kDa by both SDS/PAGE and gel filtration analyses, indicating that AI is a monomeric enzyme. The optimal pH and temperature of purified AI for the reaction were 6.0 °C and 37 °C, respectively. The gene ais encoding AI was cloned on the basis of the N-terminal amino acid sequence of the protein, and Southern blot analysis revealed that only one copy of ais is located on the bacterial genome. The gene ais contains an ORF of 786 bp, encoding a polypeptide of 262 amino acids, including the N-terminal 22 amino acids as a putative periplasm-targeting signal peptide. It is noteworthy that the amino acid sequence of AI shows 90% and 74% identity with molybdenum ABC transporter substrate-binding proteins of Pseudomonas psychrotolerans and Xanthomonas albilineans, respectively. This is the first report on purification to homogeneity, characterization and gene identification of AI. The nucleotide sequence of ais described in this article is available in the DDBJ/EMBL/GenBank nucleotide sequence databases under the Accession No. LC010980. © 2015 FEBS.

  19. β-Y(BO{sub 2}){sub 3}. A new member of the β-Ln(BO{sub 2}){sub 3} (Ln = Nd, Sm, Gd-Lu) structure family

    Schmitt, Martin K.; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie

    2017-07-01

    β-Y(BO{sub 2}){sub 3} was synthesized in a Walker-type multianvil module at 5.9 GPa/1000 C. The crystal structure has been elucidated through single-crystal X-ray diffraction. β-Y(BO{sub 2}){sub 3} crystallizes in the orthorhombic space group Pnma (no. 62) with the lattice parameters a = 15.886(2), b = 7.3860(6), and c = 12.2119(9) Aa. Its crystal structure will be discussed in the context of the isotypic lanthanide borates β-Ln(BO{sub 2}){sub 3} (Ln = Nd, Sm, Gd-Lu).

  20. Pressure-induced phase transitions in acentric BaHf(BO{sub 3}){sub 2}

    Mączka, Mirosław, E-mail: m.maczka@int.pan.wroc.pl [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Szymborska-Małek, Katarzyna [Institute of Low Temperature and Structure Research, Polish Academy of Sciences, P.O. Box 1410, 50-950 Wrocław 2 (Poland); Sousa Pinheiro, Gardenia de [Departamento de Física, Universidade Federal do Piauí, Teresina, PI 64049-550 (Brazil); Cavalcante Freire, Paulo Tarso [Departamento de Fisica, Universidade Federal do Ceara, Fortaleza CE-60455-970 (Brazil); Majchrowski, Andrzej [Institute of Applied Physics, Military University of Technology, 2 Kaliskiego Street, 00-908 Warszawa (Poland)

    2015-08-15

    High-pressure Raman scattering studies revealed that BaHf(BO{sub 3}){sub 2} is more compressible than calcite-type orthoborates and calcite, aragonite or dolomite carbonates. It undergoes a first-order reversible pressure-induced phase transition in the 3.9–4.4 GPa pressure range. Second structural change is observed at 9.2 GPa. The intermediate phase is most likely trigonal. However, Raman results suggest increase in the number of distinct BO{sub 3} groups from two in the ambient pressure phase to at least three in the intermediate phase. This intermediate phase is also strongly compressible and strong pressure dependence of the lattice modes proves that the main changes under pressure occur within the layers built from BaO{sub 6} and HfO{sub 6} octahedra. The second phase transition leads most likely to lowering of the trigonal symmetry, as evidenced by significant increase of the number of observed bands. The pressure coefficients of the Raman bands of the high-pressure phase are relatively small, suggesting more dense arrangement of the metal–oxygen polyhedra and BO{sub 3} groups in this phase. It is worth noting that the high-pressure phase was not reached in the second compression experiment up to 10 GPa. This behavior can be most likely attributed to worse hydrostatic conditions of the first experiment. - Graphical abstract: Raman spectra of BaHf(BO{sub 3}){sub 2} recorded at different pressures during compression showing onset of pressure-induced phase transitions. - Highlights: • High-pressure Raman spectra were measured for BaHf(BO{sub 3}){sub 2.} • BaHf(BO{sub 3}){sub 2} undergoes a reversible first-order phase transition at 3.9–4.4 GPa into a trigonal phase. • The intermediate trigonal phase is strongly compressible second structural transformation is observed at 9.2 GPa under non-perfect hydrostatic conditions.

  1. BoALMT1, an Al-Induced Malate Transporter in Cabbage, Enhances Aluminum Tolerance in Arabidopsis thaliana

    Zhang, Lei; Wu, Xin-Xin; Wang, Jinfang; Qi, Chuandong; Wang, Xiaoyun; Wang, Gongle; Li, Mingyue; Li, Xingsheng; Guo, Yang-Dong

    2018-01-01

    Aluminum (Al) is present in approximately 50% of the arable land worldwide and is regarded as the main limiting factor of crop yield on acidic soil. Al-induced root malate efflux plays an important role in the Al tolerance of plants. Here, the aluminum induced malate transporter BoALMT1 (KF322104) was cloned from cabbage (Brassica oleracea). BoALMT1 showed higher expression in roots than in shoots. The expression of BoALMT1 was specifically induced by Al treatment, but not the trivalent catio...

  2. Getting to "No": Locating Critical Peace Education within Resistance and Anti-Oppression Pedagogy at a Shi'a Islamic School in Lebanon

    Zakharia, Zeena

    2017-01-01

    This paper critically engages observations from a school that was aligned with a resistance movement in Lebanon during a post-war period of sustained political violence (2006-2007). Focusing on the pedagogical practices at one community-centered and community-led Shi'a Islamic urban school, the paper draws on extensive ethnographic data to…

  3. ECN's torrefaction-based BO2-technology. From pilot to demo

    Kiel, J.H.A. [ECN Biomass, Coal and Environmental Research, Petten (Netherlands)

    2011-02-15

    The contents of this PowerPoint presentation are: Torrefaction design challenges; Initial small-scale R and D; ECN's torrefaction-based BO2-technology; Pilot-scale testing; and Demonstration and market introduction. The conclusions state that Torrefaction potentially allows cost-effective production of 2nd generation biomass pellets from a wide range of biomass/waste feedstock with a high energy efficiency (>90%); Torrefaction pellets show: High energy density, Water resistance, No/Limited biological degradation and heating, Excellent grindability, and Good combustion and gasification properties; Torrefaction is a separate thermal regime and requires dedicated reactor/process design; Torrefaction development is in pilot/demo-phase and shows strong market pull for torrefaction plants and torrefaction pellets; For ECN's BO2-technology a demo-plant is in preparation and industrial partnership for world-wide market introduction is nearly established.

  4. [Bovine herpesvirus 4 (BoHV-4): general aspects of the biology and status in Argentina].

    Morán, Pedro E; Pérez, Sandra E; Odeón, Anselmo C; Verna, Andrea E

    2015-01-01

    Bovine herpesvirus 4 (BoHV-4) has been isolated from cattle with respiratory infections, vulvovaginitis, mastitis, abortions, endometritis and from apparently healthy animals throughout the world. Although it has not yet been established as causal agent of a specific disease entity, it is primarily associated with reproductive disorders of cattle. This virus can infect a wide range of species, either in vivo or in vitro. Two groups of prototype strains were originated from the first isolates: the DN599-type strains (American group) and the Movar-type strains (European group). In Argentina, BoHV-4 was isolated and characterized in 2007 from vaginal discharge samples taken from cows that had aborted. So far, more than 40 isolates, mainly associated with aborting bovine females have been registered in our country. Copyright © 2014 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.

  5. Modulated magnetic structure of an inhomogeneous stressed single crystal FeBO3

    Sharipiv, M.Z.; Dzhuraev, D.R.; Sokolov, B.Yu.; Kurbanov, M.

    2010-01-01

    With the help of low-symmetry mechanical stresses, we induced an additional spatially inhomogeneous anisotropy in the basal plane of a single crystal FeBO 3 . By the magnetooptical method, we study the effect of an inhomogeneous magnetic anisotropy on the magnetic state of this easy-plane weak ferromagnetic. It is established that, at the magnetization of inhomogeneously stressed FeBO 3 in the basal plane near some separated direction, the crystal transits from the homogeneous state into a spatially modulated magnetic state. The latter can be represented in the form of a static spin wave, in which a local vector of ferromagnetism oscillates near the direction of the mean magnetization of a crystal, by remaining in the basal plane.

  6. Non collinear magnetic phase of the inhomogeneously stressed FeBO3 monocrystals

    Sharipov, M.Z.

    2011-01-01

    With the help of low-symmetry mechanical stresses, an additional spatially inhomogeneous anisotropy in the basal plane of a single crystal FeBO 3 has been induced. By the magnetooptical method, an effect of the inhomogeneous magnetic anisotropy on the magnetic state of this easy-plane weak ferromagnetic has been investigated. It is established that at the magnetization of inhomogeneously stressed FeBO 3 in the basal plane near the separated direction, the crystal turns from the homogeneous state into a spatially modulated magnetic state. The latter can be represented in the form of a static spin wave, in which a local vector of ferromagnetism oscillates near the direction of the mean magnetization of a crystal, remaining in the basal plane. (authors)

  7. Isolation of pathogenic Yersinia enterocolitica 1B/O:8 from Apodemus mice in Japan.

    Oda, Shinya; Kabeya, Hidenori; Sato, Shingo; Shimonagane, Ai; Inoue, Kai; Hayashidani, Hideki; Takada, Nobuhiro; Fujita, Hiromi; Kawabata, Hiroki; Maruyama, Soichi

    2015-01-01

    Yersinia enterocolitica was isolated from 15.7% (88/560) of wild rodents captured in 15 prefectures in Japan. Prevalences by rodent species were 18.0% (70/388) in Japanese field mice (Apodemus speciosus), 20% (14/71) in small Japanese field mice (Apodemus argenteus), and 11% (4/38) in gray red-backed vole (Myodes rufocanus bedfordiae), suggesting that these rodent species are important reservoirs of Y. enterocolitica. Although most of the isolates were identified as biotype 1A, the pathogenic bioserotype 1B/O:8 was detected in one of the A. speciosus and in three of the A. argenteus captured in Aomori Prefecture. It is suggested that Apodemus mice may be an important reservoir of Y. enterocolitica, and that there are foci of the pathogenic bioserotype 1B/O:8 in Aomori Prefecture, because human sporadic cases by the serotype have been reported in this prefecture.

  8. Overexpression of the NADP+-specific isocitrate dehydrogenase gene (icdA) in citric acid-producing Aspergillus niger WU-2223L.

    Kobayashi, Keiichi; Hattori, Takasumi; Hayashi, Rie; Kirimura, Kohtaro

    2014-01-01

    In the tricarboxylic acid (TCA) cycle, NADP(+)-specific isocitrate dehydrogenase (NADP(+)-ICDH) catalyzes oxidative decarboxylation of isocitric acid to form α-ketoglutaric acid with NADP(+) as a cofactor. We constructed an NADP(+)-ICDH gene (icdA)-overexpressing strain (OPI-1) using Aspergillus niger WU-2223L as a host and examined the effects of increase in NADP(+)-ICDH activity on citric acid production. Under citric acid-producing conditions with glucose as the carbon source, the amounts of citric acid produced and glucose consumed by OPI-1 for the 12-d cultivation period decreased by 18.7 and 10.5%, respectively, compared with those by WU-2223L. These results indicate that the amount of citric acid produced by A. niger can be altered with the NADP(+)-ICDH activity. Therefore, NADP(+)-ICDH is an important regulator of citric acid production in the TCA cycle of A. niger. Thus, we propose that the icdA gene is a potentially valuable tool for modulating citric acid production by metabolic engineering.

  9. Wu-Chia-Pi Solution Attenuates Carbon Tetrachloride-Induced Hepatic Injury through the Antioxidative Abilities of Its Components Acteoside and Quercetin

    Ching-Chiung Wang

    2012-12-01

    Full Text Available Wu-Chia-Pi medicated wine, composed nine Chinese medicines soaked in 35% alcohol, is widely used in Asia for its health-promoting functions. However, long-term consumption of alcohol could result in liver dysfunction. In this study, Wu-Chia-Pi solution (WCPS and extract (WCPE were prepared by modification of the principals given by the Committee on Chinese Medicine and Pharmacy in Taiwan. The aim of this study was to explore the protective effect of WCPS against carbon tetrachloride (CCl4-induced liver injury and to clarify its active component(s. Antioxidative effects of the test samples were evaluated via MDA inhibition, catalase activity and DPPH-scavenging assays. HPLC was used to analysis the active components. Results showed that WCPS (1 and 5 mL/kg significantly prevented CCl4-induced liver injury without chronic liver toxicity. Referring to the antioxidative activities, WCPE displayed significant MDA inhibitory and DPPH-scavenging activities with IC50 values of 0.91 ± 0.03 and 0.60 ± 0.04 mg/mL, respectively. Catalase activity was also enhanced by treatment of WCPE, acteoside and quercetin. Therefore, we suggest that acteoside and quercetin are the major contributors to the antioxidative and hepatoprotective activities of WCPS, and a possible mechanism could be mediated through reduction of oxidative stress.

  10. Tentative characterization of precursor compounds and co-factors of pigment formation in production of 'wu mi' from Vaccinium bracteatum Thunb. Leaves.

    Fan, Mingcong; Fan, Yihui; Huang, Weiping; Wang, Li; Li, Yan; Qian, Haifeng; Zhang, Hui; Qi, Xiguang

    2018-10-01

    Vaccinium bracteatum leaves (VBTL) are traditionally used in China to dye rice grains, which assume a deep blue color, named 'Wu mi'. Information on the mechanism of pigment formation is limited. In this study, CIELAB color space parameters were used to represent the color of 'Wu mi'. Precursor compounds of pigments formed during the dyeing process were identified by UPLC Q-TOF MS analysis. The changes in co-factors for pigment formation in VBTL were measured at different growth stages. The L ∗ and b ∗ values of dyed rice increased as the leaves aged, whereas a ∗ values showed irregular changes. Six compounds were tentatively identified as pigment precursors by UPLC Q-TOF MS analysis. The pH and β-glucosidase activity at different growth stages of VBTL were indicated to be crucial co-factors for pigment formation. A tentative hypothesis is presented that iridoid glycosides are hydrolyzed by acids and β-glucosidases to form a dialdehyde structure that binds covalently with amino residues of lysine side chains in rice protein molecules. Copyright © 2018 Elsevier Ltd. All rights reserved.

  11. Synthesis and photoluminescence of Sm3+ doped alkali alkaline earth borate hosts NaBa4 (BO3)3 and LiSr4(BO3)3

    Chauhan, A.V.; Nagpure, P.A.; Omanwar, S.K.

    2012-01-01

    In this paper we report the photoluminescence of Sm 3+ doped alkali alkaline borate hosts NaBa 4 (BO 3 ) 3 and LiSr 4 (BO 3 ) 3 . For the synthesis of alkali alkaline borate hosts NaBa 4 (BO 3 ) 3 and LiSr 4 (BO 3 ) 3 doped with different concentrations of Sm 3+ ions, we used the novel combustion technique. The phase purity of the hosts was confirmed by the powder XRD technique. The photoluminescence of the phosphors were carried out within 300 to 700 nm wavelength range. The phosphor shows intense orange red (602 nm) emission for near UV excitation. The FTIR spectra of the phase pure hosts have also been reported. (author)

  12. 3D Scrape-off layer modelling with BoRiS

    Riemann, J.; Borchardt, M.; Schneider, R.; Mutzke, A.

    2005-01-01

    The 3D fluid transport code BoRiS is applied to a hydrogen plasma and a neutral fluid in a stellarator-like geometry equipped with a poloidal ring limiter. The results demonstrate the capability of dealing with 3D effects which can be related to both the influence of the geometry and the plasma-neutral interaction as well. The setup used has similarities with a poloidal gas target in a fusion device

  13. Giorgio Agamben's inclusive exclusion of Étienne De la Boétie

    Flohr, Mikkel

    2017-01-01

    This paper analyzes the significance of Étienne de La Boétie’s appearance and subsequent disappearance in the introduction to Giorgio Agamben’s Homo Sacer: Sovereign Power and Bare Life. The introduction to the first installment of the Homo Sacer-series is a significant document, which establishes...... of Agamben’s political thought to be that of the sovereign exception....

  14. Small-molecule quinolinol inhibitor identified provides protection against BoNT/A in mice.

    Padma Singh

    Full Text Available Botulinum neurotoxins (BoNTs, etiological agents of the life threatening neuroparalytic disease botulism, are the most toxic substances currently known. The potential for the use as bioweapon makes the development of small-molecule inhibitor against these deadly toxins is a top priority. Currently, there are no approved pharmacological treatments for BoNT intoxication. Although an effective vaccine/immunotherapy is available for immuno-prophylaxis but this cannot reverse the effects of toxin inside neurons. A small-molecule pharmacological intervention, especially one that would be effective against the light chain protease, would be highly desirable. Similarity search was carried out from ChemBridge and NSC libraries to the hit (7-(phenyl(8-quinolinylaminomethyl-8-quinolinol; NSC 84096 to mine its analogs. Several hits obtained were screened for in silico inhibition using AutoDock 4.1 and 19 new molecules selected based on binding energy and Ki. Among these, eleven quinolinol derivatives potently inhibited in vitro endopeptidase activity of botulinum neurotoxin type A light chain (rBoNT/A-LC on synaptosomes isolated from rat brain which simulate the in vivo system. Five of these inhibitor molecules exhibited IC(50 values ranging from 3.0 nM to 10.0 µM. NSC 84087 is the most potent inhibitor reported so far, found to be a promising lead for therapeutic development, as it exhibits no toxicity, and is able to protect animals from pre and post challenge of botulinum neurotoxin type A (BoNT/A.

  15. Polimorfisme Genetik DNA Mikrosatellite GEN BoLA Lokus DRB3 Pada Sapi Bali (Bos Indicus)

    Puja , I Ketut; Wandia, I Nengah; Suastika, Putu; Sulabda, I Nyoman

    2011-01-01

    Tujuan penelitian ini adalah untuk mendapatkan informasi dasar mengenai distribusi frekuensi lokus DRB3 gen BoLa (bovine lymphocyte antigen) pada sapi Bali. Untuk isolasi DNA digunakan sampel darah sapi Bali yang diambil dari populasi sapi Bali yang berasal dari Bali dan sapi Bali yang berasal dari Nusa Penida. Jumlah sampel untuk sapi Bali yang berasal dari Bali adalah 22 ekor dan sapi yang berasal dari Nusa Penida 21 ekor. Jumlah allel lokus DRB3 pada sapi...

  16. Moessbauer diffraction study of the Neel phase transition in Fe3BO6 crystal

    Kovalenko, P.P.; Labushkin, V.G.; Sarkisov, Eh.R.; Tolpekin, I.G.

    1987-01-01

    Phase transitions in a 57 Fe 3 BO 6 monocrystal in the vicinity of the Neel point, T N =507.5 K were investigated by means of the Moessbauergraphy. For the first time the relaxation type of Moessbauer spectra was observed near the phase transition point. First in the Moessbauer diffraction spectrum of the crystal the simultaneous presence of a component resulted from magnetic ordering and a paramagnetic component was observed

  17. Magnetic and dielectric properties of Fe3BO6 nanoplates prepared through self-combustion method

    Kalpana Kumari

    2017-12-01

    Full Text Available In the present investigation, a facile synthesis method is explored involving a self-combustion of a solid precursor mixture of iron oxide Fe2O3 and boric acid (H3BO3 using camphor (C10H16O as fuel in ambient air in order to form a single phase Fe3BO6 crystallites. X-ray diffraction (XRD, Field emission electron microscopy (FESEM, magnetic, and dielectric properties of as prepared sample are studied. From XRD pattern, a single phase compound is observed with an orthorhombic crystal structure (Pnma space group, with average crystallite size of 42nm. A reasonably uniform size distribution of the plates and self-assemblies is retained in the sample. A magnetic transition is observed in dielectric permittivity (at ∼445K and power loss (at ∼435K when plotted against temperature. A weak peak occurs near 330K due to the charge reordering in the sample. For temperatures above the transition temperature, a sharp increase of the dielectric loss is observed which occurs due to the presence of thermally activated charge carriers. A canted antiferromagnetic Fe3+ ordering in a Fe3BO6 lattice with a localized charge surface layer is an apparent source of exhibiting a ferroelectric feature in this unique example of a centrosymmetric compound. An induced spin current over the Fe sites thus could give rise to a polarization hysteresis loop. Due to the presence of both ferromagnetic as well as polarization ordering, Fe3BO6 behaves like a single phase multiferroic ceramics.

  18. The diffusion of cultural heritage through ICT: the case of the Boí valley portal

    Piero Berni Millet

    2003-04-01

    Full Text Available The Boí valley portal is a joint project involving different museums, institutions and universities in Catalonia with the aim of creating a virtual environment to include all of the cultural heritage of this small valley in the Pyrenees. The portal is not only a potential resource for cultural tourism, but also an art and history resource for secondary schools and universities, as well as a means of communication for the local community.

  19. Seasonality of Yersinia enterocolitica bioserotype 1B/O:8 infections in Poland.

    Rastawicki, W; Szych, J; Rokosz, N; Zacharczuk, K; Gierczyński, R

    2013-10-01

    Both serological and bacteriological investigations revealed a cyclic, seasonal pattern of Yersinia enterocolitica 1B/O8 infections in Poland during the years 2008–2011. A large increase in incidence was observed in the second quarter and a decrease in the third quarter of each year. Such seasonal changes were not seen in the case of infections caused by the other enteropathogenic Yersinia bioserotypes.

  20. Crystal structure of a new polar borate Na{sub 2}Ce{sub 2}[BO{sub 2}(OH)][BO{sub 3}]{sub 2} · H{sub 2}O with isolated boron triangles

    Topnikova, A. P.; Belokoneva, E. L., E-mail: elbel@geol.msu.ru; Dimitrova, O. V.; Volkov, A. S. [Moscow State University, Faculty of Geology (Russian Federation)

    2016-11-15

    Crystals of a new polar borate Na{sub 2}Ce{sub 2}[BO{sub 2}(OH)][BO{sub 3}]{sub 2} · H{sub 2}O were prepared by hydrothermal synthesis. The crystals are orthorhombic, a = 7.2295(7) Å, b = 11.2523(8) Å, c = 5.1285(6) Å, Z = 2, sp. gr. C2mm (Amm2), R = 0.0253. The formula of the compound was derived from the structure determination. The Ce and Na atoms are coordinated by nine and six O atoms, respectively. The Ce position is split, and a small amount of Ce is incorporated into the Na1 site with the isomorphous substitution for Na. The anionic moieties exist as isolated BO{sub 3} and BO{sub 2}(OH) triangles. The planes of the BO{sub 2}(OH) triangles with mm2 symmetry are parallel to the ab plane. The planes of the BO{sub 3} triangles with m symmetry are perpendicular to the ab plane and are rotated in a diagonal way. The splitting of the Ce positions and the polar arrangement of the BO{sub 2}(OH) triangles, water molecules, and Na atoms are observed along the polar a axis. The new structure is most similar to the new borate NaCa{sub 4}[BO{sub 3}]{sub 3} (sp. gr. Ama2), in which triangles of one type are arranged in a polar fashion along the c axis. Weak nonlinear-optical properties of both polar borates are attributed to the quenching of the second-harmonic generation due to the mutually opposite orientation of two-thirds of B triangles in the unit cell.

  1. Yb3+:Sr3Y2(BO3)4: A potential ultrashort pulse laser crystal

    Sun, Shijia; Xu, Jinlong; Wei, Qi; Lou, Fei; Huang, Yisheng; Yuan, Feifei; Zhang, Lizhen; Lin, Zhoubin; He, Jingliang; Wang, Guofu

    2015-01-01

    Highlights: • A Yb 3+ :Sr 3 Y 2 (BO 3 ) 4 crystal was grown successfully by Czochralski method. • The crystal has wide absorption and emission bandwidth. • 3.47 W continuous wave laser output with a slope efficiency of 29% was obtained. • The results show that the crystal is a promising ultrashort pulse laser material. - Abstract: A Yb 3+ :Sr 3 Y 2 (BO 3 ) 4 crystal was grown successfully by the Czochralski method. The polarized spectral properties and continuous wave laser output of this crystal were investigated in detail. The crystal has larger absorption and emission cross sections compared with many mature Yb 3+ -doped borate crystals. The full width at half maximum of the emission bands around 1023 nm are 69 nm (E//a), 61 nm (E//b) and 65 nm (E//c). 3.47 W continuous wave laser output with a slope efficiency of 29% and an optical conversion efficiency of 24% was obtained. The results reveal that Yb 3+ :Sr 3 Y 2 (BO 3 ) 4 crystal is an excellent candidate for ultrashort pulse laser crystal

  2. Moessbauer determination of magnetic structure of Fe3BO6 crystal

    Kovalenko, P.P.; Labushkin, V.G.; Ovsepyan, A.K.; Sarkisov, Eh.R.; Smirnov, E.V.; Prokopov, A.R.; Seleznev, V.N.

    1984-01-01

    The magnetic structure of a Fe 3 BO 6 crystal belonging to space group Dsub(2h)sup(16)(Psub(nma)) is determined by the Moessbauer γ-radiation diffraction. The bragg reflection (700) of Moessbauer 14.4 keV γ-quanta from the Fe 3 BO 6 monocrystal has been studied experimentally. A high sensitivity of the interference of γ-quantum diffraction scattering on Fe nuclei being in crystallographically non-equivalent 8d- and 4s-positions to the type of magnetic ordering in the crystal is used for determination of the magnetic structure. Agreement of the experimental results with the theoretical calculations, conducted for types of magnetic ordering resolved by the symmetry of the crystal, permitted to reliably determine the magnetic structure of this compound. The results obtained confirm the data of neutrondiffraction studies on magnetic ordering in Fe 3 BO 6 . Advantages of the Moessbauer-diffraction study, as compared to the magnetic neutrondiffraction method, in particular, for investigation of crystals, in which the hyperfine magnetic fields on Fe nuclei have different values, are revealed and discussed in detail

  3. Moessbauer determination of magnetic structure of Fe/sub 3/BO/sub 6/ crystal

    Kovalenko, P.P.; Labushkin, V.G.; Ovsepyan, A.K.; Sarkisov, Eh.R.; Smirnov, E.V.; Prokopov, A.R.; Seleznev, V.N.

    1984-10-01

    The magnetic structure of a Fe/sub 3/BO/sub 6/ crystal belonging to space group Dsub(2h)sup(16)(Psub(nma)) is determined by the Moessbauer ..gamma..-radiation diffraction. The bragg reflection (700) of Moessbauer 14.4 keV ..gamma..-quanta from the Fe/sub 3/BO/sub 6/ monocrystal has been studied experimentally. A high sensitivity of the interference of ..gamma..-quantum diffraction scattering on Fe nuclei being in crystallographically non-equivalent 8d- and 4s-positions to the type of magnetic ordering in the crystal is used for determination of the magnetic structure. Agreement of the experimental results with the theoretical calculations, conducted for types of magnetic ordering resolved by the symmetry of the crystal, permitted to reliably determine the magnetic structure of this compound. The results obtained confirm the data of neutrondiffraction studies on magnetic ordering in Fe/sub 3/BO/sub 6/. Advantages of the Moessbauer-diffraction study, as compared to the magnetic neutrondiffraction method, in particular, for investigation of crystals, in which the hyperfine magnetic fields on Fe nuclei have different values, are revealed and discussed in detail.

  4. Random mutagenesis of BoNT/E Hc nanobody to construct a secondary phage-display library.

    Shahi, B; Mousavi Gargari, S L; Rasooli, I; Rajabi Bazl, M; Hoseinpoor, R

    2014-08-01

    To construct secondary mutant phage-display library of recombinant single variable domain (VHH) against botulinum neurotoxin E by error-prone PCR. The gene coding for specific VHH derived from the camel immunized with binding domain of botulinum neurotoxin E (BoNT/E) was amplified by error-prone PCR. Several biopanning rounds were used to screen the phage-displaying BoNT/E Hc nanobodies. The final nanobody, SHMR4, with increased affinity recognized BoNT/E toxin with no cross-reactivity with other antigens especially with related BoNT toxins. The constructed nanobody could be a suitable candidate for VHH-based biosensor production to detect the Clostridium botulinum type E. Diagnosis and treatment of botulinum neurotoxins are important. Generation of high-affinity antibodies based on the construction of secondary libraries using affinity maturation step leads to the development of reagents for precise diagnosis and therapy. © 2014 The Society for Applied Microbiology.

  5. AHP 21: Architecture in The Bo, 'Brug Chu, and Co Ne Counties, Gannan Tibetan Autonomous Prefecture, Gansu

    Chos dbyings rdo rje ཆོས་དབྱིངས་རྡོ་རྗེ།

    2012-12-01

    Full Text Available Thirty-nine images of architecture in The bo, 'Brug chu, and Co ne counties (Gannan Tibetan Autonomous Prefecture, Gansu Province, China are presented. The author also relates his experiences of travelling through the area in 2010.

  6. Analysis of associations between major histocompatibility complex (BoLA) class I haplotypes and subclinical mastitis of dairy cows

    Aarestrup, Frank Møller; Jensen, N. E.; Østergård, H.

    1995-01-01

    The associations between BoLA class I haplotypes and subclinical mastitis were investigated using information on 333 cows from three different breeds and crossbreeds from 14 dairy herds in Denmark. Somatic cell count and bacteriological status were used as markers for subclinical mastitis....... Associations between BoLA class I haplotypes and IMI status were also determined. The association between BoLA class I haplotypes and subclinical mastitis was weak. The A10(W50), A11, A12(A30), A16, A19(A6), A21, A26, and A31(A30) alleles were associated with different markers of subclinical mastitis....... Susceptibility or resistance to the two bacteria categories was associated with different alleles. This study indicated that BoLA antigens may be involved in resistance to mastitis and that resistance may be specific for a particular pathogen....

  7. Linear optical properties of Ca4EuO(BO3)3 and Eu3+ : Ca4GdO(BO3)3 crystals

    Antic-Fidancev, E.; Lemaitre-Blaise, M.; Porcher, P.; Caramanian, A.; Aka, G.

    1998-01-01

    Full text: The title compounds are now intensively studied due to their quadratic nonlinear properties in view of applications, e.g. high power laser frequency conversion. Rare earth calcium oxoborates, Ca 4 REO(BO 3 ) 3 , constitute an isostructural family along the rare earth series with RE = La - Lu, Y included. These compounds crystallize in the monoclinic biaxial crystal system with Cm (N 8) space group. They are isostructural to the calcium fluoroborate Ca 5 (BO 3 ) 3 F which is related to the fluoroapatite structure Ca 5 (PO 4 ) 3 F. The rare earth ions are located in the distorted octahedron with C s point site symmetry in the mirror plane. Two types of distorted octahedral sites exist for calcium ions. The existence of some disorder between calcium and rare earth atoms is suspected from the structural analysis. Good optical quality crystals of europium (or gadolinium) oxoborate, EuCOB (GdCOB) have been grown from the stoichiometric melt by the Czochralski pulling method. From the luminescence of the Eu 3+ doped gadolinium or in the europium stoichiometric compound very complex emission spectra have been obtained. It principally depends on the preparation method of studied samples: i) for a monocrystalline sample, a single phase with a single site is observed; ii) for a polycrystalline sample complex feature occurs. It is probably due to an expanded disorder between calcium and rare earth atoms. Practically, there is one principal site corresponding to the low symmetry site of the rare earth as expected from the structural investigation. Other minor sites are attributed to the local distortion created around the active rare earth ion. The intensity of the emission lines of Eu 3+ used as a local structural probe related to these minor sites increases when the gadolinium in Ca 4 GdO(BO 0 ) 3 is substituted by lanthanum or yttrium ions. It seems therefore evident that the synthesis of these rare earth calcium oxoborates must be realised carefully. The crystal

  8. BoLA class I polymorphism and in vitro immune response to M. bovis antigens.

    Longeri, M; Polli, M; Ponti, W; Zanotti, M

    1993-01-12

    From a sample of 119 Friesian calves, serologically typed for BoLA class I, 47 subjects were chosen expressing 9 different MHC types (A6, A6.9, A10, A11, A14, A15, A30, W16, M103) with the same age and reared in the same farm conditions. The animals were s.c. injected with a water in oil suspension of killed M. bovis and the treatment was repeated two days later. Before the treatment and 21 days later, calves were bled and on PBM (peripheral blood mononuclear leucocytes) were performed the following tests: 1. Lymphocyte Stimulation with bovine and avian PPDs (Purified protein derivative of Mycobacterium bovis and Mycobacterium avium, respectively). 2. Phagocytic activity towards M. bovis. 3. Class II molecules expression on cell surface. 4. Percentage of leucocyte populations and subpopulations. In the in vitro Lymphocyte Stimulation test, all the animals and classes were responders. Animals bearing A10 BoLA class I presented c.p.m. (counts per minute) and index values higher than the other cattle; these values were significantly positively related both to bovine and avian PPDs (P celular de moleculas de clase II. 4. Porcentaje de poblaciones y de subpob-laciones de leucocitos. Todos los animales y todos los tipos de MHC dieron respuestas positivas en las pruebas de Stimulacion Lymphocitaria. Los animales que tenian la BoLA A10 presentaron valores de c.p.m. y indices mas altos de los demas animales. Estos valores se encontraron significativamente y positivamente relacionados sea a la PPD bovina que a la PPD avicola. Por medio de la analisis de varianzas se encontro que el tipo BoLA A14 muestraba una correlacion significativa y algo positiva con una mejor actividad fagocitaria. Los tipos de clase BoLA I no parecieron que influenzaran de manera appreciable el porcentaje de positividad por la clase II y el porcentaje de leucocitos en la sangre PBM. 1993 Blackwell Verlag GmbH.

  9. Luminescent properties of UV excitable blue emitting phosphors MSr4(BO3)3:Ce3+ (M = Li and Na)

    Guo Chongfeng; Ding Xu; Seo, Hyo Jin; Ren Zhaoyu; Bai Jintao

    2011-01-01

    Research highlights: → Novel blue emitting phosphors borate MSr 4 (BO 3 ) 3 (M = Li or Na) were prepared first. → Luminescent properties of phosphors borate MSr 4 (BO 3 ) 3 (M = Li or Na) were investigated extensively as candidates of blue emitting phosphor used for UV excited LED. → The optimal concentrations of dopant Ce 3+ ions in compound MSr 4 (BO 3 ) 3 (M = Li or Na) were determined as 0.05 for Li and x = 0.09 for Na excited by UV light respectively. - Abstract: A series of Ce 3+ doped novel borate phosphors MSr 4 (BO 3 ) 3 (M = Li or Na) were successfully synthesized by traditional solid-state reaction. The crystal structures and the phase purities of samples were characterized by powder X-ray diffraction. The optimal concentrations of dopant Ce 3+ ions in compound MSr 4 (BO 3 ) 3 (M = Li or Na) were determined through the measurements of photoluminescence spectra of phosphors. Ce 3+ doped phosphors MSr 4 (BO 3 ) 3 (M = Li or Na) show strong broad band absorption in UV spectral region and bright blue emission under the excitation of 345 nm light. In addition, the temperature dependences of emission spectra of M 1+x Sr 4-2x Ce x (BO 3 ) 3 (M = Li or Na) phosphors with optimal composition x = 0.05 for Li and x = 0.09 for Na excited under 355 nm pulse laser were also investigated. The experimental results indicate that the M 1+x Sr 4-2x Ce x (BO 3 ) 3 (M = Li or Na) phosphors are promising blue emitting phosphors pumped by UV light.

  10. Hypersensitive detection and quantitation of BoNT/A by IgY antibody against substrate linear-peptide.

    Tao Li

    Full Text Available Botulinum neurotoxin A (BoNT/A, the most acutely poisonous substance to humans known, cleave its SNAP-25 substrate with high specificity. Based on the endopeptidase activity, different methods have been developed to detect BoNT/A, but most lack ideal reproducibility or sensitivity, or suffer from long-term or unwanted interferences. In this study, we developed a simple method to detect and quantitate trace amounts of botulinum neurotoxin A using the IgY antibody against a linear-peptide substrate. The effects of reaction buffer, time, and temperature were analyzed and optimized. When the optimized assay was used to detect BoNT/A, the limit of detection of the assay was 0.01 mouse LD50 (0.04 pg, and the limit of quantitation was 0.12 mouse LD50/ml (0.48 pg. The findings also showed favorable specificity of detecting BoNT/A. When used to detect BoNT/A in milk or human serum, the proposed assay exhibited good quantitative accuracy (88% < recovery < 111%; inter- and intra-assay CVs < 18%. This method of detection took less than 3 h to complete, indicating that it can be a valuable method of detecting BoNT/A in food or clinical diagnosis.

  11. Characterization and mapping of LanrBo: a locus conferring anthracnose resistance in narrow-leafed lupin (Lupinus angustifolius L.).

    Fischer, Kristin; Dieterich, Regine; Nelson, Matthew N; Kamphuis, Lars G; Singh, Karam B; Rotter, Björn; Krezdorn, Nicolas; Winter, Peter; Wehling, Peter; Ruge-Wehling, Brigitte

    2015-10-01

    A novel and highly effective source of anthracnose resistance in narrow-leafed lupin was identified. Resistance was shown to be governed by a single dominant locus. Molecular markers have been developed, which can be used for selecting resistant genotypes in lupin breeding. A screening for anthracnose resistance of a set of plant genetic resources of narrow-leafed lupin (Lupinus angustifolius L.) identified the breeding line Bo7212 as being highly resistant to anthracnose (Colletotrichum lupini). Segregation analysis indicated that the resistance of Bo7212 is inherited by a single dominant locus. The corresponding resistance gene was given the designation LanrBo. Previously published molecular anchor markers allowed us to locate LanrBo on linkage group NLL-11 of narrow-leafed lupin. Using information from RNAseq data obtained with inoculated resistant vs. susceptible lupin entries as well as EST-sequence information from the model genome Lotus japonicus, additional SNP and EST markers linked to LanrBo were derived. A bracket of two LanrBo-flanking markers allows for precise marker-assisted selection of the novel resistance gene in narrow-leafed lupin breeding programs.

  12. BoHV-4-Based Vector Single Heterologous Antigen Delivery Protects STAT1(-/- Mice from Monkeypoxvirus Lethal Challenge.

    Valentina Franceschi

    2015-06-01

    Full Text Available Monkeypox virus (MPXV is the etiological agent of human (MPX. It is an emerging orthopoxvirus zoonosis in the tropical rain forest of Africa and is endemic in the Congo-basin and sporadic in West Africa; it remains a tropical neglected disease of persons in impoverished rural areas. Interaction of the human population with wildlife increases human infection with MPX virus (MPXV, and infection from human to human is possible. Smallpox vaccination provides good cross-protection against MPX; however, the vaccination campaign ended in Africa in 1980, meaning that a large proportion of the population is currently unprotected against MPXV infection. Disease control hinges on deterring zoonotic exposure to the virus and, barring that, interrupting person-to-person spread. However, there are no FDA-approved therapies against MPX, and current vaccines are limited due to safety concerns. For this reason, new studies on pathogenesis, prophylaxis and therapeutics are still of great interest, not only for the scientific community but also for the governments concerned that MPXV could be used as a bioterror agent. In the present study, a new vaccination strategy approach based on three recombinant bovine herpesvirus 4 (BoHV-4 vectors, each expressing different MPXV glycoproteins, A29L, M1R and B6R were investigated in terms of protection from a lethal MPXV challenge in STAT1 knockout mice. BoHV-4-A-CMV-A29LgD106ΔTK, BoHV-4-A-EF1α-M1RgD106ΔTK and BoHV-4-A-EF1α-B6RgD106ΔTK were successfully constructed by recombineering, and their capacity to express their transgene was demonstrated. A small challenge study was performed, and all three recombinant BoHV-4 appeared safe (no weight-loss or obvious adverse events following intraperitoneal administration. Further, BoHV-4-A-EF1α-M1RgD106ΔTK alone or in combination with BoHV-4-A-CMV-A29LgD106ΔTK and BoHV-4-A-EF1α-B6RgD106ΔTK, was shown to be able to protect, 100% alone and 80% in combination, STAT1(-/- mice

  13. Discovery of estrogen receptor α modulators from natural compounds in Si-Wu-Tang series decoctions using estrogen-responsive MCF-7 breast cancer cells.

    Liu, Li; Ma, Hongyue; Tang, Yuping; Chen, Wenxing; Lu, Yin; Guo, Jianming; Duan, Jin-Ao

    2012-01-01

    The binding between the estrogen receptor α (ER-α) and a variety of compounds in traditional Chinese formulae, Si-Wu-Tang (SWT) series decoctions, was studied using a stably-transfected human breast cancer cell line (MVLN). In 38 compounds tested from SWT series decoctions, the estrogen-like activity of 22 compounds was above 60% in 20 μg mL(-1). Furthermore, theoretical affinity of these compounds was certificated using the functional virtual screen of ER-α modulators by FlexX-Pharm. The accuracy of functional virtual screening of ER-α modulators could reach to 77.27%. The results showed that some compounds, such as organic acids and flavones in SWT series decoctions could be used as selective estrogen receptor modulators (SERMs) and could be selected for further development as potential agents for estrogen related diseases. Copyright © 2011 Elsevier Ltd. All rights reserved.

  14. Parameters for MDBK cell growth on microcarriers and BoHV-1 virus production

    Ethel C. Freitas

    2017-09-01

    Full Text Available Bovine herpes virus 1 (BoHV-1 is an important veterinary agent , which causes infectious bovine rhinotra-cheitis. This disease affects the respiratory tract or genitals, causing weight loss, reduced milk production and abor-tion. Several vaccines against BoHV-1 have been developed. In this paper, we study the parameters for MDBK growth on microcarriers (Cytodex 1 and for BoHV-1 virus production. The cell culture attached to microcarriers is an effi-cient method to enlarge the surface of cell growth and for large-scale cell production. Our studies reveal that MDBK adhered to MCs in 30 minutes and that initial agitation of culture did not influence on the efficiency of adhesion or cell growth. In our experiments, we detected no relevant influence of agitation on initial cell adhesion of MDBK to MCs. The maximum cell yield was similar to all initial conditions of agitation studied. The maximum yield obtained in culture started with 15, 20 and 30 cells / MC, was respectively.8.7 x105, 9.3 x105 and 9.8 x105 cells / ml . The cellular distribution on the MCs at the beginning of the culture was more heterogeneous in higher initial densities. After three medium exchanges during MDBK cell culture, the increase in the final yield was 100% higher than that from culture performed without medium change (0.93 x 106 cells / mL. Replacing 50% of the culture medium with fresh medium after 24 hours of growth, the concentration of glucose (5 mM and glutamine (1.8 mM were almost completely res-tored. In these studies, BoHV-1 infections of MDBK were performed after 48, 72 and 86 hours with daily exchanges of 50% of the medium. The increase in viral titer was proportional to the number of viable cells present at the time of infection. The best result of BoHV-1 production was achieved when the infection was performed from 86 hours of cell culture, reaching about 3.7 x108 (TCID50/ml after 24-48 hours of infection, being on average four times higher when compared to the

  15. Polimorfismos del gen BoLA-DRB3.2* en ganado criollo colombiano

    Darwin Hernández H.

    2013-10-01

    Full Text Available Objetivo. Caracterizar el polimorfismo del gen BoLA-DRB3.2* en las razas bovinas criollas y colombianas. Materiales y métodos. En 360 muestras de ADN de ocho razas bovinas criollas (Blanco Orejinegro, Casanareño, Costeño con Cuernos, Chino Santandereano, Caqueteño, Hartón del Valle, Romosinuano y San Martinero, dos razas sintéticas Colombianas (Lucerna y Velásquez y dos razas foráneas (Brahman y Holstein se evaluó el polimorfismo del gen BoLA-DRB3.2 mediante técnicas moleculares (PCR-RFLP; se calculó el número promedio de alelos (NPA, las frecuencias, la heterocigocidad esperada (He y observada (Ho, el equilibrio de Hardy-Weinberg, la estructura genética y los valores de FST y FIS. Resultados. El NPA fue 14.6 ± 3.8 siendo Caqueteño la raza con mayor NPA (25 y el menor el Chino Santandereano (10. Se encontraron 41 alelos BoLA-DRB3.2* los más frecuentes fueron *28, *37, *24, *23, *20, *27, *8, *16, *39 (0.17, 0.11, 0.10, 0.09, 0.09, 0.07, 0.07 y 0.06 respectivamente. Se encontró alta diversidad genética (He = 0.878 con mayor valor en Caqueteño (0.96 y menor en San Martinero (0.81. Todas las razas se encontraron en equilibrio de Hardy-Weinberg, se encontraron valores altamente significativos de diferenciación genética (FST= 0.044 y de coeficiente de endogamia (FIS = 0.249. Conclusiones. El ganado criollo colombiano posee alto polimorfismo del gen BoLA-DRB3.2* representado en los altos valores de NPA y diversidad génetica.

  16. UVB emitting LiSrBO3 phosphor for phototherapy lamp

    Kunghatkar, R. G.; Hemne, P. S.; Dhoble, S. J.

    2018-05-01

    LiSrBO3 doped Gadolinium have been synthesized by sol gel technique. The formation of host was confirmed by XRD techniques. The incorporation of Gd3+ was confirmed by photoluminescence (PL) characterization. The UVB emission is observed at 316 nm when UV excited by 274 nm. The second order emission are also observed in PL emission spectra at 612 nm and 627 nm. Energy band gap is found to be 5.81 eV by using Kubelka - Munk function. The UVB emission at 316 nm of Gd3+ doped materials are used as phototherapy lamp phosphor.

  17. Manje znani hrvatski kemičari. I. Božidar Rogina

    Trinajstić, N.

    2007-01-01

    A brief account of Professor Božidar Rogina's life is given. He was born on December 21, 1901 in Ivanjska near Bjelovar and died of a heart attack on January 20, 1967 in Zagreb. He graduated high school in 1919 in Zagreb and the same year entered the Department of Chemical Engineering of Technological College in Zagreb, but the following year (1920) Rogina moved to Prague, where in 1923 he obtained his degree in chemical engineering at the Technological College. He obtained his Ph. D. in 1931...

  18. HIGH REPETITION RATE MICROCHIP ER3+,YB3+:YAL3(BO34 DIODE-PUMPED LASER

    K. N. Gorbachenya

    2012-01-01

    Full Text Available Diode-pumped passively Q-switched microchip Er,Yb:YAl3(BO34 laser for range-finding has been demonstrated. By using a Co2+:MgAl2O4 as a saturable absorber TEM00–mode Q-switched average output power of 315 mW was demonstrated at 1522 nm with pulse duration of 5 ns and pulse energy of 5,25 μJ at a repetition rate of 60 kHz.

  19. Treatment of Common Cold Patients with the Shi-Cha Capsule: A Multicenter, Double-Blind, Randomized, Placebo-Controlled, Dose-Escalation Trial

    Chang, Jing; Dong, Shou-Jin; She, Bin; Zhang, Rui-Ming; Meng, Mao-Bin; Xu, Yan-Ling; Wan, Li-Ling; Shi, Ke-Hua; Pan, Jun-Hun; Mao, Bing

    2012-01-01

    This study was designed to determine the therapeutic efficacy and safety of the Shi-cha capsule, a Chinese herbal formula, in the treatment of patients with wind-cold type common cold. In our multi-center, prospective, double-blind, randomized, placebo-controlled, dose-escalation trial, patients with wind-cold type common cold received 0.6 g of Shi-cha capsule plus 0.6 g placebo (group A), 1.2 g of Shi-cha capsule (group B), or 1.2 g placebo (group C), three times daily for 3 days and followed up to 10 days. The primary end point was all symptom duration. The secondary end points were main symptom duration, minor symptom duration, the changes in cumulative symptom score, main symptom score, and minor symptom score 4 days after the treatment, as well as adverse events. A total of 377 patients were recruited and 360 met the inclusive criteria; 120 patients constituted each treatment group. Compared with patients in group C, patients in groups A and B had significant improvement in the all symptom duration, main symptom duration, minor symptom duration, as well as change from baseline of cumulative symptom score, main symptom score, and minor symptom score at day 4. The symptom durations and scores showed slight superiority of group B over group A, although these differences were not statistically significant. There were no differences in adverse events. The Shi-cha capsule is efficacious and safe for the treatment of patients with wind-cold type common cold. Larger trials are required to fully assess the benefits and safety of this treatment for common cold. PMID:23346193

  20. See Religious Influences from Su Shi and John Milton's Memorial Poems%苏轼与弥尔顿悼亡诗中不同的宗教影响

    Liu Lili; Li Feng

    2008-01-01

    Based on comparative study between the poetic works of John Milton and Su Shi,this thesis takes the only love sonnet of John Milton Methought l Saw My Late EspouscM Saint(On His Deceased Wife)and Su Shi's first memorial poem Jiangchengzi(Riverside Town)as examples tries to analyze the different religious influences between the two memorial poems.

  1. Kale BoRACK1 is involved in the plant response to salt stress and Peronospora brassicae Gaumann.

    Li, Da-Hong; Shen, Fu-Jia; Li, Hong-Yan; Li, Wei

    2017-06-01

    The receptor for activated C kinase 1 (RACK1) belongs to a protein subfamily containing a tryptophan-aspartic acid-domain (WD) repeat structure. Compelling evidence indicates that RACK1 can interact with many signal molecules and affect different signal transduction pathways. In this study, a kale (Brassica oleracea var. acephala f.tricolor) RACK1 gene (BoRACK1) was cloned by RT-PCR. The amino acid sequence of BoRACK1 had seven WD repeats in which there were typical GH (glycine-histidine) and WD dipeptides. Comparison with AtRACK1 from Arabidopsis revealed 87.1% identity at the amino acid level. Expression pattern analysis by RT-PCR showed that BoRACK1 was expressed in all analyzed tissues of kale and that its transcription in leaves was down-regulated by salt, abscisic acid, and H 2 O 2 at a high concentration. Overexpression of BoRACK1 in kale led to a reduction in symptoms caused by Peronospora brassicae Gaumann on kale leaves. The expression levels of the pathogenesis-related protein genes, PR-1 and PRB-1, increased 2.5-4-fold in transgenic kale, and reactive oxygen species production was more active than in the wild-type. They also exhibited increased tolerance to salt stress in seed germination. H 2 O 2 may also be involved in the regulation of BoRACK1 during seed germination under salt stress. Quantitative real-time PCR analyses showed that the transcript levels of BoRbohs genes were significantly higher in overexpression of BoRACK1 transgenic lines. Yeast two-hybrid assays showed that BoRACK1 could interact with WNK8, eIF6, RAR1, and SGT1. This study and previous work lead us to believe that BoRACK1 may form a complex with regulators of plant salt and disease resistance to coordinate kale reactions to pathogens. Copyright © 2017 Elsevier GmbH. All rights reserved.

  2. SHiP: a new facility for searching for long-lived neutral particles and studying the tau neutrino properties

    AUTHOR|(SzGeCERN)658186

    2016-01-01

    SHiP (Search for Hidden Particles) is a new general purpose fixed target facility, proposed at the CERN SPS accelerator. In its initial phase, the 400 GeV proton beam will be dumped on a heavy target, integrating $2\\times 10^{20}$ protons on target in 5 years. A dedicated detector located downstream of the target, based on a long vacuum tank and a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived neutral and very weakly interacting particles and masses below 10 GeV. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which the baryon asymmetry of the Universe could be explained. Direct detection of light and long-lived SUSY particles, such as RPV neutralinos and pseudo-Dirac gauginos could als...

  3. Cumulative approaches to track formation under swift heavy ion (SHI) irradiation: Phenomenological correlation with formation energies of Frenkel pairs

    Crespillo, M.L., E-mail: mcrespil@utk.edu [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Department of Materials Science & Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Agulló-López, F., E-mail: fal@uam.es [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain); Zucchiatti, A. [Centro de Microanálisis de Materiales, CMAM-UAM, Cantoblanco, Madrid 28049 (Spain)

    2017-03-01

    Highlights: • Extensive survey formation energies Frenkel pairs and electronic stopping thresholds. • Correlation: track formation thresholds and the energies for Frenkel pair formation. • Formation energies Frenkel pairs discussed in relation to the cumulative mechanisms. • Amorphous track formation mechanisms: defect accumulation models versus melting. • Advantages cumulative models to deal with new hot topics: nuclear-electronic synergy. - Abstract: An extensive survey for the formation energies of Frenkel pairs, as representative candidates for radiation-induced point defects, is presented and discussed in relation to the cumulative mechanisms (CM) of track formation in dielectric materials under swift heavy ion (SHI) irradiation. These mechanisms rely on the generation and accumulation of point defects during irradiation followed by collapse of the lattice once a threshold defect concentration is reached. The physical basis of those approaches has been discussed by Fecht as a defect-assisted transition to an amorphous phase. Although a first quantitative analysis of the CM model was previously performed for LiNbO{sub 3} crystals, we have, here, adopted a broader phenomenological approach. It explores the correlation between track formation thresholds and the energies for Frenkel pair formation for a broad range of materials. It is concluded that the threshold stopping powers can be roughly scaled with the energies required to generate a critical Frenkel pair concentration in the order of a few percent of the total atomic content. Finally, a comparison with the predictions of the thermal spike model is discussed within the analytical Szenes approximation.

  4. Extraction and inhibition of enzymatic activity of botulinum neurotoxins/A1, /A2, and /A3 by a panel of monoclonal anti-BoNT/A antibodies.

    Suzanne R Kalb

    Full Text Available Botulinum neurotoxins (BoNTs are extremely potent toxins that are capable of causing death or respiratory failure leading to long-term intensive care. Treatment includes serotype-specific antitoxins, which must be administered early in the course of the intoxication. Rapidly determining human exposure to BoNT is an important public health goal. In previous work, our laboratory focused on developing Endopep-MS, a mass spectrometry-based endopeptidase method for detecting and differentiating BoNT/A-G serotypes in buffer and BoNT/A, /B, /E, and /F in clinical samples. We have previously reported the effectiveness of antibody-capture to purify and concentrate BoNTs from complex matrices, such as clinical samples. Because some antibodies inhibit or neutralize the activity of BoNT, the choice of antibody with which to extract the toxin is critical. In this work, we evaluated a panel of 16 anti-BoNT/A monoclonal antibodies (mAbs for their ability to inhibit the in vitro activity of BoNT/A1, /A2, and /A3 complex as well as the recombinant LC of A1. We also evaluated the same antibody panel for the ability to extract BoNT/A1, /A2, and /A3. Among the mAbs, there were significant differences in extraction efficiency, ability to extract BoNT/A subtypes, and inhibitory effect on BoNT catalytic activity. The mAbs binding the C-terminal portion of the BoNT/A heavy chain had optimal properties for use in the Endopep-MS assay.

  5. Spectroscopic properties for identifying sapphire samples from Ban Bo Kaew, Phrae Province, Thailand

    Mogmued, J.; Monarumit, N.; Won-in, K.; Satitkune, S.

    2017-09-01

    Gemstone commercial is a high revenue for Thailand especially ruby and sapphire. Moreover, Phrae is a potential gem field located in the northern part of Thailand. The studies of spectroscopic properties are mainly to identify gemstone using advanced techniques (e.g. UV-Vis-NIR spectrophotometry, FTIR spectrometry and Raman spectroscopy). Typically, UV-Vis-NIR spectrophotometry is a technique to study the cause of color in gemstones. FTIR spectrometry is a technique to study the functional groups in gem-materials. Raman pattern can be applied to identify the mineral inclusions in gemstones. In this study, the natural sapphires from Ban Bo Kaew were divided into two groups based on colors including blue and green. The samples were analyzed by UV-Vis-NIR spectrophotometer, FTIR spectrometer and Raman spectroscope for studying spectroscopic properties. According to UV-Vis-NIR spectra, the blue sapphires show higher Fe3+/Ti4+ and Fe2+/Fe3+ absorption peaks than those of green sapphires. Otherwise, green sapphires display higher Fe3+/Fe3+ absorption peaks than blue sapphires. The FTIR spectra of both blue and green sapphire samples show the absorption peaks of -OH,-CH and CO2. The mineral inclusions such as ferrocolumbite and rutile in sapphires from this area were observed by Raman spectroscope. The spectroscopic properties of sapphire samples from Ban Bo Kaew, Phrae Province, Thailand are applied to be the specific evidence for gemstone identification.

  6. Spontaneous and stimulated emission in Sm3+-doped YAl3(BO3)4 single crystal

    Ryba-Romanowski, Witold; Lisiecki, Radosław; Beregi, Elena; Martín, I.R.

    2015-01-01

    Single crystals of YAl 3 (BO 3 ) 4 doped with trivalent samarium were grown by the top-seeded high temperature solution method and their absorption and emission spectra were investigated. Optical pumping into prominent absorption band around 405 nm feeds the 4 G 5/2 metastable level giving rise to intense visible luminescence distributed in several spectral lines with the most intense line around 600 nm characterized by a branching ratio of 0.42 and peak emission cross section of 0.25×10 −20 cm 2 . Optical amplification at 600 nm with a gain coefficient of 2.9 cm −1 was achieved during a pump-and-probe experiment. - Highlights: • YAB:Sm crystal grown by the top-seeded high temperature solution method. • Spectroscopic qualities relevant for visible laser operation. • YAB:Sm single crystal used in a pump-and-probe experiment. • Optical amplification properties of samarium doped YAl 3 (BO 3 ) 4

  7. Systematics in the electron transport and magnetic properties of LnBO3 perovskites

    Ganguly, P.; Rao, C.N.R.

    1980-01-01

    Systematics in the electrical and magnetic properties of transition metal perovskites LnBO 3 (Ln = rare-earth ion, B = 3d transition metal) with the variation of Ln and B ions are reviewed. The electrical resistivity and activation energy of LnBO 3 compounds increase with the decreasing size of the Ln 3+ ion for a given B ion. The low-spin to high-spin transition temperature of Co 3+ ion in LnCoO 3 similarly increase with the decrease in size of Ln 3+ while the magnetic ordering temperatures in LnVO 3 , LnFeO 3 , LnCrO 3 and LnSrCo 2 O 6 decrease with decreasing size of the rare-earth ion. These results may be understood in terms of the increasing acidity of the rare earth ion with decreasing size and the competition between the Ln 3+ and the B 3+ ions for covalency with the oxygen ions. The effect of this competition on the metal oxygen covalency and crystal field parameter is discussed in relation to the results obtained and Goodenough's phase diagram. The possibility of d-f exchange interaction in Lasub(1-x)Lnsub(x)NiOsub(3) is also discussed in the light of ESR results. (auth.)

  8. Crystal growth, electronic structure and optical properties of Sr2Mg(BO3)2

    Lv, Xianshun; Wei, Lei; Wang, Xuping; Xu, Jianhua; Yu, Huajian; Hu, Yanyan; Zhang, Huadi; Zhang, Cong; Wang, Jiyang; Li, Qinggang

    2018-02-01

    Single crystals of Sr2Mg(BO3)2 (SMBO) were grown by Kyropoulos method. X-ray powder diffraction (XRD) analysis, transmission spectrum, thermal properties, band structure, density of states and charge distribution as well as Raman spectra of SMBO were described. The as-grown SMBO crystals show wide transparency range with UV cut-off below 180 nm. A direct band gap of 4.66 eV was obtained from the calculated electronic structure results. The calculated band structure and density of states results indicated the top valence band is determined by O 2p states whereas the low conduction band mainly consists of Sr 5s states. Twelve Raman peaks were observed in the experimental spectrum, fewer than the number predicted by the site group analysis. Raman peaks of SMBO were assigned combining first-principle calculation and site group analysis results. The strongest peak at 917 cm-1 in the experimental spectrum is assigned to symmetric stretching mode A1‧(ν1) of free BO3 units. SMBO is a potential Raman crystal which can be used in deep UV laser frequency conversion.

  9. BoA 2 and 3 - Implementation of an innovative power plant concept and first operational experience

    Elsen, Reinhold O. [RWE Power AG, Essen (Germany). Research and Development; Schoeddert, Guido [RWE Power AG, Grevenbroich (Germany). BoA Neurath; Hensel, Manfred [RWE Technology GmbH, Grevenbroich (Germany). Site Management

    2013-04-01

    Units F and G of RWE Powers Neurath power plant have been in commercial operation since the summer of 2012. After Niederaussem K, they are the second and third units equipped with BoA technology (BoA = lignite-fired power plant with optimised plant technology). The BoA approach comprises e.g. optimisation measures in connection with the steam turbine, elevated steam parameters, lean design of thick-walled parts in the steam generator, improvements to the auxiliary power consumption, and heat recovery from the flue gases. With a gross rating of 1,100 MW (1,050 MW net) each has a net design efficiency of more than 43% they are the biggest and most modern lignite-fired power plants worldwide.

  10. Comparison of nested PCR and qPCR for the detection and quantitation of BoHV6 DNA.

    Kubiś, Piotr; Materniak, Magdalena; Kuźmak, Jacek

    2013-12-01

    Nested PCR and qPCR (quantitative PCR) tests based on glycoprotein B (gB) gene were designed for detecting Bovine herpesvirus 6 (BoHV6) in bovine whole blood samples and wild ruminant blood clots (deer and roe-deer). This virus, commonly known as BLHV (bovine lymphotropic herpesvirus) belongs to the Herpesviridae family, subfamily Gammaherpesvirinae and Macavirus genus. DNA isolated from 92 dairy cow blood samples and 69 wild ruminant clots were examined for the presence of BoHV6 using nested PCR and qPCR tests. Viral DNA was detected by using nested PCR in 59 out of 92 bovine blood samples (64.1%), and by qPCR in 68 out of 92 bovine blood samples (73.9%), but none out of 69 DNA samples isolated from wild ruminant blood clots, was positive in both assays. The specificity of nested PCR and qPCR was confirmed by using BoHV1, BoHV4, BoHV6, BFV, BIV, and BLV DNA. The sensitivity of nested PCR and qPCR was determined using a serially 10-fold diluted vector pCR2.1HgB (2 × 10(0)-2 × 10(6)copies/reaction). In this testing, qPCR was more sensitive than the nested PCR, detecting two copies of BoHV6 whilst the limit of detection for nested PCR was 20 copies. In all qPCR assays, the coefficients of determination (R(2)) ranged between 0.990 and 0.999, and the calculated amplification efficiencies (Eff%) within the range of 89.7-106.9. The intra- and inter-assay CV (coefficient of variation) values did not exceed 4%. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. İstanbul’da 1999 Yılında Sonuçlanmış Boşanma Davalarında Boşanma Nedenlerinin Değerlendirilmesi

    Halim Dişsever

    2000-12-01

    Full Text Available Bu çalışmada İstanbul'da 1999 yılında sonuçlanmış boşanma davalarından rastlantısal örnekleme yöntemiyle seçilen 3060 boşanma olgusu incelenerek, boşanma nedenleri ve diğer değişkenler arasındaki ilişkilerin değerlendirilmesi amaçlanmıştır İncelenen ve davası sonuçlanmış toplam 3060 boşanma davasının %67.1’si kailin (2053, %32.9'u (1007 erkek taralından açılmıştır, boşanma nedenlerine göre dağılım incelendiğinde ilk sırayı şiddetli geçimsizlik, ikinci sırayı alkol kötüye kullanımı, üçüncü sırayı cana kast ve pek fena muamele. i sırayı ise terk boşanma nedeninin aldığı görülmektedir. Boşanan çiftlerin %41.6 sı (1272 çift çocuksuz olup. %40.4 ü (12.36 çift evliliklerinin ilk 5 yılı içinde boşanmışlardır. Çocukların çoğunun yaşları küçük olduğundan velayetlerin annelere verilme oranı daha yüksektir. Olguların %7.6’smıla (233 çift eşlerden birinin, %28.2’ sinde (864 çift her ikisinin İstanbul nüfusuna kayıtlı olduğu, %64.2’sinde (196.3 çift her ikisinin nüfus kaydının İstanbul dışında olduğu saptanmıştır. Boşanma sonrası eşler ve çocukları ruhsal ve ekonomik sorunlarla karşı karşıya kalmaktadır. Sosyal güvenceleri, eşlerin nafaka durumları, işsizlik ve çocukların eğitini durumu göz önüne alındığında sosyal destek mekanizmalarının daha ila güçlendirilmesi toplum ruh sağlığı açısından faydalı olacaktır. Anahtar Kelimeler: Boşanma, boşanma nedenleri.

  12. A Density Functional Theory Study of the Ionic and Electronic Transport Mechanisms in LiFeBO3 Battery Electrodes

    Loftager, Simon; García Lastra, Juan Maria; Vegge, Tejs

    2016-01-01

    electrochemical effects can be explained by an intrinsically low Li-ion and electron/hole-polaron mobility in Li0.5FeBO3 due to high activation barriers for both the ionic and electronic transport. These studies include the effects of the experimentally reported commensurate modulation. We have also investigated...... with the formation of intermediate phases is linked to the intrinsically poor properties of the Li0.5FeBO3 phase rather than to the presence of interfaces between different phases....

  13. Genetics and fine mapping of a purple leaf gene, BoPr, in ornamental kale (Brassica oleracea L. var. acephala).

    Liu, Xiao-Ping; Gao, Bao-Zhen; Han, Feng-Qing; Fang, Zhi-Yuan; Yang, Li-Mei; Zhuang, Mu; Lv, Hong-Hao; Liu, Yu-Mei; Li, Zhan-Sheng; Cai, Cheng-Cheng; Yu, Hai-Long; Li, Zhi-Yuan; Zhang, Yang-Yong

    2017-03-14

    Due to its variegated and colorful leaves, ornamental kale (Brassica oleracea L. var. acephala) has become a popular ornamental plant. In this study, we report the fine mapping and analysis of a candidate purple leaf gene using a backcross population and an F 2 population derived from two parental lines: W1827 (with white leaves) and P1835 (with purple leaves). Genetic analysis indicated that the purple leaf trait is controlled by a single dominant gene, which we named BoPr. Using markers developed based on the reference genome '02-12', the BoPr gene was preliminarily mapped to a 280-kb interval of chromosome C09, with flanking markers M17 and BoID4714 at genetic distances of 4.3 cM and 1.5 cM, respectively. The recombination rate within this interval is almost 12 times higher than the usual level, which could be caused by assembly error for reference genome '02-12' at this interval. Primers were designed based on 'TO1000', another B. oleracea reference genome. Among the newly designed InDel markers, BRID485 and BRID490 were found to be the closest to BoPr, flanking the gene at genetic distances of 0.1 cM and 0.2 cM, respectively; the interval between the two markers is 44.8 kb (reference genome 'TO1000'). Seven annotated genes are located within the 44.8 kb genomic region, of which only Bo9g058630 shows high homology to AT5G42800 (dihydroflavonol reductase), which was identified as a candidate gene for BoPr. Blast analysis revealed that this 44.8 kb interval is located on an unanchored scaffold (Scaffold000035_P2) of '02-12', confirming the existence of assembly error at the interval between M17 and BoID4714 for reference genome '02-12'. This study identified a candidate gene for BoPr and lays a foundation for the cloning and functional analysis of this gene.

  14. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P.; Asokan, K.; Krishna, J.B.M.; Dhanasekaran, R.

    2013-01-01

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au 9+ ions at room temperature with fluences of 1 × 10 12 and 5 × 10 12 ions/cm 2 . The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail

  15. Effect of SHI irradiation on structural, surface morphological and optical studies of CVT grown ZnSSe single crystals

    Kannappan, P. [Crystal Growth Centre, Anna University, Chennai 600 025 (India); Asokan, K. [Inter University Accelerator Centre, Aruna Asaf Ali Marg, New Delhi 110 067 (India); Krishna, J.B.M. [UGC-DAE Consortium for Scientific Research, III-/LB-8, Bidhan nagar, Kolkata 700 098 (India); Dhanasekaran, R., E-mail: rdcgc@yahoo.com [Crystal Growth Centre, Anna University, Chennai 600 025 (India)

    2013-12-15

    Highlights: •CVT grown ZnSSe single crystals were irradiated with 120 MeV Au ion. •The GIXRD results show the FWHM increases with increasing ion fluency. •The AFM study show the surface roughness increases with ion fluency. •The optical band gap energy vary with increasing ion fluency. •The PL emission decreases with increasing ion fluency. -- Abstract: The ZnSSe single crystals grown by chemical vapour transport (CVT) method have been irradiated by 120 MeV Au{sup 9+} ions at room temperature with fluences of 1 × 10{sup 12} and 5 × 10{sup 12} ions/cm{sup 2}. The grazing incidence X-ray diffraction (GIXRD) results show that the full width at half maximum (FWHM) value for the as grown ZnSSe crystal is 0.215°; and for the irradiated samples, the FWHM values are 0.413° and 0.625°, with the increase of ion fluences. The atomic force microscopy (AFM) studies reveal the formation of the pits and islands due to irradiation. The optical absorption cut off wavelength is found to be 441 nm for as grown ZnSSe crystal. The cut off values are increased to 447 nm and 457 nm for the irradiated samples with increasing ion fluency. The photoluminescence studies show the emission for the as grown ZnSSe is 590 nm whereas for the irradiated samples in the emission range it is 580–590 nm and 575–595 nm due to SHI irradiation. FT-Raman spectra analysis has been made for the ZnSSe single crystals and irradiated samples. The results are discussed in detail.

  16. Bridging the Divide: Literature, Dao and the Case for Subjective Access in the Thought of Su Shi

    Curie Virág

    2014-10-01

    Full Text Available In the 11th century in China, there was an unusual moment in which a number of philosophers, later associated with the Daoxue—or Neo-Confucian—school, confronted what they perceived as a long-standing sense of disjunction between inner, subjective reality and the structured patterns of the cosmos. One way they sought to overcome this disjunction was by positing new theories of the cosmos that focused on the underlying, shared reality behind the myriad differentiations of phenomena. A potential tension was born that affected how thinkers understood the relationship between wen 文 (writing, literature, culture and Dao 道 (the cosmic process, the ultimate reality, the normative path. Some thinkers, like Zhou Dunyi 周敦頤 (1017–1073, believed that wen was simply a vehicle for carrying the Dao, and was thus, implicitly, dispensable. This idea was met with resistance from one of the leading intellectual figures of the time—the philosopher, poet and statesman Su Shi 蘇軾 (1037–1101. While some of Su’s contemporaries, in their attempts to demonstrate that the world was real, and that truth was knowable, downplayed the role of individual experience and perception, Su stressed the necessity of subjective, individual experience as giving access, and concrete expression, to Dao. Su’s philosophical project came in the form of defending the enterprise of wen—writing as a creative, individual endeavor—and asserting that the quest for unity with the Dao could only be realized through direct, personal engagement in wen and other forms of meaningful practice. Through his philosophy of wen, Su sought to show that the search for truth, meaning and order did not—and could not—be achieved by transcending subjective experience. Instead, it had to be carried out at the point of encounter between self and the world, in the realm of practice.

  17. Structural and Biochemical Characterization of BdsA from Bacillus subtilis WU-S2B, a Key Enzyme in the “4S” Desulfurization Pathway

    Tiantian Su

    2018-02-01

    Full Text Available Dibenzothiophene (DBT and their derivatives, accounting for the major part of the sulfur components in crude oil, make one of the most significant pollution sources. The DBT sulfone monooxygenase BdsA, one of the key enzymes in the “4S” desulfurization pathway, catalyzes the oxidation of DBT sulfone to 2′-hydroxybiphenyl 2-sulfonic acid (HBPSi. Here, we determined the crystal structure of BdsA from Bacillus subtilis WU-S2B, at the resolution of 2.2 Å, and the structure of the BdsA-FMN complex at 2.4 Å. BdsA and the BdsA-FMN complex exist as tetramers. DBT sulfone was placed into the active site by molecular docking. Seven residues (Phe12, His20, Phe56, Phe246, Val248, His316, and Val372 are found to be involved in the binding of DBT sulfone. The importance of these residues is supported by the study of the catalytic activity of the active site variants. Structural analysis and enzyme activity assay confirmed the importance of the right position and orientation of FMN and DBT sulfone, as well as the involvement of Ser139 as a nucleophile in catalysis. This work combined with our previous structure of DszC provides a systematic structural basis for the development of engineered desulfurization enzymes with higher efficiency and stability.

  18. The complete mitochondrial genome of the styloperlid stonefly species Styloperla spinicercia Wu (Insecta: Plecoptera) with family-level phylogenetic analyses of the Pteronarcyoidea.

    Wang, Ying; Cao, Jinjun; Li, Weihai

    2017-03-13

    We present the complete mitochondrial (mt) genome sequence of the stonefly, Styloperla spinicercia Wu, 1935 (Plecoptera: Styloperlidae), the type species of the genus Styloperla and the first complete mt genome for the family Styloperlidae. The genome is circular, 16,129 base pairs long, has an A+T content of 70.7%, and contains 37 genes including the large and small ribosomal RNA (rRNA) subunits, 13 protein coding genes (PCGs), 22 tRNA genes and a large non-coding region (CR). All of the PCGs use the standard initiation codon ATN except ND1 and ND5, which start with TTG and GTG. Twelve of the PCGs stop with conventional terminal codons TAA and TAG, except ND5 which shows an incomplete terminator signal T. All tRNAs have the classic clover-leaf structures with the dihydrouridine (DHU) arm of tRNASer(AGN) forming a simple loop. Secondary structures of the two ribosomal RNAs are presented with reference to previous models. The structural elements and the variable numbers of tandem repeats are described within the control region. Phylogenetic analyses using both Bayesian (BI) and Maximum Likelihood (ML) methods support the previous hypotheses regarding family level relationships within the Pteronarcyoidea. The genetic distance calculated based on 13 PCGs and two rRNAs between Styloperla sp. and S. spinicercia is provided and interspecific divergence is discussed.

  19. Si-Wu-tang extract stimulates bone formation through PI3K/Akt/NF-κB signaling pathways in osteoblasts.

    Wu, Chi-Ming; Chen, Po-Chun; Li, Te-Mao; Fong, Yi-Chin; Tang, Chih-Hsin

    2013-10-24

    Si-Wu-Tang (SWT), a Traditional Chinese Medicine (TCM) formula, is widely used for the treatment of gynopathies diseases such as menstrual discomfort, climacteric syndrome, dysmenorrhea, and other estrogen-related diseases. Recent studies have shown that SWT can treat primary dysmenorrhea, have anti-pruritic anti-inflammatory effects, and protect against radiation-induced bone marrow damage in an animal model. It has been reported that anti-inflammatory and anti-oxidant agents have the potential to treat osteoporosis by increasing bone formation and/or suppressing bone resorption. However, the effect of SWT on bone cell function has not yet been reported. Alkaline phosphatase (ALP), bone morphogenetic proteins (BMP)-2, and osteopontin (OPN) mRNA expression was analyzed by qPCR. The mechanism of action of SWT extract was investigated using western blotting. The in vivo anti-osteoporotic effect of SWT extract was assessed in ovariectomized mice. Here, we report that SWT increases ALP, BMP-2, and OPN expression as well as bone mineralization. In addition, we show that the PI3K, Akt, and NF-κB signaling pathways may be involved in the SWT-mediated increase in gene expression and bone mineralization. Notably, treatment of mice with SWT extract prevented bone loss induced by ovariectomy in vivo. SWT may be used to stimulate bone formation for the treatment of osteoporosis.

  20. Identification of Multiple Ingredients for a Traditional Chinese Medicine Preparation (Bu-yang-huan-wu-tang by Liquid Chromatography Coupled with Tandem Mass Spectrometry

    Tung-Hu Tsai

    2013-09-01

    Full Text Available Bu-yang-huan-wu-tang (BYHWT is a popular Traditional Chinese Medicine formula consisting of seven herbal medicines (Astragalus membranaceus, Angelica sinensis, Paeonia lactiflora, Ligusticum chuanxiong, Carthamus tinctorius, Amygdalus persica and Pheretima aspergillum, that has been used in China for centuries to overcome stroke-induced disability. To ensure the consistency of quality, a reliable analytical method is required, therefore, we developed a liquid chromatography with tandem mass spectrometry (LC-MS/MS method for quantitative analysis of the major constituents in BYHWT. The herbal ingredients consisting of the cycloartane-type triterpene glycosides of astragaloside I, astragaloside II and astragaloside IV; isoflavones of formononetin, ononin calycosin, calycosin-7-O-β-d-glucoside; ligustilide and paeoniflorin were separated on a C18 column with gradient elution of methanol/10 mM ammonium acetate buffer–formic acid (100:0.1, v/v. This study was performed by a mass spectrometer using electrospray ionization (ESI with positive ionization ions monitored in the multiple reaction-monitoring (MRM mode. The linearity, accuracy, precision, limit of detection (LOD and lower limit of quantification (LLOQ were validated for this quantification method, and the sensitivity, reliability and reproducibility were all confirmed. The experiments provided a good method for analyzing BYHWT extracts. This study also quantitated the active components in various brands of commercially available products. The results indicated that the pharmaceutical industrial products of BYHWT exhibited considerable variation in their contents of the herbal compounds.

  1. Investigation of the dynamic NMR frequency shift for Fe57 in FeBO3

    Bun'kov, Yu.M.; Punkkinen, M.; Yulinen, E.E.

    1978-01-01

    NMR of Fe 57 in FeBO 3 is investigated by pulsed magnetic resonance techniques in the 2 to 70 K temperature range. A dynamic NMR frequency shift is observed which is due to coupling between the NMR oscillations and the low-frequency AFMR mode, the magnitude of which only slightly exceeds the micro-inhomogeneous broadening of the NMR line caused by the spread of the value of hyperfine field at the nuclei. Under these conditions the nuclear spin system possesses a number of unusual properties. Thus, broadening of the magnetic resonance line is uniform, the magnitude of the homogeneous broadening depends on the angle of deviation of the nuclear magnetization from the equilibrium axis, and an echo signal is detected which is similar to the ''solid echo'' in substances with dipole broadening of the magnetic resonance line

  2. Uptake and accumulation of lead by plants from the Bo Ngam lead mine area in Thailand

    Rotkittikhun, P.; Kruatrachue, M.; Chaiyarat, R.; Ngernsansaruay, C.; Pokethitiyook, P.; Paijitprapaporn, A.; Baker, A.J.M.

    2006-01-01

    A field survey of terrestrial plants growing on Bo Ngam lead mine area, Thailand, was conducted to identify species accumulating exceptionally high concentrations of lead. Plant and soil samples were collected from five areas. Lead concentrations in surface soil ranged from 325 to 142 400 mg/kg. The highest lead concentration in soil was found at the ore dressing plant area and lowest at a natural pond area. In different areas, the concentrations of lead in plants were different when comparing various study sites. A total of 48 plant species belonging to 14 families were collected from five sampling sites. Twenty-six plant species had lead concentrations more than 1000 mg/kg in their shoots. Three species (Microstegium ciliatum, Polygala umbonata, Spermacoce mauritiana) showed extremely high lead concentrations in their shoots (12 200-28 370 mg/kg) and roots (14 580-128 830 mg/kg). - Uptake and accumulation of lead by plants

  3. Control and initial operation of the Fermilab BO low β insertion

    Finley, D.A.; Johnson, R.P.; Willeke, F.

    1985-06-01

    The operation of the Fermilab BO low β insertion involves the coordinated control of the 4 strings of quadrupoles of the insertion itself along with several magnetic correction elements (20 dipoles for the closed orbit, 2 quad circuits for betatron tunes, 1 skew quad circuit for coupling, and 2 sextupole circuits for chromaticity). When the beam is stored at high energy, these elements must correct the errors induced by the strong superconducting quadrupoles of the insertion as the optics are smoothly changed from the fixed target configuration to the low β state. The techniques and control programs for these manipulations and initial tests using a single coasting beam are described. 6 refs., 4 figs

  4. Fe-induced enhancement of antiferromagnetic spin correlations in Mn2-xFexBO4

    Kazak, N. V.; Platunov, M. S.; Knyazev, Yu. V.; Moshkina, E. M.; Gavrilkin, S. Yu.; Bayukov, O. A.; Gorev, M. V.; Pogoreltsev, E. I.; Zeer, G. M.; Zharkov, S. M.; Ovchinnikov, S. G.

    2018-04-01

    Fe substitution effect on the magnetic behavior of Mn2-xFexBO4 (x = 0.3, 0.5, 0.7) warwickites has been investigated combining Mössbauer spectroscopy, dc magnetization, ac magnetic susceptibility, and heat capacity measurements. The Fe3+ ions distribution over two crystallographic nonequivalent sites is studied. The Fe introduction breaks a long-range antiferromagnetic order and leads to onset of spin-glass ground state. The antiferromagnetic short-range-order spin correlations persist up to temperatures well above TSG reflecting in increasing deviations from the Curie-Weiss law, the reduced effective magnetic moment and "missing" entropy. The results are interpreted in the terms of the progressive increase of the frustration effect and the formation of spin-correlated regions.

  5. Luminescence properties of Nd{sup 3+}-doped (Y,Gd)BO{sub 3} phosphors

    Yi, Soung Soo; Kim, Ji-Chul; Kim, Dong Woo [Department of Electronic Materials Engineering, Silla University, Busan 617-736 (Korea, Republic of); Balakrishnaiah, R. [Department of Electronic Materials Engineering, Silla University, Busan 617-736 (Korea, Republic of); Department of Physics, Pukyong National University, Busan 608-737 (Korea, Republic of); Kim, Sung Hoon [Department of Engineering in Energy and Applied Chemistry, Silla University, Busan 617-736 (Korea, Republic of); Jang, Kiwan, E-mail: kwjang@changwon.ac.k [Department of Physics, Changwon National University, Changwon 641-773 (Korea, Republic of); Lee, Ho Sueb [Department of Physics, Changwon National University, Changwon 641-773 (Korea, Republic of); Moon, Byung Kee; Jeong, Jung Hyun [Department of Physics, Pukyong National University, Busan 608-737 (Korea, Republic of)

    2010-09-01

    A system of 0.03 mol Nd{sup 3+}-doped (Y,Gd)BO{sub 3} phosphors were prepared by the conventional solid state reaction method for different concentrations of Gd{sup 3+} ions and were characterized by X-ray diffraction (XRD), field emission scanning electron microscopy (FESEM) and NIR emission measurements. The emitted radiation was dominated by 1057 nm peak in the NIR region as a result of {sup 4}F{sub 3/2} {yields} {sup 4}I{sub 11/2} transitions of Nd{sup 3+} ions. As the concentration of Gd{sup 3+} ions increases from 0.00 to 0.57 mol, the grain sizes and the intensity of NIR emission peaks were improved. The results are discussed in comparison with similar reported works.

  6. Cascade de photons dans les boîtes quantiques uniques

    Robert, I.; Moreau, E.; Gérard, J. M.; Abram, I.

    2002-06-01

    Nous présentons l'observation expérimentale de l'émission squentielle de photons par une boîte quantique unique sous pompage optique continu ou pulsé. Cette cascade radiative produit des paires de photons corrélés qui sont émis suivant un ordre bien défini. En effet, la fonction de corrélation croisée entre les deux photons formant la paire présente une allure asymétrique, de type groupement ou dégroupement de photons, suivant l'ordre temporel de détection des deux photons. Prédit théoriquement en physique atomique, ce comportement asymétrique de la fonction de corrélation de second ordre est la signature de l'émission successive de photons.

  7. Tunable blue–violet Cr3+:LiCAF + BiBO compact laser

    Maestre, H; Torregrosa, A J; Capmany, J

    2015-01-01

    We present a compact continuous wave (CW) external-cavity tunable Cr 3+ :LiCaAlF 6 (Cr:LiCAF) laser which is intracavity frequency doubled using a BiB 3 O 6 (BiBO) nonlinear crystal to obtain tunable blue–violet radiation. The generated second harmonic (SH) can be tuned by means of either angular or temperature variation of the nonlinear crystal. We have obtained SH radiation between 390–415 nm and a maximum output power of 34 mW at 400 nm. Future improvements on the SH tuning range and output power are addressed in the text. Our results may be applied in the design of compact tunable composite external-cavity solid-state lasers. (paper)

  8. Preparation of red phosphor (Y, Gd)BO3:Eu by soft chemistry methods

    Cui Xiangzhong; Zhuang Weidong; Yu Zhijian; Xia Tian; Huang Xiaowei; Li Hongwei

    2008-01-01

    The three soft chemistry methods were employed to prepare the red phosphor (Y, Gd)BO 3 :Eu, such as coprecipitation-combustion method, salt assisted combustion method and emulsion method. The main factors affecting particle size, particle distribution and luminescent properties of the product were investigated in detail, and as a result, the preparation processes were optimized. The phosphors were characterized by X-ray diffraction (XRD), scanning electronic microscope (SEM), transmission electronic microscope (TEM) and vacuum ultraviolet (VUV) spectra. Results reveal that phosphors with different morphology, small particle size and high luminescence intensity could be obtained by soft chemistry methods. The difference between the luminescence properties of phosphors in this work and commercial rare earth borate phosphor is discussed. The phosphor with grain shape and high luminescence intensity could be prepared by coprecipitation-combustion method, nanophosphor could be prepared by salt assisted combustion method, and spherical phosphor with a narrow size distribution could be obtained by using emulsion method

  9. Scintillation characteristics of Tm3+ in Ca3(BO3)2 crystals

    Fujimoto, Yutaka; Yanagida, Takayuki; Yokota, Yuui; Kawaguchi, Noriaki; Fukuda, Kentaro; Totsuka, Daisuke; Watanabe, Kenichi; Yamazaki, Atsushi; Yoshikawa, Akira

    2011-01-01

    Basic optical properties and radiation responses of undoped, Tm 3+ 1.0% and 2.0% activated Ca 3 (BO 3 ) 2 (CBO) crystalline scintillator prepared by the micro-pulling down (μ-PD) method are reported. Tm 3+ : CBO crystals showed three weak absorption bands around 190, 260 and 350 nm, owing to the Tm 3+ 4f–4f transition. Strong blue luminescence peaks at 360 and 460 nm which are ascribed to the 1 D 2 – 3 H 6 and 1 D 2 – 3 F 4 transitions of Tm 3+ respectively were observed under 241 Am 5.5 MeV α-ray excitation. The scintillation light yield of 2.0% Tm 3+ -doped CBO crystal was evaluated to be about 250 ph/n from the 252 Cf excited pulse height spectrum.

  10. Stimulated luminescence property of Zn(BO{sub 2}){sub 2}:TbCl{sub 3}

    Cedillo, G.; Cruz Z, E. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Garcia H, M. [UNAM, Instituto de Investigaciones en Materiales, Posgrado en Ciencia e Ingenieria de Materiales, Apdo. Postal 70-360, 04510 Mexico D. F. (Mexico); Marcazzo, J. [Instituto de Fisica Arroyo Seco / UNICEN, Gral. Pinto 399, 7000 Tandil, Buenos Aires (Argentina); Hernandez A, J. M.; Murrieta S, H., E-mail: ecruz@nucleares.unam.mx [UNAM, Instituto de Fisica, Apdo. Postal 20-364, 01000 Mexico D. F. (Mexico)

    2015-10-15

    Zinc borate, Zn(BO{sub 2}){sub 2}, doped with TbCl{sub 3} at different concentration (0.5-8 mol %) was synthesized. The polycrystalline samples were characterized by Scanning Electron Microscopy (Sem/EDS) and X-ray Diffraction. The X-ray difractrograms of the pure samples sintered at 750 and 800 degrees C shown the evidence of the Zn(BO{sub 2}){sub 2} has the body centered cubic (bcc) structure and a ZnB{sub 4}O{sub 7} primitive orthorhombic phase of the crystal system. The thermoluminescent (Tl) intensity was dependent on the thermal treatment (250-500 degrees C) and also on the impurity concentration. The glow curves show four glow peaks at about 82, 164, 251, and 331 degrees C when the Tb{sup 3+} doped zinc borate samples were exposed to gamma or beta radiation. The structure of the glow curves was analyzed by CGCD deconvolution method. The kinetics parameters (activation energy, frequency factor and the kinetic order) were calculated assuming the general order kinetics model describing accurately the Tl process. The glow peaks were overlapped and then the whole glow curve was considered for dosimetric characteristics measurements. The linear Tl response as a function of gamma and beta doses was performed using a {sup 60}Co irradiator and a {sup 90}Sr, respectively. Zinc borate with 8 mol % of impurity concentration exhibited an intense radio luminescent (Rl) emission. The Rl spectra show their maximum bands at 370, 490, 545 and 700 nm. The linear dose-response was between 2.2 c Gy and 27.7 Gy when the samples were exposed to beta radiation. These results suggest that the Tb -doped zinc borate material is a good phosphor for use in radiation dosimetry because its high Tl sensitivity to the ionizing radiation and good dose-response. (Author)

  11. Identification of lactic acid bacteria from chili bo, a Malaysian food ingredient.

    Leisner, J J; Pot, B; Christensen, H; Rusul, G; Olsen, J E; Wee, B W; Muhamad, K; Ghazali, H M

    1999-02-01

    Ninety-two strains of lactic acid bacteria (LAB) were isolated from a Malaysian food ingredient, chili bo, stored for up to 25 days at 28 degreesC with no benzoic acid (product A) or with 7,000 mg of benzoic acid kg-1 (product B). The strains were divided into eight groups by traditional phenotypic tests. A total of 43 strains were selected for comparison of their sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) whole-cell protein patterns with a SDS-PAGE database of LAB. Isolates from product A were identified as Lactobacillus plantarum, Lactobacillus fermentum, Lactobacillus farciminis, Pediococcus acidilactici, Enterococcus faecalis, and Weissella confusa. Five strains belonging to clusters which could not be allocated to existing species by SDS-PAGE were further identified by 16S rRNA sequence comparison. One strain was distantly related to the Lactobacillus casei/Pediococcus group. Two strains were related to Weissella at the genus or species level. Two other strains did not belong to any previously described 16S rRNA group of LAB and occupied an intermediate position between the L. casei/Pediococcus group and the Weissella group and species of Carnobacterium. The latter two strains belong to the cluster of LAB that predominated in product B. The incidence of new species and subspecies of LAB in chili bo indicate the high probability of isolation of new LAB from certain Southeast Asian foods. None of the isolates exhibited bacteriocin activity against L. plantarum ATCC 14917 and LMG 17682.

  12. Identification of Lactic Acid Bacteria from Chili Bo, a Malaysian Food Ingredient

    Leisner, Jørgen J.; Pot, Bruno; Christensen, Henrik; Rusul, Gulam; Olsen, John E.; Wee, Bee Wah; Muhamad, Kharidah; Ghazali, Hasanah M.

    1999-01-01

    Ninety-two strains of lactic acid bacteria (LAB) were isolated from a Malaysian food ingredient, chili bo, stored for up to 25 days at 28°C with no benzoic acid (product A) or with 7,000 mg of benzoic acid kg−1 (product B). The strains were divided into eight groups by traditional phenotypic tests. A total of 43 strains were selected for comparison of their sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) whole-cell protein patterns with a SDS-PAGE database of LAB. Isolates from product A were identified as Lactobacillus plantarum, Lactobacillus fermentum, Lactobacillus farciminis, Pediococcus acidilactici, Enterococcus faecalis, and Weissella confusa. Five strains belonging to clusters which could not be allocated to existing species by SDS-PAGE were further identified by 16S rRNA sequence comparison. One strain was distantly related to the Lactobacillus casei/Pediococcus group. Two strains were related to Weissella at the genus or species level. Two other strains did not belong to any previously described 16S rRNA group of LAB and occupied an intermediate position between the L. casei/Pediococcus group and the Weissella group and species of Carnobacterium. The latter two strains belong to the cluster of LAB that predominated in product B. The incidence of new species and subspecies of LAB in chili bo indicate the high probability of isolation of new LAB from certain Southeast Asian foods. None of the isolates exhibited bacteriocin activity against L. plantarum ATCC 14917 and LMG 17682. PMID:9925588

  13. A novel UV-emitting phosphor: NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+}

    Pekgözlü, İlhan, E-mail: pekgozluilhan@yahoo.com

    2016-01-15

    Pb{sup 2+} doped NaSr{sub 4}(BO{sub 3}){sub 3} materials were prepared by a solution combustion synthesis method. The phase analysis of all synthesized materials was carried out using the powder XRD. The synthesized materials were investigated using spectrofluorometer at room temperature. The excitation and emission bands of NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+} were observed at 291 and 368 nm, respectively. The dependence of the emission intensity on the Pb{sup 2+} concentration for the NaSr{sub 4}(BO{sub 3}){sub 3} was studied in detail. It was observed that the concentration quenching of Pb{sup 2+} in NaSr{sub 4}(BO{sub 3}){sub 3} is 0.01 mol. The Stokes shifts of NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+} phosphor were calculated to be 7190 cm{sup −1}. - Highlights: • A novel UV-emitting phosphor, NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+}, was prepared by combustion method. • The excitation and emission bands of NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+} were observed at 291 and 368 nm, respectively. • It was observed that the concentration quenching of Pb{sup 2+} in NaSr{sub 4}(BO{sub 3}){sub 3} is 0.01 mol.

  14. Impact of interstitial iron on the study of meta-stable B-O defects in Czochralski silicon: Further evidence of a single defect

    Kim, Moonyong; Chen, Daniel; Abbott, Malcolm; Nampalli, Nitin; Wenham, Stuart; Stefani, Bruno; Hallam, Brett

    2018-04-01

    We explore the influence of interstitial iron (Fei) on lifetime spectroscopy of boron-oxygen (B-O) related degradation in p-type Czochralski silicon. Theoretical and experimental evidence presented in this study indicate that iron-boron pair (Fe-B) related reactions could have influenced several key experimental results used to derive theories on the fundamental properties of the B-O defect. Firstly, the presence of Fei can account for higher apparent capture cross-section ratios (k) of approximately 100 observed in previous studies during early stages of B-O related degradation. Secondly, the association of Fe-B pairs can explain the initial stage of a two-stage recovery of carrier lifetime with dark annealing after partial degradation. Thirdly, Fei can result in high apparent k values after the permanent deactivation of B-O defects. Subsequently, we show that a single k value can describe the recombination properties associated with B-O defects throughout degradation, that the recovery during dark annealing occurs with a single-stage, and both the fast- and slow-stage B-O related degradation can be permanently deactivated during illuminated annealing. Accounting for the recombination activity of Fei provides further evidence that the B-O defect is a single defect, rather than two separate defects normally attributed to fast-forming recombination centers and slow-forming recombination centers. Implications of this finding for the nature of the B-O defect are also discussed.

  15. Spectroscopic study of magnetic phase transitions and magnetic structures in rare earth ferroborates RFe3(BO3)4 (R = Y, Er, Tb, Gd)

    Popova, M.N.; Chukalina, E.P.; Stanislavchuk, T.N.; Bezmaternykh, L.N.

    2006-01-01

    One investigated into the absorption spectra of RFe 3 (BO 3 ) 4 , R=Y, Er, Tb, Gd rare earth borate single crystals containing erbium (1%) introduced to serve as a probe. On the basis of the temperature dependences of Er 3+ ion spectral line splittings one determined the values of the magnetic ordering temperatures of Er, Tb and Gd ferroborates and the temperatures of the spin reoriented first order phase transition in GdFe 3 (BO 3 ) 4 :Er 3+ (1%). On the basis of comparison of the splitting values of Er 3+ ion ground state in RFe 3 (BO 3 ) 4 (R=Y, Er, Tb) and in GdFe 3 (BO 3 )4 compounds the magnetic structure of which is known one makes a concussion about the orientation of iron magnetic moments in the magneto-ordered state: a lightly planar structure is observed for YFe 3 (BO 3 ) 4 and ErFe 3 (BO 3 ) 4 and a lightly axial one - for TbFe 3 (BO 3 ) 4 . One discusses the role of R 3+ ion single ion anisotropy when determining the magnetic structure type in RFe 3 (BO 3 ) 4 [ru

  16. In-Vivo Neutralization of Botulinum Neurotoxin Serotype E Using Rabbit Polyclonal Antibody Developed against BoNT/E Light Chain.

    Rani, Sarita; Ponmariappan, S; Sharma, Arti; Kamboj, D V; Jain, A K

    2017-01-01

    Clostridium botulinum is an obligate anaerobic, Gram positive bacterium that secretes extremely toxic substances known as botulinum neurotoxins (BoNTs) that cause serious paralytic illness called botulism. Based upon the serological properties, these neurotoxin have been classified into seven serotypes designated from A to G. Due to extreme toxicity of BoNTs, these neurotoxins have been designated as category A biowarfare agents. There is no commercial neutralizing antibody available for the treatment of botulism. Hence there is an urgent need to develop therapeutic intervention for prevention and cure of botulism within short period. BoNT antiserum injection is still the effective treatment. In the present study, the recombinant light chain of BoNT/E was successfully purified in soluble form. The purified rBoNT/E LC was used for the generation of polyclonal antibody in rabbit. In order to find out the neutralizing capacity of generated antisera, rabbit antiserum was incubated with 20 LD50 of botulinum neurotoxin type E for 1 hour at 37°C and then injected intraperitoneally (IP) into mice. Further in another set of experiments antiserum was administered in different ways that included administration of - antiserum and BoNT/E toxin simultaneously without preincubation, one after another at the same and different time points for its therapeutic ability. To find out cross neutralization capacity, rBoNT/E LC antiserum was pre-incubated with 5 LD50 of BoNT/A, BoNT/B, BoNT/F and then injected (IP) into mice. In all the cases mice were observed continuously for 96 hours. The results clearly indicate that developed polyclonal rabbit antiserum showed serotype specific neutralization of BoNT/E toxin only but not of BoNT/A, BoNT/B and BoNT/F. The developed antibodies will be used for preventive and therapeutic intervention of type 'E' botulism. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  17. Linear and nonlinear optical susceptibilities for a novel borate oxide BaBiBO4: Theory and experiment

    Reshak, Ali H; Auluck, S.; Kityk, I. V.

    2008-01-01

    Roč. 4, č. 181 (2008), s. 789-795 ISSN 0022-4596 Institutional research plan: CEZ:AV0Z60870520 Keywords : electronic structure * optical properties * SHG * DFT Subject RIV: BO - Biophysics Impact factor: 1.910, year: 2008

  18. Konflikt i wojna jako „bicz Boży” w literaturze bułgarskiego średniowiecza

    Marzanna Kuczyńska

    2017-10-01

    Full Text Available Conflict and war as the “whip of God” in the literature of the Bulgarian Middle Ages The article focuses on the motif of war as a tool for the realization of God’s plans for people and the sign of His reward, and above all the penalty for human misdeeds, so called “whip of God”. The forms of the presence of the idea of God’s whip, his literary images and the functions it implements, are analyzed. The analysis was carried out on the material of the Bulgarian literature from 10th-15th century.   Konflikt i wojna jako „bicz Boży” w literaturze bułgarskiego średniowiecza Przedmiotem zainteresowania w artykule jest motyw wojny jako narzędzia realizacji Bożych planów wobec ludzi i znaku Jego nagrody, a przede wszystkim kary za ludzkie przewinienia, tzw. „bicz Boży”. Analizowane są formy obecności idei „bicza Bożego”, jego literackie wyobrażenia i funkcje, jakie realizuje. Analizę przeprowadzono na materiale bułgarskiego piśmiennictwa X–XV wieku.

  19. KCa4(BO33:Ln3+ (Ln = Dy, Eu, Tb phosphors for near UV excited white–light–emitting diodes

    Allu Amarnath Reddy

    2013-02-01

    Full Text Available A series of doped KCa4(BO33:Ln3+ (Ln: Dy, Eu and Tb compositions were synthesized by solid–state reaction method and their photoluminescent properties were systematically investigated to ascertain their suitability for application in white light emitting diodes. The X–ray diffraction (XRD and nuclear magnetic resonance (MAS–NMR data indicates that Ln3+–ions are successfully occupied the non–centrosymmetric Ca2+ sites, in the orthorhombic crystalline phase of KCa4(BO33 having space group Ama2, without affecting the boron chemical environment. The present phosphor systems could be efficiently excitable at the broad UV wavelength region, from 250 to 350 nm, compatible to the most commonly available UV light–emitting diode (LED chips. Photoluminescence studies revealed optimal near white–light emission for KCa4(BO33 with 5 wt.% Dy3+ doping, while warm white–light (CIE; X = 0.353, Y = 0.369 is obtained at 1wt.% Dy3+ ion concentration. The principle of energy transfer between Eu3+ and Tb3+ also demonstrates the potential white–light from KCa4(BO33:Eu3+,Tb3+ phosphor. Whereas, single Tb3+ and Eu3+–doped systems showed bright green (Tb3+ and red (Eu3+ emissions, respectively. Having structural flexibility along with remarkable chemical/thermal stability and suitable quantum efficiency these phosphors can be promising candidates as white–light–emitter for near UV LEDs.

  20. Theory of the orthogonal dimer Heisenberg spin model for SrCu sub 2 (BO sub 3) sub 2

    Miyahara, S

    2003-01-01

    The magnetic properties of SrCu sub 2 (BO sub 3) sub 2 are reviewed from a theoretical point of view. SrCu sub 2 (BO sub 3) sub 2 is a new two-dimensional spin gap system and its magnetic properties are well described by a spin-1/2 antiferromagnetic Heisenberg model of the orthogonal dimer lattice. The model has a dimer singlet ground state whose exactness was proven by Shastry and Sutherland for a topologically equivalent model more than 20 years ago. The exactness of the ground state is maintained even if interlayer couplings are introduced for SrCu sub 2 (BO sub 3) sub 2. In the two-dimensional model, quantum phase transitions take place between different ground states for which three phases are expected: a gapped dimer singlet state, a plaquette resonating valence bond state and a gapless magnetic ordered state. Analysis of the experimental data shows that the dimer singlet ground state is realized in SrCu sub 2 (BO sub 3) sub 2. The orthogonality of the dimer bonds, which is the underlying symmetry of th...

  1. BoKS 1.0. : Een voorstel voor een body of knowlegde & skills van de communicatieve competentie

    Els van der Pool; Monique van Wijk; Cecilia van Dongen

    2010-01-01

    Sinds 2008 bestaat er een landelijke Body of Knowledge & Skills voor vijf domeinen binnen het hoger onderwijs, te weten Business Administration, Commerce, Communications, Economics en Laws (Hbo-raad 2008). De term Body of Knowledge & Skills (BoKS) staat voor het geheel van kennis, vaardigheden en

  2. Intracavity doubling of CW Ti:sapphire laser to 392.5 nm using BiBO-crystal

    Mortensen, Jesper Liltorp; Thorhauge, Morten; Tidemand-Lichtenberg, Peter

    2005-01-01

    In this work we present results obtained for intra-cavity frequency-doubling of a 785 nm CW Ti:sapphire laser utilising BiBO as the non-linear crystal. Intracavity doubling offers several advantages compared to extra-cavity doubling, such as no need to couple to an external resonance cavity...

  3. Regional asymmetry of metabolic and antioxidant profile in the sciaenid fish shi drum (Umbrina cirrosa white muscle. Response to starvation and refeeding

    M. Carmen Hidalgo

    2017-04-01

    Full Text Available The objective of the present study is to characterize the metabolic and antioxidant profile of white muscle of shi drum in two sites of the body, anterior dorsal (AM and posterior dorsal (PM portions. In addition, it will be analyzed the possible effect of starvation and a subsequent refeeding, with two different protocols, pair feeding and ad libitum. Activities of key enzymes of intermediary metabolism and of antioxidant enzymes, as well as lipid peroxidation, as an index of oxidative stress, were evaluated. The results indicate the existence of a regional asymmetry of the metabolic capacities of the white muscle of shi drum, which is likely related to the different contribution to swimming of the body regions examined. Starvation induces a metabolic depression that is more marked in those activities that support burst swimming in PM, while those activities supporting maintenance requirements are conserved. The greatest energy demands during starvation appear to lie in AM, which showed the highest oxidative metabolism rate. The increased use of fatty acids as energy source for AM leads to oxidative stress. A period of more than four weeks of refeeding for full restoration of metabolic capacities in AM is needed, probably related to the higher muscle mass located in this region. On the contrary, all enzyme activities in PM returned to control levels in both refeeding protocols, but pair feeding seems to be advantageous since compensatory growth has been taking place without signs of oxidative stress. This work was addressed to gain knowledge on the physiology of a promising fish species in aquaculture like shi drum. The results displayed here show how the starving and further re-feeding events could generate oxidative stress situations characterized by high lipid peroxidation levels which may influence negatively on the quality of the edible part of the fish. This study opens an interesting field on this fish species which deserves being

  4. Characterization of BoHV-5 field strains circulation and report of transient specific subtype of bovine herpesvirus 5 in Argentina

    Thiry Julien

    2011-02-01

    Full Text Available Abstract Background Bovine herpesvirus 5 (BoHV-5 is a member of the subfamily Alphaherpesvirinae responsible for meningo-encephalitis in young cattle. The first case of bovine meningo-encephalitis associated with a herpesvirus infection was reported in Australia. The current geographical distribution of BoHV-5 infection is mainly restricted to South America, especially Brazil and Argentina. Outbreaks of BoHV-5 are regularly observed in Argentina suggesting the circulation of the virus in the bovine population. Results Seventeen field strains of BoHV-5 isolated from 1984 to now were confirmed by differential PCR and subjected to restriction endonuclease analysis (REA. Viral DNA was cleaved with BstEII which allows the differentiation among subtypes a, b and non a, non b. According to the REA with BstEII, only one field strain showed a pattern similar to the Argentinean A663 strain (prototype of BoHV-5b. All other isolates showed a clear pattern similar to the Australian N569 strain (prototype of BoHV-5a consistent with the subtypes observed in Brazil, the other South-American country where BoHV-5 is known to be prevalent. The genomic region of subtype b responsible for the distinct pattern was determined and amplified by PCR; specifically a point mutation was identified in glycoprotein B gene, on the BstEII restriction site, which generates the profile specific of BoHV-5b. Conclusions This is the first report of circulation of BoHV-5a in Argentina as the prevailing subtype. Therefore the circulation of BoHV-5b was restricted to a few years in Argentina, speculating that this subtype was not able to be maintained in the bovine population. The mutation in the gB gene is associated with the difference in the restriction patterns between subtypes "a" and "b".

  5. Frequency of antibodies against bovine herpesvirus type 1 (BoHV-1 in beef cattle not vaccinated

    Ermilton Junio Pereira de Freitas

    2014-06-01

    Full Text Available Bovine herpesvirus type 1 (BoHV-1, is responsible for clinical manifestations such as infectious bovine rhinotracheitis, abortion, conjunctivitis, infectious pustular vulvovaginitis and balanoposthitis. This virus has been responsible for major losses in different productive and reproductive herds in the country. Thus, the objective of this study was to estimate the frequency of antibodies against BoHV-1 in beef heifers not vaccinated in Microregion of Imperatriz, Maranhao, and identify the age group most affected by the virus, as well as a study of factors associated with virus infection and to evaluate the indirect ELISA using the serum neutralization (SN as a reference standard. The study was conducted in 48 herds, cutting, distributed in 12 counties of Microregion of Imperatriz. The samples were collected from female cattle stratified into three age groups, ? 12 months, between 12 and 36 months and ? 36 months of age. The samples were subjected to two serological tests, ELISA and SN. In each herd, an epidemiological questionnaire was applied in order to obtain information on management and reproductive sanitary, for the study of risk factors. The frequency of antibodies against BoHV-1 in Microregion of Imperatriz was 63.23%, and the municipalities of Açailândia Buritirana showed the highest frequencies, both with 80.44%, the most affected age group, the Microregion, was animals aged ? 36 months (69.65%. Based on the results we can conclude that the frequency of antibodies against BoHV-1 is high, between the age groups most affected were the animals aged ? 36 months were considered risk factors for virus transmission, return to estrus (OR=1.874, recovery of animals from other states / region (OR=1.365 and the creation of goat / sheep associated with bovine (OR=1.348, the indirect ELISA technique showed moderate concordance when compared to SN technique, which is the gold standard technique for diagnosis of BoHV-1.

  6. Martinický palác v Praze za vlastnictví Jiřího Bořity z Martinic a jeho následovníka Jaroslava Bořity z Martinic. Architektonická podoba a výzdoba

    Poláčková, Daniela

    2011-01-01

    Bachelor thesis "Martinic palace in Prague during the ownership of George Bořita of Martinic and his follower Jaroslav Bořita of Martinic. Its architectural form and decoration" is based on the Martinic palace in the Hradčany square during the ownerships of George Bořita of Martinic and Jaroslav Bořita of Martinic. At the beginning you can find the list of the owners, who owned the palace, during this there appeared important changes not only architectural, but also in decoration. The first c...

  7. Contamination and Human Health Risk Assessment of Polycyclic Aromatic Hydrocarbons (PAHs) in Oysters After the Wu Yi San Oil Spill in Korea.

    Loh, Andrew; Yim, Un Hyuk; Ha, Sung Yong; An, Joon Geon; Kim, Moonkoo

    2017-07-01

    After the collision of the Singapore-registered oil tanker M/V Wu Yi San into the oil terminal of Yeosu, Korea on January 31, 2014, approximately 900 m 3 of oil and oil mixture were released from the ruptured pipelines. The oil affected more than 10 km of coastline along Gwangyang Bay. Emergency oil spill responses recovered bulk oil at sea and cleaned up the stranded oil on shore. As part of an emergency environmental impact assessment, region-wide monitoring of oil contamination in oyster had been conducted for 2 months. Highly elevated concentrations of polycyclic aromatic hydrocarbons (PAHs) were detected at most of the spill affected sites. Four days after the spill, the levels of PAHs in oysters increased dramatically to 627-81,000 ng/g, the average of which was 20 times higher than those found before the spill (321-4040 ng/g). The level of PAHs in these oysters increased until 10 days after the spill and then decreased. Due to the strong tidal current and easterly winter winds, the eastern part of the Bay-the Namhae region-was heavily contaminated compared with other regions. The accumulation and depuration of spilled oil in oyster corresponded with the duration and intensity of the cleanup activities, which is the first field observation in oil spill cases. Human health risk assessments showed that benzo[a]pyrene equivalent concentrations exceeded levels of concern in the highly contaminated sites, even 60 days after the spill.

  8. Pharmacokinetic determination of ephedrine in Herba Ephedrae and Wu Tou Tang decoctions in rats using ultra performance liquid chromatography tandem mass spectrometry.

    Zheng, Zhijie; Yan, Tongmeng; Chen, Weiying; Ye, Ling; Tang, Lan; Liu, Zhongqiu

    2012-08-01

    A rapid and sensitive ultra performance liquid chromatography tandem mass spectrometry method was developed and validated for the determination and quantification of ephedrine in rat plasma samples. An Acquity UPLC BEH C18 column (1.7 μm, 2.1 mm × 50 mm) was used for chromatographic separation. Electrospray ionization in the positive mode was used, and the precursor-fragment ion pairs of m/z 166/148 and m/z 289/97 were adopted to characterize ephedrine and testosterone (internal standard), respectively. The method was validated using 10, 100 and 500 ng/mL of ephedrine. It demonstrated adequate levels of precision and accuracy, matrix effect, extraction recovery and stability. Linearity over the concentration range of 0.5-2000 ng/mL was acceptable with a correlation coefficient (r²) better than 0.990. To determine the pharmacokinetic behaviour of this sympathomimetic compound in the Sprague-Dawley rats, ephedrine hydrochloride, Herba Ephedrae single-herb and Wu Tou Tang decoctions were administered orally, and ephedrine hydrochloride was also administered by intravenous injection, and blood samples were collected over 24 h. Ephedrine was measured in plasma and pharmacokinetic parameters were determined by using the standard non-compartmental method and calculated by using Practical Pharmacokinetic Program-Version 87/97. The AUC(0-t) and T(max) values were significantly different (p Tang decoction compared to the other oral treatments, suggesting that some components in the decoction may reduce the bioavailability of ephedrine.

  9. Inhibition of Neoplastic Transformation and Chemically-Induced Skin Hyperplasia in Mice by Traditional Chinese Medicinal Formula Si-Wu-Tang

    Mandy M. Liu

    2017-03-01

    Full Text Available Exploring traditional medicines may lead to the development of low-cost and non-toxic cancer preventive agents. Si-Wu-Tang (SWT, comprising the combination of four herbs, Rehmanniae, Angelica, Chuanxiong, and Paeoniae, is one of the most popular traditional Chinese medicines for women’s diseases. In our previous studies, the antioxidant Nrf2 pathways were strongly induced by SWT in vitro and in vivo. Since Nrf2 activation has been associated with anticarcinogenic effects, the purpose of this study is to evaluate SWT’s activity of cancer prevention. In the Ames test, SWT demonstrated an antimutagenic activity against mutagenicity induced by the chemical carcinogen 7,12-dimethylbenz(aanthracene (DMBA. In JB6 P+ cells, a non-cancerous murine epidermal model for studying tumor promotion, SWT inhibited epidermal growth factor (EGF-induced neoplastic transformation. The luciferase reporter gene assays demonstrated that SWT suppressed EGF-induced AP-1 and TNF-α-induced NF-κB activation, which are essential factors involved in skin carcinogenesis. In a DMBA-induced skin hyperplasia assay in ‘Sensitivity to Carcinogenesis’ (SENCAR mice, both topical and oral SWT inhibited DMBA-induced epidermal hyperplasia, expression of the proliferation marker Proliferating cell nuclear antigen (PCNA, and H-ras mutations. These findings demonstrate, for the first time, that SWT prevents tumor promoter and chemical-induced carcinogenesis in vitro and in vivo, partly by inhibiting DNA damage and blocking the activation of AP-1 and NF-κB.

  10. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how personal experiences affect individual risk taking. To separate the intertwining effects of personal experiences and wealth changes, our identification strategy relies on the decision to keep unexpected inheritances of risky assets. Experience derives from investments in banks...... that defaulted in the aftermath of the financial crisis. To differentiate the effect of personal experiences, we classify the degrees of experiences into first-hand experiences from personal losses, second-hand experiences from the losses of close family members, and third-hand experiences from living...... in municipalities where banks defaulted. We find that third-hand experiences result in marginally lower risk taking. Second-hand experiences have a relatively stronger negative effect, whereas the effect of first-hand experiences on risk taking is strongly negative. Overall, our results demonstrate that personal...

  11. Once Bitten, Twice Shy

    Andersen, Steffen; Hanspal, Tobin; Meisner Nielsen, Kasper

    We study how inertia and personal experiences affect individual risk taking. Our research design relies on active portfolio decisions relating to inheritances to separate the effect of personal experiences from inertia, which otherwise would be observationally equivalent. Experience derives from...... results demonstrate that experiences gained personally, aside from inertia or common shocks, explain substantial heterogeneity in individuals' risk taking....

  12. Synthesis, crystal structure, and properties of Bi{sub 3}TeBO{sub 9} or Bi{sub 3}(TeO{sub 6})(BO{sub 3}): a non-centrosymmetric borate-tellurate(VI) of bismuth

    Daub, Michael; Krummer, Michael; Hoffmann, Anke [Institut fuer Anorganische und Analytische Chemie, Albert-Ludwigs-Universitaet, Albertstrasse 21, 79104, Freiburg (Germany); Bayarjargal, Lkhamsuren [Institut fuer Geowissenschaften, Abt. Kristallographie, Goethe-Universitaet, Altenhoeferallee 1, 60438, Frankfurt am Main (Germany); Hillebrecht, Harald [Institut fuer Anorganische und Analytische Chemie, Albert-Ludwigs-Universitaet, Albertstrasse 21, 79104, Freiburg (Germany); Freiburger Materialforschungszentrum FMF, Albert-Ludwigs-Universitaet, Stefan-Meier-Strasse 25, 79104, Freiburg (Germany)

    2017-01-26

    Pale-yellow single crystals of the new borate tellurate(VI) Bi{sub 3}TeBO{sub 9} were obtained by reaction of stoichiometric amounts of Bi{sub 2}O{sub 3}, B{sub 2}O{sub 3}, and Te(OH){sub 6} at 780 C. The non-centrosymmetric crystal structure (P6{sub 3}, Z=2, a=8.7454(16), c=5.8911(11) Aa, 738 refl., 43 param, R1=0.037, wR2=0.093) contains isolated trigonal-planar BO{sub 3} units and nearly undistorted TeO{sub 6} octahedra. The Bi{sup 3+} cations are located in between in octahedral voids. The BiO{sub 6} octahedra are significantly distorted to a [3+3] pattern (2.25/2.50 Aa) due to the ns{sup 2} configuration. According to the structural features, the formula can be written as Bi{sub 3}(TeO{sub 6})(BO{sub 3}). Alternatively, the structure can also be described as hcp of oxygen with Te{sup VI} and Bi{sup III} in octahedral voids and B{sup III} in trigonal- planar voids. The vibrational spectra show the typical features of BO{sub 3} and TeO{sub 6} units with a significant {sup 10}B/{sup 11}B isotopic splitting of the IR-active B-O valence mode (1248 and 1282 cm{sup -1}). The UV/Vis spectrum shows an optical band edge with an onset around 480 nm (2.6 eV). MAS-NMR spectra of {sup 11}B show an anisotropic signal with a quadrupole coupling constant of C{sub Q}=2.55 MHz. and a very small deviation from rotational symmetry (η=0.2). The isotropic chemical shift is 20.1 ppm. The second harmonic generation (SHG) test was positive with an activity comparable to potassium dihydrogen phosphate (KDP). Bi{sub 3}TeBO{sub 9} decomposes in air at 825 C to Bi{sub 2}TeO{sub 5}. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  13. A graphene oxide based fluorescence resonance energy transfer (FRET) biosensor for ultrasensitive detection of botulinum neurotoxin A (BoNT/A) enzymatic activity.

    Shi, Jingyu; Guo, Jiubiao; Bai, Gongxun; Chan, Chunyu; Liu, Xuan; Ye, Weiwei; Hao, Jianhua; Chen, Sheng; Yang, Mo

    2015-03-15

    Botulinum neurotoxins (BoNTs) are among the most potent toxic bacterial proteins for humans, which make them potential agents for bioterrorism. Therefore, an ultrasensitive detection of BoNTs and their active states is in great need as field-deployable systems for anti-terrorism applications. We report the construction of a novel graphene oxide (GO)-peptide based fluorescence resonance energy transfer (FRET) biosensor for ultrasensitive detection of the BoNT serotype A light chain (BoNT-LcA) protease activity. A green fluorescence protein (GFP) modified SNAP-25 peptide substrate (SNAP-25-GFP) was optimally designed and synthesized with the centralized recognition/cleavage sites. This FRET platform was constructed by covalent immobilization of peptide substrate on GO with BSA passivation which have advantages of low non-specific adsorption and high stability in protein abundant solution. BoNT-LcA can specifically cleave SNAP-25-GFP substrate covalently immobilized on GO to release the fragment with GFP. Based on fluorescence signal recovery measurement, the target BoNT-LcA was detected sensitively and selectively with the linear detection range from 1fg/mL to 1pg/mL. The limit of detection (LOD) for BoNT-LcA is around 1fg/mL. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. SHiP: a new facility with a dedicated detector to search for new neutral particles and studying tau neutrino properties

    Shevchenko V.

    2017-01-01

    Full Text Available SHiP (Search for Hidden Particles is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee and by the CERN Research Board. The two boards recommended that the experiment proceeds further to a Comprehensive Design phase in the context of the new CERNWorking group "Physics Beyond Colliders", aiming at presenting a CERN strategy for the European Strategy meeting of 2019. In the initial phase of SHiP, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 pot in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10 GeV/c2. The main focus will be the physics of the so-called Hidden Portals, i.e. search for Dark Photons, Light scalars and pseudo-scalars, and Heavy Neutrinos. The sensitivity to Heavy Neutrinos will allow for the first time to probe, in the mass range between the kaon and the charm meson mass, a coupling range for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions.

  15. SHI induced effects on the electrical and optical properties of HfO{sub 2} thin films deposited by RF sputtering

    Manikanthababu, N.; Dhanunjaya, M.; Nageswara Rao, S.V.S.; Pathak, A.P., E-mail: appsp@uohyd.ernet.in

    2016-07-15

    The continuous downscaling of Metal Oxide Semiconductor (MOS) devices has reached a limit with SiO{sub 2} as a gate dielectric material. Introducing high-k dielectric materials as a replacement for the conservative SiO{sub 2} is the only alternative to reduce the leakage current. HfO{sub 2} is a reliable and an impending material for the wide usage as a gate dielectric in semiconductor industry. HfO{sub 2} thin films were synthesized by RF sputtering technique. Here, we present a study of Swift Heavy Ion (SHI) irradiation with100 MeV Ag ions for studying the optical properties as well as 80 MeV Ni ions for studying the electrical properties of HfO{sub 2}/Si thin films. Rutherford Backscattering Spectrometry (RBS), Field Emission Scanning Electron Microscope (FESEM), energy-dispersive X-ray spectroscopy (EDS), profilometer and I–V (leakage current) measurements have been employed to study the SHI induced effects on both the structural, electrical and optical properties.

  16. Raman and time resolved photoluminescence studies on the effect of temperature on disorder production in SHI irradiated N-doped 6H-SiC crystals

    Sivaji, K., E-mail: sivaji.krishnan@yahoo.com [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Viswanathan, E. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); Selvakumar, S. [Materials Science Centre, Department of Nuclear Physics, University of Madras, Guindy Campus, Chennai 600025 (India); University of Tsukuba Tandem Accelerator Complex, University of Tsukuba, Tennodai 1-1-1, Ibaraki 305-8577 (Japan); Sankar, S. [Department of Physics, MIT Campus, Anna University, Chennai 600044 (India); Kanjilal, D. [Inter-University Accelerator Centre, Aruna Asaf Ali Marg, P.O. Box 10502, New Delhi 110067 (India)

    2014-02-25

    Highlights: • N doped SiC were irradiated with 150 MeV Ag{sup 12+} (1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}). • Local disorder are analyzed by studying the LO Raman mode of the irradiated sample. • The TRPL studies provided evidence of the formation of radiative centers at 80 K. -- Abstract: In this report, the effect of disorder accumulation in Swift Heavy Ion (SHI) irradiated 6H-SiC is distinguished with respect to the irradiation temperature, viz., 80 K and 300 K. The samples were irradiated with 150 MeV Ag{sup 12+} ions with different fluences ranging from 1 × 10{sup 12} to 5 × 10{sup 13} ions/cm{sup 2}. The structural and optical properties of N-doped 6H-SiC in its pristine condition and after SHI irradiation have been studied. The changes observed by Raman spectroscopy and Time resolved photoluminescence (TRPL) spectroscopy were ascribed to the disorder accumulation in 6H-SiC. The local disorder has been analyzed by studying the LO Raman mode of the irradiated sample in comparison to the pristine sample. The TRPL studies have provided evidence of the formation of radiative centers after irradiation at 80 K.

  17. Effect of the partial replacement of fish meal and oil by vegetable products on performance and quality traits of juvenile shi drum (Umbrina cirrosa L.

    Igino Andrighetto

    2010-01-01

    Full Text Available A four-month growth trial was carried out in order to evaluate performance and quality traits of juvenile shi drum fedwith two isonitrogenous and isoenergetic diets having different amounts of vegetable products (Vegetable diet vs. Controldiet. Compared to the Control diet, the Vegetable diet was formulated by increasing the replacement of fish meal (14%with soybean and cereal products, and fish oil (12% with a mixture of vegetable oil. On June, 4 groups of 225 fish (2replicates per dietary treatment were sorted according to live weight and reared in fibreglass tanks over a four- monthlong experimental period. Fish were hand fed to apparent satiety. Offered feed, growth parameters and feed efficiencywere recorded as productive performance. At the end of the trial (October biometric, chemical and reological traits wereexamined to assess fish quality. The dietary treatments showed similar productive performance. The relatively high inclusionof vegetable sources led to a significant modification of body shape, mesenteric fat and viscera weight. Among qualitytraits, Vegetable diet-fed fish demonstrated a significantly lower whole body and fillet crude protein content.Yellowness value of the cooked fillet was significantly lower in the Control diet-fed fish, whereas fillet texture was similar.The results of this research showed that shi drum is a suitable candidate for Mediterranean marine aquaculture andits dietary formulation might include at least the amount of vegetable sources used in this trial.

  18. Controlled synthesis of different multilayer architectures of GdBO{sub 3}:Eu{sup 3+} phosphors and shape-dependent luminescence properties

    Leng, Zhihua; Zhang, Nannan; Liu, Yali; Li, Linlin; Gan, Shucai, E-mail: gansc@jlu.edu.cn

    2015-03-01

    Graphical abstract: - Highlights: • Pancake-like/flower-like/leaf-like GdBO{sub 3} were obtained via a hydrothermal method. • Gd(OH){sub 3} nanorods and borates were used as the precursors for the first time. • A dissolution and recrystallization process was happened induced by the excess borax. • Three products have the similar stacked arrangements to reduce the surface energy. • The luminescence properties of GdBO{sub 3}:Eu{sup 3+} are related to shape and crystallinity. - Abstract: Monodisperse pancake-like/flower-like/leaf-like GdBO{sub 3} samples have been successfully synthesized via a designed hydrothermal conversion method using H{sub 3}BO{sub 3}, Na{sub 2}B{sub 4}O{sub 7}·10H{sub 2}O, or NaBO{sub 2}·4H{sub 2}O as boron sources, respectively. It was found that different boron sources have crucial influences on the formation and morphology of the products. The Gd(OH){sub 3} nanorods precursors were prepared through a simple hydrothermal process, which then served as sacrificial templates for the fabrication of GdBO{sub 3} micropancakes/microflowers/microleaves via a hydrothermal conversion process. FT-IR spectra confirm that vaterite-type GdBO{sub 3} can be synthesized by this method. The possible formation mechanisms for different microstructures were put forward on the basis of a series of time-dependent control experiments. The products have similar stacked arrangements driven by the minimization of the interfacial and surface energy of the hydrothermal system. An investigation on the photoluminescence (PL) properties of GdBO{sub 3}:Eu{sup 3+} samples with different morphologies indicates that the PL properties of as-obtained GdBO{sub 3}:Eu{sup 3+} phosphors are strongly dependent on their morphology and crystallinity. The flower-like structure exhibits the strongest red emission.

  19. New structural design standard for cooling towers. Pilot project BoA 2 and 3 in Neurath; Pilotprojekt der neuen Normengeneration im Kuehlturmbau. Die Naturzugkuehltuerme von BoA 2 and 3 in Neurath

    Woermann, Ralf [Kraetzig und Partner Ingenieurgesellschaft fuer Bautechnik mbH, Bochum (Germany); Haupt, Ralf [ALPINE BAU DEUTSCHLAND AG NL Industrie- und Kraftwerksbau, Dortmund (Germany); Ohlmann, Uwe [RWE Power AG, Essen (Germany). Bautechnik

    2010-01-15

    Starting in 2006 RWE Power is erecting two lignite power plants with highly optimized efficiency (BoA) in Neurath near Cologne. These will be the second and third plant of this most advanced technique after the completion of BoA1 in Niederaussem in 2003. The most outstanding buildings of the new power-station are the natural draught cooling towers with a height of 173 m. Their design and execution will be described in this paper. For the first time in cooling tower design the completely revised new edition 2005 of the VGB-Guideline ''Structural Design of Cooling Towers'' was applied in connection with other related new design standards. (orig.)

  20. EPR study of the low-spin state of Ru{sup 3+}in the YAl{sub 3}(BO{sub 3}){sub 4} and EuAl{sub 3}(BO{sub 3}){sub 4} aluminum borates

    Prokhorov, A.A., E-mail: andaprokhorov@gmail.com [Institute of Physics AS CR, Na Slovance 2, Praha 8 18221 (Czech Republic); Chernush, L.F. [A.A. Galkin Donetsk Physico-Technical Institute, 72, R. Luxembourg Str., Donetsk 83114 (Ukraine); Dyakonov, V.P.; Szymczak, H. [Institute of Physics, PAS, al. Lotników 32/46, Warsaw 02-668 (Poland); Prokhorov, A.D. [A.A. Galkin Donetsk Physico-Technical Institute, 72, R. Luxembourg Str., Donetsk 83114 (Ukraine)

    2016-12-15

    New data on the ground state of impurity Ru{sup 3+} ions in the crystals of YAl{sub 3}(BO{sub 3}){sub 4} and EuAl{sub 3}(BO{sub 3}){sub 4} aluminum borates were obtained. It was shown that Ru{sup 3+} ion replaces trivalent rare-earth ions without breaking the symmetry of the site. The crystal field acting on 4d{sup 5} ions forms an EPR spectrum, which is described by the spin Hamiltonian with S=1/2. The spin-Hamiltonian parameters determined are equal to g{sub II}=1.963, g{sub ⊥}=3.796, A{sub II}=43.03*10{sup −4} cm{sup −1}, A{sub ⊥}=84.86*10{sup −4} cm{sup −1} in the YAl{sub 3}(BO{sub 3}){sub 4} crystal (at T=15 K) and g{sub II}=2.016, g{sub ⊥}=3.796 in the EuAl{sub 3}(BO{sub 3}){sub 4} crystal (at T=15 K). It is found that the value of ∆g=g{sub II}-g{sub ⊥} is an indicator of distortions of nearest environment of Ru{sup 3+} ion. The angle between the C{sub 3} axis and the direction into nearest oxygen ion was determined. The EPR linewidth of Ru{sup 3+} ion increases with increasing temperature due to the dipole-dipole and exchange interactions with the excited states of the host lattice Ru{sup 3+} ion.

  1. Cyanobacteria, algae and microfungi present in biofilm from Božana Cave (Serbia

    Slađana Popović

    2015-05-01

    Full Text Available Phototrophic microorganisms (cyanobacteria and algae and microfungi, were identified from biofilm on the walls of the entrance of BožanaCavein west Serbia. Temperature, relative humidity and light intensity were measured, and chlorophyll a content determined. Light intensity differed from the entrance inwards. However, Chl a content was not proportional to light intensity, instead it was positively correlated to biofilm weight. Biofilm samples from two sites were also observed using a scanning electron microscope. Coccoid forms of cyanobacteria were abundant at the sampling site with the lowest light intensity, while members of the order Nostocales were predominant at the sampling site with the highest light intensity measured. Cyanobacteria were the dominant group of phototrophs colonizing cave walls (29 taxa, with the order Chroococcales prevailing (21 taxa. The most frequently documented cyanobacteria were species from genera Gloeocapsa, Scytonema, Aphanocapsa and Chroococcus. Desmococcus olivaceus and Trentepohlia aurea were the only green algae documented on cave walls. Ascomycetes were common (e.g. Alternaria, Aspergillus, Cladosporium, Epicoccum, Penicillum and Trichoderma, while zygomycetes and oomycetes were less frequent. The different color of each biofilm sample was ascribed to the presence of various different species of cyanobacteria and algae.

  2. Electron paramagnetic resonance and optical properties of Cr3+ doped YAl3(BO3)4

    Wells, Jon-Paul R; Yamaga, Mitsuo; Han, Thomas P J; Honda, Makoto

    2003-01-01

    We report on the electron paramagnetic resonance (EPR) and optical absorption and fluorescence spectroscopy of YAl 3 (BO 3 ) 4 single crystals doped with 0.2 mol% of trivalent chromium. From EPR we determine that the Cr 3+ ions reside in sites of essentially octahedral symmetry with an orthorhombic distortion. The ground state 4 A 2 splitting is determined to be 2√D 2 + 3E 2 ∼ 1.05 ± 0.04 cm -1 , where D and E are fine-structure parameters, and we can attribute this splitting to the combined effect of a low-symmetry distortion and spin-orbit coupling. The g-values and fine-structure parameters D and E of the ground state 4 A 2 are measured to be g x ∼ g y ∼ g z = 1.978 ± 0.005, vertical bar D vertical bar = 0.52 ± 0.02 cm -1 and vertical bar E vertical bar 0.010 ± 0.005 cm -1 respectively. From 10 K optical absorption we have measured the position and crystal-field splittings of the 2 E, 2 T 1 , 4 T 2 , 2 T 2 and 4 T 1 states with the 4 T 2 and 4 T 1 levels appearing as vibronically broadened bands

  3. A community in trouble? The impact of gentrification on the Bo-Kaap, Cape Town

    Nico Kotze

    2013-01-01

    Full Text Available The Bo-Kaap is an older inner-city, working-class neighbourhood in Cape Town, South Africa. By the 1930s, the area had degenerated into an overcrowded and run-down neighbourhood, consisting largely of dilapidated houses, but by 1941 about 150 housing units had been expropriated by the local authority for redevelopment in a comprehensive renewal scheme for the area. However, the process was halted with the formation of the so-called “Group for the Preservation of the Malay Quarter”, which fought against the demolition of the houses. At present, the area with its colourful housing units and 11 mosques is part of Cape Town’s cultural heritage and a very important tourist attraction. As in the case of De Waterkant, a gentrified neighbourhood adjacent to it, the area has seen a large number of housing units renovated and upgraded. Property prices have increased dramatically, although they are still relatively low, while the number of properties sold is also on the rise – so much so that the community leaders and especially the Muslim residents are in a constant battle to preserve the neighbourhood’s cultural identity.

  4. Electronic structure of lanthanum calcium oxoborate LaCa4O(BO3)3

    Nelson, A.J.; Buuren, T. van; Willey, Trevor M.; Bostedt, C.; Adams, J.J.; Schaffers, K.I.; Terminello, Lou; Callcott, T.A.

    2004-01-01

    Lanthanum calcium oxoborate (LaCOB) is a nonlinear optical (NLO) material that belongs to the calcium-rare-earth (R) oxoborate family, with general composition Ca 4 RO(BO 3 ) 3 (R 3+ =La, Sm, Gd, Lu, Y). X-ray photoemission, photoabsorption, and resonant fluorescence were applied to study the electronic structure of this material. High resolution photoemission measurements on the valence band (VB) electronic structure and La 3d and 4d, Ca 2p, B 1s, and O 1s core lines were used to evaluate the surface and near surface chemistry. Element specific density of unoccupied electronic states in LaCOB were probed by X-ray absorption spectroscopy (XAS) at the La 3d (M 4,5 -edge), B 1s, and O 1s (K-edges) absorption edges. Soft X-ray fluorescence was used to further examine valence band states associated with spectral differences noted in the absorption measurements. These results provide the first measurements of the electronic structure and surface chemistry of this rare-earth oxoborate

  5. Spin-glass behavior in single crystals of hetero-metallic magnetic warwickites MgFeBO{sub 4,} Mg{sub 0.5}Co{sub 0.5}FeBO{sub 4,} and CoFeBO{sub 4}

    Arauzo, A., E-mail: aarauzo@unizar.es [Servicio de Medidas Físicas, Universidad de Zaragoza, Pedro Cerbuna 12, 50009 Zaragoza (Spain); Kazak, N.V. [L.V. Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Ivanova, N.B. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Platunov, M.S. [L.V. Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Knyazev, Yu.V. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Bayukov, O.A.; Bezmaternykh, L.N. [L.V. Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Lyubutin, I.S.; Frolov, K.V. [Shubnikov Institute of Crystallography, RAS, 119333 Moscow (Russian Federation); Ovchinnikov, S.G. [L.V. Kirensky Institute of Physics, SB of RAS, 660036 Krasnoyarsk (Russian Federation); Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Siberian State Aerospace University, 660014 Krasnoyarsk (Russian Federation); Bartolomé, J. [Instituto de Ciencia de Materiales de Aragón, CSIC-Universidad de Zaragoza and Departamento de Física de la Materia Condensada, 50009 Zaragoza (Spain)

    2015-10-15

    Magnetic properties of heterometallic warwickites MgFeBO{sub 4,} Mg{sub 0.5}Co{sub 0.5}FeBO{sub 4,} and CoFeBO{sub 4} are presented, highlighting the effect of Co substitution on the magnetic properties of these compounds. The analysis of magnetization and heat capacity data has shown that these compounds exhibit a spin-glass transition below T{sub SG}=10, 20 and 22 K, respectively. Using zero field ac susceptibility as entanglement witness we find that the low dimensional magnetic behavior above T{sub SG} show quantum entanglement behavior χ(Τ)∝T{sup −α(Τ)} up to T{sub E}≈130 K. The α parameters have been deduced as a function of temperature and Co content, indicating the existence of random singlet phase in this temperature region. Above T{sub E} the paramagnetism is interpreted in terms of non-entangled spins giving rise to Curie–Weiss paramagnetism. The different intra- and inter-ribbon exchange interaction pathways have been calculated within a simple indirect coupling model. It is determined that the triangular motifs in the warwickite structure, together with the competing interactions, induce frustration. The spin-glass character is explained in terms of the substitutional disorder of the Mg, Fe and Co atoms at the two available crystallographic sites, and the frustration induced by the competing interactions. The Co substitution induces uniaxial anisotropy, increases the absolute magnetization and increases the spin-glass freezing temperature. The entanglement behavior is supported in the intermediate phase irrespective of the introduction of anisotropy by the Co substitution. - Highlights: • Spin-glass transition of MgFeBO{sub 4,} Mg{sub 0.5}Co{sub 0.5}FeBO{sub 4,} and CoFeBO{sub 4}. • Anisotropy and transition temperature T{sub SG} increases with Co substitution. • Dynamical scaling theory near T{sub SG} is fulfilled. • Quantum entanglement is observed in between T{sub SG} and T{sub E}=130 K. • Low dimensional random singlet phase

  6. Diode-pumped orthogonally polarized dual-wavelength Nd3+:LaBO2MoO4 laser

    Chen, Y. J.; Gong, X. H.; Lin, Y. F.; Huang, J. H.; Luo, Z. D.; Huang, Y. D.

    2013-08-01

    Polarized spectroscopic properties related to 1.07 μm laser operation of a 1.8 at.% Nd3+:LaBO2MoO4 crystal grown by the Czochralski method were investigated at room temperature. Using a 2.2-mm-thick, Z-cut Nd3+:LaBO2MoO4 crystal as gain medium, orthogonally polarized dual-wavelength laser at 1,068 and 1,074 nm was first realized in a plano-concave resonator end-pumped by a quasi-continuous-wave 795 nm diode laser. A total output peak power of 1.2 W with slope efficiency of 26 % around 1.07 μm was obtained. The influences of resonator length and pump power on output laser wavelength were also investigated.

  7. BoA大碟封套的彩虹效果,你也能做得到

    2005-01-01

    近年的“韩风”十分强劲.哪里都能嗅到它的气息。现在的韩剧热潮与昔日的日剧相比.具的有过之而无不及.韩剧的剧情已经成为大家茶余饭后的话题了;不只是韩剧.韩国的流行音乐也是相当受“韩迷”们欢迎的。前段时间韩国小天后BoA推出了精选大碟《BoA BEST OF SOUL》。

  8. LiSr4(BO3)3:Ce3+ phosphor as a new material for ESR dosimetry

    Jiang, L.H.; Zhang, Y.L.; Gong, X.M.; Pang, R.; Zhang, S.; Li, C.Y.; Su, Q.

    2014-01-01

    LiSr 4 (BO 3 ) 3 :0.01Ce 3+ phosphor was investigated to assess its potential as a material for measurements of radiotherapeutic doses with electron spin resonance (ESR). The ESR spectrum of the phosphor irradiated with 60 Co features five ESR signals. An isochronal annealing experiment has shown that the strongest of these signals is associated with the same trap center as the 473 K peak on the TL glow curve of this material. The dose–response is linear in the studied range from 0.89 to 90.30 Gy. Fading of the signal was also investigated. - Highlights: • LiSr 4 (BO 3 ) 3 :Ce 3+ phosphor can be used as an ESR dosimeter for radiation therapy. • The ESR signal originates from the same traps as the TL. • Dose–response is linear, and the fading is slow

  9. Study on the effect of Huo Xue Bo Gu Pill on secretion of endogenous bFGF after fracture

    Li Qiang; Wang Xiping; Guo E; Ye Liyan; Liu Yingjie

    2006-01-01

    Objective: To study the effect of a Chinese traditional preparation Huo Xue Bo Gu Pill on the serum contents of basic fibroblast growth factor (bFGF) after forearm fractures. Method: Serum bFGF contents were measured (with ELISA) in 62 patients with forearm fractures on d1, d8, d14 and d20 after the accident. Thirty-two of the patients were treated with Huo Xue Bo Gu Pills and thirty patients were not. Results: The serum contents of bFGF on d8 and d14 were significantly higher in the patients treated with the pills than those in patients not treated with the pills (P<0.05). Conclusion: This pill could promote the secretion of endogenous bFGF with proliferation of capillaries at the fracture site. (authors)

  10. A comparison of theory and flight test of the BO 105/BMR in hover and forward flight

    Mirick, Paul H.

    1988-01-01

    Four cases were selected for comparison with theoretical predictions using stability data obtained during the flight test of the Bearingless Main Rotor (BMR) on a Messerschmidt-Boelkow-Blohm BO 105 helicopter. The four cases selected form the flight test included two ground resonance cases and two air resonance cases. The BMR used four modified BO 105 blades attached to a bearingless hub. The hub consisted of dual fiberglass C-channel beams attached to the hub center at 0.0238R and attached to the blade root at 0.25R with blade pitch control provided by a torque tube. Analyses from Bell Helicopter Textron, Boeing Vertol, and Sikorsky Aircraft were compared with the data and the correlation ranged from very poor-to-poor to poor-to-fair.

  11. UV-induced acoustooptics of matrices containing BaHf(BO{sub 3}){sub 2} microcrystallites embedded into olygoetheracrylate photopolymer

    Majchrowski, A. [Institute of Applied Physics, Military University of Technology, Kaliskiego 2, 00-908 Warsaw (Poland); Kityk, I.V., E-mail: iwank74@gmail.com [Faculty of Electrical Engineering, Czestochowa University Technology, Armii Krajowej 17, Czestochowa (Poland); Jaroszewicz, L.R. [Institute of Applied Physics, Military University of Technology, Kaliskiego 2, 00-908 Warsaw (Poland); Fedorchuk, A.O. [Lviv National University of Veterinary Medicine and Biotechnologies, Department of Inorganic and Organic Chemistry, Lviv (Ukraine)

    2017-02-01

    UV-induced acoustooptics was explored for BaHf(BO{sub 3}){sub 2} microcrystallites with sizes varying within 5–30 μm range. The titled microcrystallites were embedded into the polymer matrices. The results were analyzed using both experimental optical as well as theoretical DFT approach. The measurements were done for principal acoustical frequencies: 0.5 MHz, 1 MHz, 2 MHz, and 3 MHz. The acoustical waves were excited by an electromechanical LiNbO{sub 3} piezoceramics transducers from acoustical generator. We explored dependence of the acoustooptical efficiency versus the photoinducing laser beam power, angle between the beams, acoustical power light polarization and temperature. We explored variation of the acoustooptical efficiency at 1150 nm probing cw He-Ne laser wavelength under influence of pulsed nitrogen laser at wavelength 371 nm working in the 7 ns regime with frequency repetition 6 Hz at power densities up to 900 MW/cm{sup 2}. Existence of some optimal conditions at about 1 MHz and UV photoinduced power equal to about 0.8 MW/cm{sup 2} was found. The spatial acousooptical gratings formation was observed. The DFT simulations of the charge density in main structural fragments under photoinducing UV beams is presented and principal role of the BO{sub 3} structural fragments is established. This is confirmed by crystallochemistry analysis. The phenomenological description is also presented. - Graphical abstract: Principal relation between the crystallochemistry and acoustically induced charge density space distribution changes. UV induced acoustooptical behaviours. - Highlights: • UV-induced increase of acoustooptics of BaHf(BO{sub 3}){sub 2} microcrystallites shown. • Principal role of the crystalline nano-interfaces is shown. • BO{sub 3} fragments play principal role.

  12. BoB, a best-of-breed automated text de-identification system for VHA clinical documents.

    Ferrández, Oscar; South, Brett R; Shen, Shuying; Friedlin, F Jeffrey; Samore, Matthew H; Meystre, Stéphane M

    2013-01-01

    De-identification allows faster and more collaborative clinical research while protecting patient confidentiality. Clinical narrative de-identification is a tedious process that can be alleviated by automated natural language processing methods. The goal of this research is the development of an automated text de-identification system for Veterans Health Administration (VHA) clinical documents. We devised a novel stepwise hybrid approach designed to improve the current strategies used for text de-identification. The proposed system is based on a previous study on the best de-identification methods for VHA documents. This best-of-breed automated clinical text de-identification system (aka BoB) tackles the problem as two separate tasks: (1) maximize patient confidentiality by redacting as much protected health information (PHI) as possible; and (2) leave de-identified documents in a usable state preserving as much clinical information as possible. We evaluated BoB with a manually annotated corpus of a variety of VHA clinical notes, as well as with the 2006 i2b2 de-identification challenge corpus. We present evaluations at the instance- and token-level, with detailed results for BoB's main components. Moreover, an existing text de-identification system was also included in our evaluation. BoB's design efficiently takes advantage of the methods implemented in its pipeline, resulting in high sensitivity values (especially for sensitive PHI categories) and a limited number of false positives. Our system successfully addressed VHA clinical document de-identification, and its hybrid stepwise design demonstrates robustness and efficiency, prioritizing patient confidentiality while leaving most clinical information intact.

  13. A contribution to better understanding of structural characteristics and tectonic phases of the Boč region, Periadriatic Fault Zone

    Lea Žibret

    2016-12-01

    Full Text Available The aim of this study was to determine properties of the tectonic contact between Permian/Mesozoic limestones and less competent Miocene clastites on the northeastern foothill of the Boč Mt. Because fault planes signifiantly mark the relief, this contact was studied by a detailed structural mapping, which showed that the Boč Mt. is limited by subvertical faults in its northeastern part. To ensure that mapped subvertical contact is compatible with regional geodynamics of the area, additionally paleostress analysis of fault-slip data was performed. Four individual paleostress tensor groups were documented in a wider Boč area and compared by published structural data from the border zone between Alps, Dinarides and Pannonian Basin. The oldest paleostress tensor group (Phase 1 is likely of Lower and Middle Miocene age and indicates SW-NE extension accommodated by W-E to WNW-ESE striking normal faults. Phase 2 can be correlated with Middle to Late Miocene NW-SE to WNWESE directed extension accommodated by NNE-SSW striking normal faults. Phase 3 is correlated with Late Miocene W-E directed contraction accommodated by N-S striking sinistral faults and NNE-SSW to NE-SW striking dextral faults. The youngest paleostress tensor group (Phase 4 fis well with Pliocene to Quaternary NNW-SSE to N-S directed contraction accommodated by NW-SE to W-E striking dextral faults and NE-SW striking reverse faults. Since the documented paleostress phases fis well with the geodynamic processes of the Alps-Dinarides-Carpathians territory the subvertical border in the northeastern part of Boč Mt. seems to be an acceptable structural solution. The study is important because the study area is located at interaction zone between two major Alpine fault systems: the Periadriatic and the Lavanttal faults.

  14. Novel ordered phases in the orthogonal dimer spin system SrCu2(BO3)2

    Takigawa, Masashi; Waki, Takeshi; Horvatic, Mladen; Berthier, Claude

    2010-01-01

    The magnetic properties of SrCu 2 (BO 3 ) 2 , a model spin system on the two-dimensional (2D) Shastry-Sutherland lattice, are reviewed with particular emphasis on the nuclear magnetic resonance (NMR) experiments. SrCu 2 (BO 3 ) 2 has a dimer singlet ground state at zero magnetic field and shows a sequence of magnetization plateaux at high magnetic fields. The plateaux are attributed to the localization of triplets into a superlattice due to mutual repulsion. Such a superstructure has been indeed observed at the 1/8 plateau by NMR experiments. Furthermore, the superstructure persists above the 1/8 plateau, where new phases have been identified by the torque and NMR measurements. SrCu 2 (BO 3 ) 2 also has the anisotropic Dzyaloshinski-Moriya interactions, which significantly change the ground state in magnetic fields. A recent development is the discovery of a new magnetic phase transition under high pressure. At 2.4 GPa, the 11 B NMR spectrum exhibits line splitting as a function of temperature in two steps. A gradual splitting below 30 K indicating loss of four-fold symmetry is followed by a further sudden splitting below 4 K marking a clear magnetic phase transition. The low-T phase has a doubled unit cell, yet with no spontaneous magnetic moment. A new type of valence-bond-solid (VBS) order is proposed. (author)

  15. Data Mining of Acupoint Characteristics from the Classical Medical Text: DongUiBoGam of Korean Medicine

    Taehyung Lee

    2014-01-01

    Full Text Available Throughout the history of East Asian medicine, different kinds of acupuncture treatment experiences have been accumulated in classical medical texts. Reexamining knowledge from classical medical texts is expected to provide meaningful information that could be utilized in current medical practices. In this study, we used data mining methods to analyze the association between acupoints and patterns of disorder with the classical medical book DongUiBoGam of Korean medicine. Using the term frequency-inverse document frequency (tf-idf method, we quantified the significance of acupoints to its targeting patterns and, conversely, the significance of patterns to acupoints. Through these processes, we extracted characteristics of each acupoint based on its treating patterns. We also drew practical information for selecting acupoints on certain patterns according to their association. Data analysis on DongUiBoGam’s acupuncture treatment gave us an insight into the main idea of DongUiBoGam. We strongly believe that our approach can provide a novel understanding of unknown characteristics of acupoint and pattern identification from the classical medical text using data mining methods.

  16. Knowledge Attitude And Practice Of Street Food Vendors In Selected Schools Within Bo City Southern Sierra Leone

    P.T. Lamin-Boima

    2017-12-01

    Full Text Available This paper attempts to investigate the lack of knowledge attitude and practices of street food vendors in Bo the Southern Province of Sierra Leone. A cross sectional study conducted among eighty-seven respondents vendors in forty-four in Bo City. Data was collected using a structured and semi structured questionnaire. The collected data is analysed using a simple descriptive statistics with the help Excel Microsoft ware. A statistical significance was found in relation to knowledge. Attitude towards food safety was negative self-reported practices by Street Food Vendors were statistically significant with low hygiene standards while predisposing factors showed relatively low personal hygiene poor environmental sanitation and low food safety practice. The realize consequences are utmost health risks of consuming street foods as food contamination has caused food borne diseases and outbreaks. It is recommended that standard training be provided for these vendors by the Bo City Council in collaboration with Njala University. It is essential that poor people in a developing country such as Sierra Leone be allowed to earn their livelihood by means of an easy-to-enter business such as street food vending when hygiene standards are sustained.

  17. Concentration quenching of Eu{sup 2+} doped Ca{sub 2}BO{sub 3}Cl

    Seed Ahmed, H.A.A. [Department of Physics, University of the Free State, Bloemfontein, ZA 9300 (South Africa); Department of Physics, University of Khartoum, Khartoum (Sudan); Swart, H.C. [Department of Physics, University of the Free State, Bloemfontein, ZA 9300 (South Africa); Bergman, Peber [Department of Physics, Chemistry and Biology, Linköping University, Linköping (Sweden); Kroon, R.E., E-mail: KroonRE@Uufs.ac.za [Department of Physics, University of the Free State, Bloemfontein, ZA 9300 (South Africa)

    2016-03-15

    Highlights: • Ca{sub 2}BO{sub 3}Cl doped with Eu{sup 2+} prepared by solid state reaction. • Concentration quenching studied by intensity and lifetime measurements. • Accurate determination of the critical transfer distance. • Interaction mechanism verified to be dipole–dipole interactions. - Abstract: With the aim of determining the concentration quenching mechanism of Eu{sup 2+} doped Ca{sub 2}BO{sub 3}Cl, a series of phosphors with a varied Eu{sup 2+} concentration (Ca{sub 2−x}BO{sub 3}Cl:xEu{sup 2+}) was synthesized by the solid state reaction method. The phase structure was determined by X-ray diffraction. Photoluminescence (PL) measurements showed broad excitation and emission signatures of the allowed f–d transition of Eu{sup 2+} ions. The PL emission intensity was found to be increased by increasing the concentration of Eu{sup 2+} ions up to x = 0.03 and then decreased as a result of the concentration quenching effect. The lifetime of the emission from the Eu{sup 2+} ions was measured and the decrease in the lifetime with increasing Eu{sup 2+} concentration confirmed that non-radiative energy transfer occurred between Eu{sup 2+} ions. From the luminescence data, the value of the critical transfer distance was calculated as 1.5 nm and the corresponding concentration quenching mechanism was verified to be a dipole–dipole interaction.

  18. Kristološki naglasci govora o Božjem milosrđu u promišljanjima izabranih crkvenih otaca

    Filić, Andrea

    2017-01-01

    Polazišno pitanje ovoga članka, nadahnuto tvrdnjama Waltera Kaspera, glasi: Ako milosrđe po definiciji u sebi nužno uključuje trpljenje može li se, dok držimo sigurnim da je netrpljivost jedna od bitnih vlastitosti božanske naravi, o njemu uopće govoriti, kako Kasper potiče, kao o temeljnom Božjem svojstvu i odrednici Božje biti? To se pitanje i odgovor na nj obrađuje pod kristološkim vidom i to na temelju promišljanja izabranih crkvenih otaca u čijim djelima pronalazimo govor o Božjem milosr...

  19. Experimental demonstration of bandwidth on demand (BoD) provisioning based on time scheduling in software-defined multi-domain optical networks

    Zhao, Yongli; Li, Yajie; Wang, Xinbo; Chen, Bowen; Zhang, Jie

    2016-09-01

    A hierarchical software-defined networking (SDN) control architecture is designed for multi-domain optical networks with the Open Daylight (ODL) controller. The OpenFlow-based Control Virtual Network Interface (CVNI) protocol is deployed between the network orchestrator and the domain controllers. Then, a dynamic bandwidth on demand (BoD) provisioning solution is proposed based on time scheduling in software-defined multi-domain optical networks (SD-MDON). Shared Risk Link Groups (SRLG)-disjoint routing schemes are adopted to separate each tenant for reliability. The SD-MDON testbed is built based on the proposed hierarchical control architecture. Then the proposed time scheduling-based BoD (Ts-BoD) solution is experimentally demonstrated on the testbed. The performance of the Ts-BoD solution is evaluated with respect to blocking probability, resource utilization, and lightpath setup latency.

  20. Ab initio studies on the optical effects in the deep ultraviolet nonlinear optical crystals of the KBe2BO3F2 family

    Kang Lei; Luo Siyang; Huang Hongwei; Lin, Z S; Chen, C T; Zheng Tao

    2012-01-01

    Electronic structures of the deep ultraviolet nonlinear optical crystals of the KBe 2 BO 3 F 2 (KBBF) family, including KBBF, RbBe 2 BO 3 F 2 and CsBe 2 BO 3 F 2 , have been investigated based on a plane-wave pseudopotential method. Their linear and nonlinear optical coefficients are also calculated, and are in good agreement with the experimental results. A real-space atom-cutting method is adopted to analyze the respective contributions of the alkali metal cations and anionic groups to optical response. The results show that the contributions of anionic groups to the nonlinear optical anisotropic responses are dominant, but the influence of the A-site alkali metal cations becomes slightly more pronounced with the increase of their radius. Moreover, the birefringence difference among these crystals strongly depends on the volume effect, i.e., the spatial density of the (BO 3 ) 3- anionic groups. (paper)

  1. Test of Shi et al. Method to Infer the Magnetic Reconnection Geometry from Spacecraft Data: MHD Simulation with Guide Field and Antiparallel Kinetic Simulation

    Denton, R.; Sonnerup, B. U. O.; Swisdak, M.; Birn, J.; Drake, J. F.; Heese, M.

    2012-01-01

    When analyzing data from an array of spacecraft (such as Cluster or MMS) crossing a site of magnetic reconnection, it is desirable to be able to accurately determine the orientation of the reconnection site. If the reconnection is quasi-two dimensional, there are three key directions, the direction of maximum inhomogeneity (the direction across the reconnection site), the direction of the reconnecting component of the magnetic field, and the direction of rough invariance (the "out of plane" direction). Using simulated spacecraft observations of magnetic reconnection in the geomagnetic tail, we extend our previous tests of the direction-finding method developed by Shi et al. (2005) and the method to determine the structure velocity relative to the spacecraft Vstr. These methods require data from four proximate spacecraft. We add artificial noise and calibration errors to the simulation fields, and then use the perturbed gradient of the magnetic field B and perturbed time derivative dB/dt, as described by Denton et al. (2010). Three new simulations are examined: a weakly three-dimensional, i.e., quasi-two-dimensional, MHD simulation without a guide field, a quasi-two-dimensional MHD simulation with a guide field, and a two-dimensional full dynamics kinetic simulation with inherent noise so that the apparent minimum gradient was not exactly zero, even without added artificial errors. We also examined variations of the spacecraft trajectory for the kinetic simulation. The accuracy of the directions found varied depending on the simulation and spacecraft trajectory, but all the directions could be found within about 10 for all cases. Various aspects of the method were examined, including how to choose averaging intervals and the best intervals for determining the directions and velocity. For the kinetic simulation, we also investigated in detail how the errors in the inferred gradient directions from the unmodified Shi et al. method (using the unperturbed gradient

  2. Host composition dependent tunable multicolor emission in the single-phase Ba2(Ln1-zTbz)(BO3)2Cl:Eu phosphors

    Xia, Z.; Zhuang, J.; Meijerink, A.; Jing, X.

    2013-01-01

    A new strategy based on the host composition design has been adopted to obtain efficient color-tunable emission from Ba2Ln0.97−zTbz(BO3)2Cl:0.03Eu (Ln = Y, Gd and Lu, z = 0–0.97) phosphors. This study reveals that the single-phase Ba2Ln1−zTbz(BO3)2Cl compounds can be applied to use allowed Eu2+

  3. The Cartoon quality in Internet. Clan TVE, Neox Kidz and Boing: entertainment platforms for young audiences

    Inmaculada Sánchez-Labella Martín

    2016-05-01

    Full Text Available With the advancement of technology, Internet it has become the primary means for audiovisual consumption while presenting a critical situation around the debate the quality of the content. With the emergence of DTT (Digital Terrestrial Television in Spain television networks, public and private, they have created new thematics channels focused on content for children. At the same time, with the rise of new electronic devices such as tablets and smartphones, they have moved such content to the network by creating of platforms whose programs are aimed childhood. The non-linearity and immediacy in consumption make the Internet becomes an active mean giving autonomy and freedom to access a multitude of content regardless of time and the device. In this situation the child consumers is the audience that worries both parents and educational institutions. Restless, therefore, that children do not find programs adjusted to their age. The quality concept harbors no concrete definition because of the multitude of factors and perspectives that influence it. This paper, and based on different measurement criteria set by countries like Argentina, Chile, Spain, France, Italy, Japan, Sweden, the University of Pennsylvania (USA or the ACTF (Australian Children´s Television Foundation poses as main objective to analyze the online platforms Clan RTVE, Neox Kidz and Boing of television TVE, Antena 3 and Telecinco, respectively, because they are considered spaces with audiovisual material created for children. With the intention of demonstrating that they are presented as quality environments for children who access them it will conduct a qualitative methodology. Using the content analysis technique to each of the animated titles we can say that the cartoons, as outlined above, are quality entertainment programs.

  4. Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

    Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki

    2016-01-01

    BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when not used in accordance with the use of the in-house Bos

  5. Dosimetric evaluation of using in-house BoS Frame Fixation Tool for the Head and Neck Cancer Patient

    Kim, Kwang Suk; Jo, Kwang Hyun; Choi, Byeon Ki [Dept. of Radiation Oncology, Samsung Seoul Hospital, Seoul (Korea, Republic of)

    2016-06-15

    BoS(Base of Skull) Frame, the fixation tool which is used for the proton of brain cancer increases the lateral penumbra by increasing the airgap (the distance between patient and beam jet), due to the collision of the beam of the posterior oblique direction. Thus, we manufactured the fixation tool per se for improving the limits of BoS frame, and we'd like to evaluate the utility of the manufactured fixation tool throughout this study. We've selected the 3 patients of brain cancer who have received the proton therapy from our hospital, and also selected the 6 beam angles; for this, we've selected the beam angle of the posterior oblique direction. We've measured the planned BoS frame and the distance of Snout for each beam which are planned for the treatment of the patient using the BoS frame. After this, we've proceeded with the set-up that is above the location which was recommended by the manufacturer of the BoS frame, at the same beam angle of the same patient, by using our in-house Bos frame fixation tool. The set-up was above 21 cm toward the superior direction, compared to the situation when the BoS frame was only used with the basic couch. After that, we've stacked the snout to the BoS frame as much as possible, and measured the distance of snout. We've also measured the airgap, based on the gap of that snout distance; and we've proceeded the normalization based on each dose (100% of each dose), after that, we've conducted the comparative analysis of lateral penumbra. Moreover, we've established the treatment plan according to the changed airgap which has been transformed to the Raystation 5.0 proton therapy planning system, and we've conducted the comparative analysis of DVH(Dose Volume Histogram). When comparing the result before using the in-house Bos frame fixation tool which was manufactured for each beam angle with the result after using the fixation tool, we could figure out that airgap than when

  6. Identification of fibroblast growth factor receptor 3 (FGFR3 as a protein receptor for botulinum neurotoxin serotype A (BoNT/A.

    Birgitte P S Jacky

    Full Text Available Botulinum neurotoxin serotype A (BoNT/A causes transient muscle paralysis by entering motor nerve terminals (MNTs where it cleaves the SNARE protein Synaptosomal-associated protein 25 (SNAP25206 to yield SNAP25197. Cleavage of SNAP25 results in blockage of synaptic vesicle fusion and inhibition of the release of acetylcholine. The specific uptake of BoNT/A into pre-synaptic nerve terminals is a tightly controlled multistep process, involving a combination of high and low affinity receptors. Interestingly, the C-terminal binding domain region of BoNT/A, HC/A, is homologous to fibroblast growth factors (FGFs, making it a possible ligand for Fibroblast Growth Factor Receptors (FGFRs. Here we present data supporting the identification of Fibroblast Growth Factor Receptor 3 (FGFR3 as a high affinity receptor for BoNT/A in neuronal cells. HC/A binds with high affinity to the two extra-cellular loops of FGFR3 and acts similar to an agonist ligand for FGFR3, resulting in phosphorylation of the receptor. Native ligands for FGFR3; FGF1, FGF2, and FGF9 compete for binding to FGFR3 and block BoNT/A cellular uptake. These findings show that FGFR3 plays a pivotal role in the specific uptake of BoNT/A across the cell membrane being part of a larger receptor complex involving ganglioside- and protein-protein interactions.

  7. Luminescent properties of (Y,Gd)BO3:Bi3+,RE3+ (RE=Eu, Tb) phosphor under VUV/UV excitation

    Zeng Xiaoqing; Im, Seoung-Jae; Jang, Sang-Hun; Kim, Young-Mo; Park, Hyoung-Bin; Son, Seung-Hyun; Hatanaka, Hidekazu; Kim, Gi-Young; Kim, Seul-Gi

    2006-01-01

    Bi 3+ - and RE 3+ -co-doped (Y,Gd)BO 3 phosphors were prepared and their luminescent properties under vacuum ultraviolet (VUV)/UV excitation were investigated. Strong red emission for (Y,Gd)BO 3 :Bi 3+ ,Eu 3+ and strong green emission for (Y,Gd)BO 3 :Bi 3+ ,Tb 3+ are observed under VUV excitation from 147 to 200 nm with a much broader excitation region than that of single Eu 3+ -doped or Tb 3+ -doped (Y,Gd)BO 3 phosphor. Strong emissions are also observed under UV excitation around 265 nm where as nearly no luminescence is observed for single Eu 3+ -doped or Tb 3+ -doped (Y,Gd)BO 3 . The luminescence enhancement of Bi 3+ - and RE 3+ -co-doped (Y,Gd)BO 3 phosphors is due to energy transfer from Bi 3+ ion to Eu 3+ or Tb 3+ ion not only in the VUV region but also in the UV region. Besides, host sensitization competition between Bi 3+ and Eu 3+ or Tb 3+ is also observed. The investigated phosphors may be preferable for devices with a VUV light 147-200 nm as an excitation source such as PDP or mercury-free fluorescent lamp

  8. Luminescence, Energy Transfer and Tunable Color of Ce3+- and Tb3+-Activated Na3Gd(BO3)2 Phosphors

    Zhang, Xinguo; Pan, Jialiang; Mo, Fuwang

    2017-07-01

    A series of blue Na3Gd(BO3)2:Ce3+ and blue-to-green color-tunable Na3Gd (BO3)2:Ce3+,Tb3+ phosphors were synthesized by the solid-state method. The luminescence, concentration quenching and energy transfer (ET) process of Na3Gd(BO3)2:Ce3+,Tb3+ were investigated. Both Ce3+ and Tb3+ occupy the Gd3+ site in the Na3Gd(BO3)2 host. Na3Gd(BO3)2:Ce3+ exhibits strong ultraviolet absorption and broadband blue emission. The Ce3+ sensitization effect on Tb3+ has been verified by the variation of PL/PLE spectra, the Ce3+ decay lifetimes and the energy transfer efficiency of Na3Gd(BO3)2:Ce3+,Tb3+ phosphors. The maximum Ce3+-Tb3+ ET efficiency has been calculated to be 95%. The emitting color of the obtained phosphors can be modulated from blue (0.179, 0.204) through bluish-green (0.271, 0.391) to green (0.349, 0.551) by properly changing the ratio of Ce3+/Tb3+.

  9. Identification and expression pattern analysis of BoMYB51 involved in indolic glucosinolate biosynthesis from broccoli (Brassica oleracea var. italica).

    Yu, Qingyue; Hao, Guodong; Zhou, Jianxin; Wang, Jingying; Evivie, Ejiroghene Ruona; Li, Jing

    2018-06-22

    Glucosinolates are a class of amino acid-derived specialized metabolites characteristic of the Brassicales order. Trp derived indolic glucosinolates are essential for the effective plant defense responses to a wide range of pathogens and herbivores. In Arabidopsis, MYB51 is the key transcription factor positively regulates indolic glucosinolate production by activating certain biosynthetic genes. In this study, we report the isolation and identification of a MYB51 from broccoli designated as BoMYB51. Overexpression of BoMYB51 in Arabidopsis increased indolic glucosinolate production by upregulating biosynthetic genes and resulted in enhanced flagellin22 (Flg22) induced callose deposition. The spatial expression pattern and responsive expression of BoMYB51 to several hormones and stress treatments were investigated by expressing the β-glucuronidase (GUS) reporter gene driven by BoMYB51 promotor in Arabidopsis and quantitative real-time PCR analysis in broccoli. Our study provides information on molecular characteristics of BoMYB51 and possible physiological process BoMYB51 may involve. Copyright © 2018 Elsevier Inc. All rights reserved.

  10. High-pressure studies on electronic and mechanical properties of FeBO3 (B = Ti, Mn, Cr) ceramics - a first-principles study

    Kishore, N.; Nagarajan, V.; Chandiramouli, R.

    2018-04-01

    Using the density functional theory (DFT) method, the electronic and mechanical properties of perovskites FeBO3 (B = Ti, Mn, Cr) nanostructures were studied in the pressure range of 0-100 GPa. The band structure studies show the change in the band structure upon substitution of different B cation in FeBO3 perovskite structure. The density of states spectrum gives the perception of change in the electronic properties of FeBO3 with the substitution of B cation. The bulk, shear and Young's moduli were calculated and an increase in the moduli is noticed. Moreover, the hardness increases under high pressure. The high-pressure studies of FeBO3 perovskite nanostructures are explored at atomistic level. The findings show that ductility and hardness of FeBO3 get increased upon an increase in the applied pressure. The substitution of Ti, Mn and Cr on FeBO3 shows a significant change in the electronic and mechanical properties.

  11. Studies for the electro-magnetic calorimeter {\\em SplitCal} for the SHiP experiment at CERN with shower direction reconstruction capability

    2018-01-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named {\\it SplitCal}, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200~MeV to 1~GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  12. Studies for the electro-magnetic calorimeter SplitCal for the SHiP experiment at CERN with shower direction reconstruction capability

    Bonivento, Walter M.

    2018-02-01

    This paper describes the basic ideas and the first simulation results of a new electro-magnetic calorimeter concept, named SplitCal, aimed at optimising the measurement of photon direction in fixed-target experiment configuration, with high photon detection efficiency. This calorimeter was designed for the invariant mass reconstruction of axion-like particles decaying into two photons in the mass range 200 MeV to 1 GeV for the proposed proton beam dump experiment SHiP at CERN. Preliminary results indicate that angular resolutions better than obtained by past experiments can be achieved with this design. An implementation of this concept with real technologies is under study.

  13. Measurement of parameters of scintillating bars with wavelength-shifting fibres and silicon photomultiplier readout for the SHiP Muon Detector

    Montanari, Alessandro; Baldini, Wander; Calcaterra, Alessandro; Lanfranchi, Gaia; Saputi, Alessandro; Khotyantsev, Alexey; Kudenko, Yury; Mefodev, Aleksandr; Mineev, Oleg

    2016-01-01

    The light yield and the time resolution of different types of 3 m long scintillating bars instrumented with wavelength shifting fibres and read out by different models of silicon photomultipliers have been measured at a test beam at the T9 area at the CERN Proton Synchrotron. The results obtained with different configurations are presented. A time resolution better than 800 ps, constant along the bar length within 20%, and a light yield of 140 (70) photo-electrons are obtained for bars 3 m long, 4.5 (5) cm wide and 2 (0.7) cm thick. These results nicely match the requirements for the Muon Detector of the SHiP experiment.

  14. [Non-pharmaceutical therapy of candidates for geriatric rehabilitation: Non-pharmaceutical therapy prescribed by SHI-accredited doctors after application for outpatient geriatric rehabilitative care].

    Krupp, Sonja; Schnoor, Maike; Lohse, Kristina; Katalinic, Alexander; Willkomm, Martin

    2015-06-01

    The rejection of an application for ambulant geriatric rehabilitation (AGRV) is usually justified by the argument that non-pharmaceutical therapy prescribed by doctors accredited by social housing institutions (SHI) would suffice. The reality in healthcare during the 6 months following an application is unknown. In this study 203 patients who had made an application for AGRV in the second half of 2010 in Flensburg, Lübeck or Ratzeburg were interviewed by telephone. The survey revealed that 25.7% of the applications for AGRV had been rejected. The majority of these patients received no ambulant non-pharmaceutical therapy (e.g. physical therapy, physiotherapy, occupational therapy, speech therapy or psychological therapy), less than 20% received more than 12 therapy sessions and in most cases exclusively physiotherapy. The 141 successful AGRV applicants received additional ambulant therapies of a similar magnitude. The difference between the intensified interdisciplinary therapy offered in the AGRV and additionally and the offer to rejected applicants is substantial.

  15. Wu Shangshi: One of the outstanding founders of Chinese modern geography%吴尚时对中国近代地理学的贡献与学术思想探讨

    陈吉余; 吴超羽; 司徒尚纪

    2017-01-01

    Wu Shangshi (1904-1947) is considered one of the outstanding modem geographers emerging in the early 20th century in China.It is partly a result of the introduction of modem sciences from the West.Wu graduated as a gold medalist in Sun Yat-sen University (SYU) in 1928.He was then granted scholarship to study geography in France.He studied at the University of Lyon and the University of Grenoble under the supervision of A.Allix,M.Pardé and R.Blanchard,who was one of the best known students of V.de la Blanche.In 1934,Wu finished his study in France and returned to SYU to serve as a professor of geography.He was head of the department in 1939-1945,the most difficult and perilous period during the Japanese invasion.The university moved constantly to flee the flames of war.The thousands of miles across south and south-west China became Wu's research field.To continue one's work under such circumstances required an extraordinary determination and dedication to science.Excessive hard work in tough environments ruined his health.Wu died in 1947 at the age of 43.Among the second generation of Chinese modem geographers,Wu was a rare example of an integrated geographer.He combined comprehensive and complex geographic thought with a balanced approach between holistic perspective and detailed research.In addition,he possessed an outstanding ability to conduct field work.As such,many of his research findings have withstood the test of time and remain relevant to this day.For instance,Wu proposed "one belt and three arcs" to summarize the distribution of the mountain ranges in China.On the long debates of the stratigraphic sequence of the red bed formations "Danxia" and "Nanxiong",Wu suggested an alternative viewpoint that the two formations could be deposited at approximately the same time but in different faces and it has been confirmed by modem geologic investigation some 50 years later.Both contributions were listed on the "Great Geographical Discoveries of China in 100

  16. Facile controlled synthesis different morphologies of LuBO{sub 3}:Ln{sup 3+} (Ln = Eu, Tb) phosphors and tunable luminescent properties

    Leng, Zhihua; Xiong, Hailong; Li, Linlin; Zhang, Nannan; Liu, Yali; Gan, Shucai, E-mail: gansc@jlu.edu.cn

    2015-10-15

    Sphere-like and cauliflower-like hexagonal-vaterite LuBO{sub 3} have been successfully synthesized for the first time via a chemical conversion route using Lu(OH)CO{sub 3} colloid spheres as sacrificial precursor and H{sub 3}BO{sub 3} as boron source without any additional surfactant. FTIR analysis provides an additional evidence of the formation of vaterite-type LuBO{sub 3} in this method. It was found that, an appropriate amount ethanol in the hydrothermal process has a great effect on the products' morphology and crystallinity. Time-dependent experiments indicate that the formation of LuBO{sub 3} crystals went through a two-stage growth process, which involves a fast nucleation of primary particles followed by a slow aggregation and crystallization of primary particles. An investigation on the photoluminescence (PL) properties of LuBO{sub 3}:Eu{sup 3+} phosphors with different morphologies indicates that their PL intensity are dependent on their crystallinity. The effect of Eu{sup 3+} and Tb{sup 3+} doping concentration on PL intensity were also investigated and the quenching concentration of LuBO{sub 3}:Eu{sup 3+} and LuBO{sub 3}:Tb{sup 3+} is 0.25 and 0.20, respectively. Moreover, for Eu{sup 3+}/Tb{sup 3+} doped LuBO{sub 3} phosphors, the color tones can be tuned from green, through green–yellow and yellow, and then to red by simply adjusting the relative doping concentrations of the Tb{sup 3+} and Eu{sup 3+} ions. - Highlights: • Sphere-like and cauliflower-like LuBO{sub 3} were obtained by a conversion route. • This method used Lu(OH)CO{sub 3} and H{sub 3}BO{sub 3} as the precursors for the first time. • Ethanol can control the products' morphology, crystallinity and PL intensity. • The emitting color tones vary with Tb{sup 3+}/Eu{sup 3+} doped concentration.

  17. DEAD-box helicase DDX27 regulates 3′ end formation of ribosomal 47S RNA and stably associates with the PeBoW-complex

    Kellner, Markus; Rohrmoser, Michaela [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany); Forné, Ignasi [Adolf Butenandt Institute, Ludwig Maximilians University of Munich, Center for Integrated Protein Science Munich (CIPSM), Schillerstr. 44, Munich 80336 (Germany); Voss, Kirsten; Burger, Kaspar; Mühl, Bastian; Gruber-Eber, Anita [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany); Kremmer, Elisabeth [Institute of Molecular Immunology, Helmholtz Center Munich, Marchioninistr. 25, Munich 81377 (Germany); Imhof, Axel [Adolf Butenandt Institute, Ludwig Maximilians University of Munich, Center for Integrated Protein Science Munich (CIPSM), Schillerstr. 44, Munich 80336 (Germany); Eick, Dirk, E-mail: eick@helmholtz-muenchen.de [Department of Molecular Epigenetics, Helmholtz Center Munich, Center for Integrated Protein Science Munich (CIPSM), Marchioninistr. 25, Munich 81377 (Germany)

    2015-05-15

    PeBoW, a trimeric complex consisting of pescadillo (Pes1), block of proliferation (Bop1), and the WD repeat protein 12 (WDR12), is essential for processing and maturation of mammalian 5.8S and 28S ribosomal RNAs. Applying a mass spectrometric analysis, we identified the DEAD-box helicase DDX27 as stably associated factor of the PeBoW-complex. DDX27 interacts with the PeBoW-complex via an evolutionary conserved F×F motif in the N-terminal domain and is recruited to the nucleolus via its basic C-terminal domain. This recruitment is RNA-dependent and occurs independently of the PeBoW-complex. Interestingly, knockdown of DDX27, but not of Pes1, induces the accumulation of an extended form of the primary 47S rRNA. We conclude that DDX27 can interact specifically with the Pes1 and Bop1 but fulfils critical function(s) for proper 3′ end formation of 47S rRNA independently of the PeBoW-complex. - Highlights: • DEAD-box helicase DDX27 is a new constituent of the PeBoW-complex. • The N-terminal F×F motif of DDX27 interacts with the PeBoW components Pes1 and Bop1. • Nucleolar anchoring of DDX27 via its basic C-terminal domain is RNA dependent. • Knockdown of DDX27 induces a specific defect in 3′ end formation of 47S rRNA.

  18. A near-UV-converted LiMgBO3:Dy3+ nanophosphor: Surface and spectral investigations

    Bedyal, A.K.; Kumar, Vinay; Prakash, Ram; Ntwaeaborwa, O.M.; Swart, H.C.

    2015-01-01

    Graphical abstract: - Highlights: • Combustion method was employed to synthesize LiMgBO 3 :Dy 3+ nanophosphors. • The phosphor can be efficiently excited by near-UV chips. • XPS was done to investigate the chemical constitution and chemical bonding state of elements in the LiMgBO 3 : Dy 3+ nanophosphor. • The calculated CIE coordinates (0.45, 0.46) were found to be in the white spectrum region. - Abstract: A near-ultra violet (UV) converted LiMgBO 3 :Dy 3+ nanophosphors have been synthesized by the combustion method. The structural, spectral and optical properties were examined by powder X-ray diffraction, fluorescent spectrophotometry and UV–vis spectroscopy. The excitation spectra of the phosphors contain sharp peaks at 294, 323, 348 and 385 nm due to the 4f–4f transition of the Dy 3+ ion. The phosphor is efficiently excited by near-UV chips. Upon near-UV excitation the phosphor emits intense blue and yellow with a weak red band centered at 484, 573 and 669 nm respectively, ascribed to the transition of Dy 3+ ion from 4 F 9/2 → 6 H 15/2 , 6 H 13/2 , 6 H 11/2 . The diffuse reflectance spectra of the phosphors were consistent with the excitation spectra and were used to calculate the band gap of the material, approximated to be 5.4 eV. The calculated CIE coordinates (0.45, 0.46) under 348 nm excitation were found to be in the white spectrum region. For surface investigation, X-ray photoelectron spectroscopy was used which confirms the presence of all the elements on the surface of the material

  19. Observation of soft phonon mode in TbFe3(BO3)4 by inelastic neutron scattering

    Pavlovskiy, M. S.; Shaykhutdinov, K. A.; Wu, L. S.; Ehlers, G.; Temerov, V. L.; Gudim, I. A.; Shinkorenko, A. S.; Podlesnyak, A.

    2018-02-01

    The phonon dispersion in terbium iron borate TbFe3(BO3)4 has been measured by inelastic neutron scattering in a temperature range 180

  20. Interpretation Problem of Czubek's Σa Measurement Method. Reference Experiment on H3BO3 Solutions

    Krynicka, E.; Gabanska, B.; Woznicka, U.; Dabrowska, J.; Burda, J.

    2001-12-01

    Czubek's method of measurement of the thermal neutron absorption cross section may be influenced by the energy spectrum of the thermal neutron flux (deviated from the Maxwellian distribution) which exist in the two-region geometric system. A correction function has been experimentally obtained to eliminate this disturbance. A series of reference measurements has been done on the H 3 BO 3 solution and Plexiglas outer moderator. The obtained function allows to interpret correctly measurements of the thermal neutron absorption rate in the range from 10 000 to 45 000 s -1 for hydrogenous samples. (author)

  1. Decorated Shastry-Sutherland lattice in the spin-(1)/(2) magnet CdCu2(BO3)2

    Janson, O.; Rousochatzakis, I.; Tsirlin, A. A.; Richter, J.; Skourski, Yu.; Rosner, H.

    2012-02-01

    We report the microscopic magnetic model for the spin-1/2 Heisenberg system CdCu2(BO3)2, one of the few quantum magnets showing the 1/2-magnetization plateau. Recent neutron diffraction experiments on this compound [M. Hase , Phys. Rev. BPLRBAQ0556-280510.1103/PhysRevB.80.104405 80, 104405 (2009)] evidenced long-range magnetic order, inconsistent with the previously suggested phenomenological magnetic model of isolated dimers and spin chains. Based on extensive density functional theory band structure calculations, exact diagonalizations, quantum Monte Carlo simulations, third-order perturbation theory as well as high-field magnetization measurements, we find that the magnetic properties of CdCu2(BO3)2 are accounted for by a frustrated quasi-2D magnetic model featuring four inequivalent exchange couplings: the leading antiferromagnetic coupling Jd within the structural Cu2O6 dimers, two interdimer couplings Jt1 and Jt2, forming magnetic tetramers, and a ferromagnetic coupling Jit between the tetramers. Based on comparison to the experimental data, we evaluate the ratios of the leading couplings Jd : Jt1 : Jt2 : Jit = 1 : 0.20 : 0.45 : -0.30, with Jd of about 178 K. The inequivalence of Jt1 and Jt2 largely lifts the frustration and triggers long-range antiferromagnetic ordering. The proposed model accounts correctly for the different magnetic moments localized on structurally inequivalent Cu atoms in the ground-state magnetic configuration. We extensively analyze the magnetic properties of this model, including a detailed description of the magnetically ordered ground state and its evolution in magnetic field with particular emphasis on the 1/2-magnetization plateau. Our results establish remarkable analogies to the Shastry-Sutherland model of SrCu2(BO3)2, and characterize the closely related CdCu2(BO3)2 as a material realization for the spin-1/2 decorated anisotropic Shastry-Sutherland lattice.

  2. First principles results on TbAl3(BO3)4: A promising magneto-optical material

    Saeed, Y.

    2011-11-21

    The electronic and optical properties of TbAl3(BO3)4 are determined using density functional theory. The calculated total magnetic moment of 5.96 μB is close to the expected moment of Tb3+. The frequency dependent dielectric function, refractive index, extinction coefficient, absorption, optical reflectivity, and energy loss function are explained in terms of the transitions between the valence and conduction bands. We find very high Kerr angles for ultraviolet light and potential for extension, even into the visible range by band structure design.

  3. Modelling soil dust aerosol in the Bodélé depression during the BoDEx campaign

    I. Tegen; B. Heinold; M. Todd; J. Helmert; R. Washington; O. Dubovik; O. Dubovik

    2006-01-01

    We present regional model simulations of the dust emission events during the Bodélé Dust Experiment (BoDEx) that was carried out in February and March 2005 in Chad. A box model version of the dust emission model is used to test different input parameters for the emission model, and to compare the dust emissions computed with observed wind speeds to those calculated with wind speeds from the regional model simulation. While field observations indicate that dust production occurs via self-abras...

  4. Modelling soil dust aerosol in the Bodélé depression during the BoDEx campaign

    Tegen , I.; Heinold , B.; Todd , M.; Helmert , J.; Washington , R.; Dubovik , O.

    2006-01-01

    International audience; We present regional model simulations of the dust emission events during the Bodélé Dust Experiment (BoDEx) that was carried out in February and March 2005 in Chad. A box model version of the dust emission model is used to test different input parameters for the emission model, and to compare the dust emissions computed with observed wind speeds to those calculated with wind speeds from the regional model simulation. While field observations indicate that dust producti...

  5. Modelling soil dust aerosol in the Bodélé depression during the BoDEx campaign

    R. Washington; J. Helmert; M. Todd; B. Heinold; I. Tegen; O. Dubovik

    2006-01-01

    We present regional model simulations of the dust emission events during the Bodélé Dust Experiment (BoDEx) that was carried out in February and March 2005 in Chad. A box model version of the dust emission model is used to test different input parameters for the emission model, and to compare the dust emissions computed with observed wind speeds to those calculated with wind speeds from the regional model simulation. While field observations indicate that dust production occurs via ...

  6. First principles results on TbAl3(BO3)4: A promising magneto-optical material

    Saeed, Y.; Singh, Nirpendra; Schwingenschlö gl, Udo

    2011-01-01

    The electronic and optical properties of TbAl3(BO3)4 are determined using density functional theory. The calculated total magnetic moment of 5.96 μB is close to the expected moment of Tb3+. The frequency dependent dielectric function, refractive index, extinction coefficient, absorption, optical reflectivity, and energy loss function are explained in terms of the transitions between the valence and conduction bands. We find very high Kerr angles for ultraviolet light and potential for extension, even into the visible range by band structure design.

  7. Molecular diversity analysis of Tetradium ruticarpum (WuZhuYu) in China based on inter-primer binding site (iPBS) markers and inter-simple sequence repeat (ISSR) markers.

    Xu, Jing-Yuan; Zhu, Yan; Yi, Ze; Wu, Gang; Xie, Guo-Yong; Qin, Min-Jian

    2018-01-01

    "Wu zhu yu", which is obtained from the dried unripe fruits of Tetradium ruticarpum (A. Jussieu) T. G. Hartley, has been used as a traditional Chinese medicine for treatment of headaches, abdominal colic, and hypertension for thousands of years. The present study was designed to assess the molecular genetic diversity among 25 collected accessions of T. ruticarpum (Wu zhu yu in Chinese) from different areas of China, based on inter-primer binding site (iPBS) markers and inter-simple sequence repeat (ISSR) markers. Thirteen ISSR primers generated 151 amplification bands, of which 130 were polymorphic. Out of 165 bands that were amplified using 10 iPBS primers, 152 were polymorphic. The iPBS markers displayed a higher proportion of polymorphic loci (PPL = 92.5%) than the ISSR markers (PPL = 84.9%). The results showed that T. ruticarpum possessed high loci polymorphism and genetic differentiation occurred in this plant. The combined data of iPBS and ISSR markers scored on 25 accessions produced five clusters that approximately matched the geographic distribution of the species. The results indicated that both iPBS and ISSR markers were reliable and effective tools for analyzing the genetic diversity in T. ruticarpum. Copyright © 2018 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.

  8. Tunable Yellow-Red Photoluminescence and Persistent Afterglow in Phosphors Ca4LaO(BO3)3:Eu3+ and Ca4EuO(BO3)3.

    Chen, Zhen; Pan, Yuexiao; Xi, Luqing; Pang, Ran; Huang, Shaoming; Liu, Guokui

    2016-11-07

    In most Eu 3+ activated phosphors, only red luminescence from the 5 D 0 is obtainable, and efficiency is limited by concentration quenching. Herein we report a new phosphor of Ca 4 LaO(BO 3 ) 3 :Eu 3+ (CLBO:Eu) with advanced photoluminescence properties. The yellow luminescence emitted from the 5 D 1,2 states is not thermally quenched at room temperature. The relative intensities of the yellow and red emission bands depend strongly on the Eu 3+ doping concentration. More importantly, concentration quenching of Eu 3+ photoluminescence is absent in this phosphor, and the stoichiometric compound of Ca 4 EuO(BO 3 ) 3 emits stronger luminescence than the Eu 3+ doped compounds of CLBO:Eu; it is three times stronger than that of a commercial red phosphor of Y 2 O 3 :Eu 3+ . Another beneficial phenomenon is that ligand-to-metal charge transfer (CT) transitions occur in the long UV region with the lowest charge transfer band (CTB) stretched down to about 3.67 eV (∼330 nm). The CT transitions significantly enhance Eu 3+ excitation, and thus result in stronger photoluminescence and promote trapping of excitons for persistent afterglow emission. Along with structure characterization, optical spectra and luminescence dynamics measured under various conditions as a function of Eu 3+ doping, temperature, and excitation wavelength are analyzed for a fundamental understanding of electronic interactions and for potential applications.

  9. Molecular Characterization of the First Bovine Herpesvirus 4 (BoHV-4 Strains Isolated from In Vitro Bovine Embryos production in Argentina.

    Erika González Altamiranda

    Full Text Available Bovine herpesvirus 4 (BoHV-4 is increasingly considered as responsible for various problems of the reproductive tract. The virus infects mainly blood mononuclear cells and displays specific tropism for vascular endothelia, reproductive and fetal tissues. Epidemiological studies suggest its impact on reproductive performance, and its presence in various sites in the reproductive tract highlights its potential transmission in transfer-stage embryos. This work describes the biological and genetic characterization of BoHV-4 strains isolated from an in vitro bovine embryo production system. BoHV-4 strains were isolated in 2011 and 2013 from granulosa cells and bovine oocytes from ovary batches collected at a local abattoir, used as "starting material" for in vitro production of bovine embryos. Compatible BoHV-4-CPE was observed in the co-culture of granulosa cells and oocytes with MDBK cells. The identity of the isolates was confirmed by PCR assays targeting three ORFs of the viral genome. The phylogenetic analyses of the strains suggest that they were evolutionary unlinked. Therefore it is possible that BoHV-4 ovary infections occurred regularly along the evolution of the virus, at least in Argentina, which can have implications in the systems of in vitro embryo production. Thus, although BoHV-4 does not appear to be a frequent risk factor for in vitro embryo production, data are still limited. This study reveals the potential of BoHV-4 transmission via embryo transfer. Moreover, the high variability among the BoHV-4 strains isolated from aborted cows in Argentina highlights the importance of further research on the role of this virus as an agent with the potential to cause reproductive disease in cattle. The genetic characterization of the isolated strains provides data to better understand the pathogenesis of BoHV-4 infections. Furthermore, it will lead to fundamental insights into the molecular aspects of the virus and the means by which these

  10. Clinical protection of goats against CpHV-1 induced genital disease with a BoHV-4-based vector expressing CpHV-1 gD.

    Gaetano Donofrio

    Full Text Available Caprine herpesvirus type 1 (CpHV-1 is an alphaherpesvirus causing genital disease leading to abortion in adult pregnant goats and a systemic disease with high morbility and mortality in kids. Further, Caprine herpesvirus 1 infection represents a valuable large animal model for human herpesvirus induced genital disease, exploitable for pathogenic studies, new vaccines and antiviral molecules testing. Here, the bovine herpesvirus 4 (BoHV-4 based vector derived from an apathogenic isolate of BoHV-4 and expressing the immunodominant CpHV-1 glycoprotein D (BoHV-4-A-gD(cpgD(106ΔTK was constructed and its ability to protect goats against CpHV-1 induced genital disease evaluated. The subcutaneous route of recombinant BoHV-4 administration was first tested in vivo/ex vivo by in vivo image analysis and in vitro by goat skin primary cultures preparation and transduction. Next, an exploratory immunization and safety study in goats was performed with two recombinant BoHV4, BoHV-4-A-gD(cpgD(106ΔTK or BoHV-4-CMV-IgK-gE2gD-TM. In both cases no clinical signs were evident but a good titer of serum neutralizing antibodies was produced in all inoculated animals. When a challenge experiment was performed in a new group of animals using a highly pathogenic dose of CpHV-1, all the vaccinated goats with BoHV-4-A-gD(cpgD(106ΔTK were protected toward CpHV-1 induced genital disease respect to the unvaccinated control which showed typical vaginal lesions with a high grade of clinical score as well as a long lasting viral shedding. In summary, the data acquired in the present study validate BoHV-4-based vector as a safe and effective viral vector for goat vaccination against CpHV-1 induced genital disease and pave the way for further applications.

  11. Synthesis and structural characterization of Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9}

    Braeuchle, Sebastian; Huppertz, Hubert [Innsbruck Univ. (Austria). Inst. fuer Allgemeine, Anorganische und Theoretische Chemie; Seibald, Markus [OSRAM GmbH, Schwabmuenchen (Germany). Corporate Innovation

    2017-07-01

    Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9} was prepared by high-temperature solid state synthesis at 900 C in a platinum crucible from lithium carbonate, potassium carbonate, boric acid, and europium(III) oxide. The title compound crystallizes in the orthorhombic space group Pca2{sub 1} (no. 29) (Z = 4). The structure was refined from single-crystal X-ray diffraction data: a = 21.126(2), b = 6.502(2), c = 17.619(2) Aa, V = 2420.1(2) Aa{sup 3}, R1 = 0.0183 and wR2 = 0.0412 for all data. The crystal structure of Li{sub 3}K{sub 3}Eu{sub 7}(BO{sub 3}){sub 9} is isotypic to Li{sub 3}K{sub 3}Y{sub 7}(BO{sub 3}){sub 9} featuring isolated BO{sub 3} units and LiO{sub 6} octahedra forming [Li{sub 3}B{sub 4}O{sub 21}] units in the ac plane, which are linked by additional BO{sub 3} units. The K{sup +} and Eu{sup 3+} cations are arranged in the cavities of the structure.

  12. Shi Diao and the Social Enlightenment Movement in the Late Qing Dynasty%时调唱歌与清末之社会启蒙运动

    李秋菊

    2017-01-01

    流传于市井的时调艺术以其俚俗时行的特质,与清末启蒙思潮正相契合,因而被一些感时忧世的爱国文人所关注、重视并加以利用,成为开启民智、再造人心、救亡图存、改良社会的利器。启蒙者根据清末流行的时调曲调新填的曲词,已经完全跳出儿女情思、古人古事、市井俗态的窠臼,不但在题材内容、创作动机等方面呈现出新的质素,不论是感慨时政、劝戒恶俗,还是破除迷信、介绍新知,无不体现出“启蒙救亡”的特色,而且承载着救亡图存的爱国精神及强身—强种—强国、男女平等平权与维新图强的思想,因而老树发新芽,在清末社会启蒙运动中扮演着重要角色。发掘时调艺术在清末启蒙思潮中所起的积极作用,对于清末社会启蒙运动研究的推进及重新评估时调之类的民间文艺的价值不无裨益。%Because of its popularity,Shi diao 时调 (popular tune) was in line with the social enlightenment movement in the late Qing Dynasty and thus attracted attention of the patriotic intellectuals,who employed this type of popular musical and literary genre to awaken Chinese people to their patriotic mission of saving their nation from outside bullying and invasion through mental and social reforms. Different from the old themes (e.g. love stories and legends) associated with this genre,Shi diao thus created acquired a distinctive feature of pursuing social enlightenment and reforms,which were intended to eliminate superstitions and backward customs and traditions,introduce new knowledge,enhance the mental and physical quality of Chinese people, and even achieve the equality between men and women. These patriotic themes made Shi

  13. Effects of Zr4+ codoping on the Lu0.8Sc0.2BO3:Ce scintillation materials

    Wu, Yuntao; Ren, Guohao; Ding, Dongzhou; Shang, Shanshan; Sun, Dandan; Zhang, Guoqing; Wang, Jiayu; Pan, Shangke; Yang, Fan

    2013-01-01

    Both Zr-codoped Lu 0.8 Sc 0.2 BO 3 :Ce polycrystalline powders and single crystals were obtained by solid-state reaction and Czochralski method, respectively. The effects of Zr codoping on the optical absorption, Ce 3+ /Ce 4+ ratio, scintillation efficiency, decay time and point defect in Lu 0.8 Sc 0.2 BO 3 :Ce materials were examined systematically. Our results show that there is no positive contribution of Zr 4+ ion codoping to the scintillation efficiency. And the reasons for the deterioration of scintillation efficiency by codoping Zr 4+ were revealed. - Highlights: ► No positive contribution of the Zr 4+ ions on the scintillation efficiency was found. ► New optical absorption band was in the region from 200 to 225 nm. ► Continuously accelerated decay time indicated that Zr 4+ codoping induced new point defects. ► The induced hole trap located at 1.91 eV below the conduction band.

  14. Study on the fabrication and photoluminescence characteristics of LiBO2 glass scintillators with the lanthanides activators

    Sin, S. W.; Hwang, J. H.; Choi, S. H.; Sumarokov, S. Yu.

    2002-01-01

    LiBO 2 glass scintillators were fabricated, and lanthanides(except Pm) oxides or chlorides were used as an activator. For the fabrication of LiBO 2 glasses, optimum heating conditions were obtained, and the photoluminescence of the glasses was measured by the monochromator. For the best transparency of the glass samples, optimum heating temperature and time are 1000 .deg. C and 40 min, respectively. The result of photoluminescence analysis shows that Pr, Nd, Gd, Ho, Er, Tm, Yb, and Lu are not good as activator. Because emission spectrum of samples with them was equal to that of sample without activator. In the case of samples with Europium, the peak of emission spectrum of Eu(III) is 810 nm. And Samples with Ce(III) are 760 nm, and Tb(III) are about 535 nm. Samples with Ce(III) and Tb(III) have the best PL intensity with added sugar in Ar reduction atmosphere, and sample with Eu(III) has the best intensity without a reducing process

  15. BO2-functionalized B3N3C54 heterofullerene as a possible candidate for molecular spintronics and nonlinear optics

    Srivastava, Ambrish Kumar; Pandey, Sarvesh Kumar; Misra, Neeraj

    2016-04-01

    BO2-substituted B3N3C54 heterofullerene was studied using density functional theory, and its electronic, magnetic and nonlinear optical properties are discussed. The substitution was considered at the B and N sites of the heterofullerene, in lower and higher spin states. We notice that BO2 substitution at the B sites of B3N3C54 heterofullerene leads to interesting properties, such as a smaller energy gap (0.66 eV) and a high spin magnetic moment (3 μ B). The density-of-states curves, molecular orbitals and spin density surfaces have been used to explain these facts. In addition, the first-order mean hyperpolarizability of B3N3C54 heterofullerene has been found to be significantly large (3.6 × 103 a.u.), which is due to smaller transition energy in the crucial excited state. This is reflected by the absorption spectra calculated using the time-dependent density functional theory method. These findings may be exploited to design novel materials for possible spintronic and electro-optical applications.

  16. Bovine herpes virus-1 (BoHV-1 detection in dairy cattle with reproductive problems in Sudan

    Amira Mohamed Elhassan

    2015-06-01

    Full Text Available The present work aimed to observe the infection pattern of Bovine herpes virus-1 (BoHV-1 in dairy cattle with reproductive problems in Sudan. A total of 140 samples comprising of vaginal swab (n=97, placenta (n=15, whole blood (n=19, uterine fluid (n=1, and serum (n=8 were collected from 16 dairy herds showing particularly high rate of abortion and infertility in Khartoum State. The samples were used for virus isolation, and were tested by Enzyme-Linked Immunosorbent Assay (ELISA and polymerase chain reaction (PCR. No virus could be isolated from the samples inoculated for isolation in cell culture. Out of 80 specimens tested by ELISA, 7 (8.75% were found to be positive, and one sample was doubtful. Using PCR, 11 (10.7% out of 103 samples were found to be positive. When comparing between two methods for DNA extraction, the DNA extracted by commercial kit was found to be better in quality as compared to the DNA extracted using phenol/chloroform/isoamyl-alcohol method. The study confirmed the presence of BoHV-1 in cattle farms with reproductive problems in Sudan.

  17. Silylene-Nickel Promoted Cleavage of B-O Bonds: From Catechol Borane to the Hydroborylene Ligand.

    Hadlington, Terrance J; Szilvási, Tibor; Driess, Matthias

    2017-06-19

    The first 16 valence electron [bis(NHC)](silylene)Ni 0 complex 1, [( TMS L)ClSi:→Ni(NHC) 2 ], bearing the acyclic amido-chlorosilylene ( TMS L)ClSi: ( TMS L=N(SiMe 3 )Dipp; Dipp=2,6-Pr i 2 C 6 H 4 ) and two NHC ligands (N-heterocyclic carbene=:C[(Pr i )NC(Me)] 2 ) was synthesized in high yield and structurally characterized. Compound 1 is capable of facile dihydrogen activation under ambient conditions to give the corresponding HSi-NiH complex 2. Most notably, 1 reacts with catechol borane to afford the unprecedented hydroborylene-coordinated (chloro)(silyl)nickel(II) complex 3, {[cat( TMS L)Si](Cl)Ni←:BH(NHC) 2 }, via the cleavage of two B-O bonds and simultaneous formation of two Si-O bonds. The mechanism for the formation of 3 was rationalized by means of DFT calculations, which highlight the powerful synergistic effects of the Si:→Ni moiety in the breaking of incredibly strong B-O bonds. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. 4-spin plaquette singlet state in the Shastry-Sutherland compound SrCu2(BO3)2

    Zayed, M. E.; Rüegg, Ch.; Larrea J., J.; Läuchli, A. M.; Panagopoulos, C.; Saxena, S. S.; Ellerby, M.; McMorrow, D. F.; Strässle, Th.; Klotz, S.; Hamel, G.; Sadykov, R. A.; Pomjakushin, V.; Boehm, M.; Jiménez-Ruiz, M.; Schneidewind, A.; Pomjakushina, E.; Stingaciu, M.; Conder, K.; Rønnow, H. M.

    2017-10-01

    The study of interacting spin systems is of fundamental importance for modern condensed-matter physics. On frustrated lattices, magnetic exchange interactions cannot be simultaneously satisfied, and often give rise to competing exotic ground states. The frustrated two-dimensional Shastry-Sutherland lattice realized by SrCu2(BO3)2 (refs ,) is an important test case for our understanding of quantum magnetism. It was constructed to have an exactly solvable 2-spin dimer singlet ground state within a certain range of exchange parameters and frustration. While the exact dimer state and the antiferromagnetic order at both ends of the phase diagram are well known, the ground state and spin correlations in the intermediate frustration range have been widely debated. We report here the first experimental identification of the conjectured plaquette singlet intermediate phase in SrCu2(BO3)2. It is observed by inelastic neutron scattering after pressure tuning to 21.5 kbar. This gapped singlet state leads to a transition to long-range antiferromagnetic order above 40 kbar, consistent with the existence of a deconfined quantum critical point.

  19. Effects of membrane curvature and pH on proton pumping activity of single cytochrome bo3 enzymes

    Li, Mengqiu; Khan, Sanobar; Rong, Honglin

    2017-01-01

    The molecular mechanism of proton pumping by heme-copper oxidases (HCO) has intrigued the scientific community since it was first proposed. We have recently reported a novel technology that enables the continuous characterisation of proton transport activity of a HCO and ubiquinol oxidase from...... Escherichia coli, cytochrome bo3, for hundreds of seconds on the single enzyme level (Li et al. J Am Chem Soc 137 (2015) 16055–16063). Here, we have extended these studies by additional experiments and analyses of the proton transfer rate as a function of proteoliposome size and pH at the N- and P......-side of single HCOs. Proton transport activity of cytochrome bo3 was found to decrease with increased curvature of the membrane. Furthermore, proton uptake at the N-side (proton entrance) was insensitive to pH between pH 6.4–8.4, while proton release at the P-side had an optimum pH of ~ 7.4, suggesting...

  20. Polarized spectra calculation and continuous wave laser operation of Yb-doped disordered Ca3La2(BO3)4 crystal

    Wang, Yeqing; Chen, Aixi; You, Zhenyu; Tu, Chaoyang

    2015-12-01

    A notable disorder crystal Yb:Ca3La2(BO3)4 crystal with Yb3+ ion doping concentration of 10 at.% was grown by the Czochralski method. The polarized absorption, polarized emission, and polarized gain cross sections were systematically calculated. The laser operations were investigated with Yb:Ca3La2(BO3)4 crystals cut along the a, b, and c crystallographic axes. The highest output power of 3.88 W was obtained by using the b-cut Yb:Ca3La2(BO3)4 crystal, with a slope efficiency of 62%. Additionally, it was confirmed that the output laser spectra were largely dependent on the output coupler.

  1. Polarized spectra calculation and continuous wave laser operation of Yb-doped disordered Ca3La2(BO3)4 crystal

    Wang, Yeqing; Chen, Aixi; You, Zhenyu; Tu, Chaoyang

    2015-01-01

    A notable disorder crystal Yb:Ca 3 La 2 (BO 3 ) 4 crystal with Yb 3+ ion doping concentration of 10 at.% was grown by the Czochralski method. The polarized absorption, polarized emission, and polarized gain cross sections were systematically calculated. The laser operations were investigated with Yb:Ca 3 La 2 (BO 3 ) 4 crystals cut along the a, b, and c crystallographic axes. The highest output power of 3.88 W was obtained by using the b-cut Yb:Ca 3 La 2 (BO 3 ) 4 crystal, with a slope efficiency of 62%. Additionally, it was confirmed that the output laser spectra were largely dependent on the output coupler. (paper)

  2. PENGARUH GAYA KEPEMIMPINAN TRANSFORMASIONAL DAN KOMPENSASI TERHADAP KINERJA KARYAWAN DENGAN MOTIVASI SEBAGAI VARIABEL INTERVENING (STUDI PADA INDUSTRI ALAS KAKI PT. BO KYUNG PASURUAN

    Wahyu Budi Priyanto

    2016-07-01

    Full Text Available Compensation is also self motivation factor for employees, where those things end in high-low level of work result or performance. This research purposes to test the effect of transformational leadership style, compensation, and motivation of employee’s performance, motivation as an effect mediator from transformational leadership style and compensation to employee’s performance in PT. Bo Kyung Pasuruan. This research is explanatory. In this research uses 96 samples from 2719 employees that work in PT. Bo Kyung Pasuruan. The result of Partial Least Square (PLS this research shows that transformational leadership style is positively effected but not significant to motivation and employee’s performance. Motivation affect transformational leadership style of employee’s performance, and motivation does not influence compensation of employee’s performance in PT. Bo Kyung Pasuruan.

  3. “Ni{sub 5}TiO{sub 7}” is Ni{sub 5}TiO{sub 4}(BO{sub 3}){sub 2}

    Nalbandyan, V.B.

    2017-05-15

    It is shown that the compound known as Ni{sub 5}TiO{sub 7} and considered as a promising catalyst and oxidation product of alloys does not exist and its XRD pattern actually corresponds to Ni{sub 5}TiO{sub 4}(BO{sub 3}){sub 2} - Graphical abstract: XRD pattern of “Ni{sub 5}TiO{sub 7}” (top) is identical to that for Ni{sub 5}TiO{sub 4}(BO{sub 3}){sub 2} (bottom) based on single-crystal structural data. - Highlights: • Popular catalyst known as Ni{sub 5}TiO{sub 7} is actually Ni{sub 5}TiO{sub 4}(BO{sub 3}){sub 2}. • B{sub 2}O{sub 3} came from the flux used for crystal growth. • Some authors reporting this phase did not use any boron compounds.

  4. A modern approach for epitope prediction: identification of foot-and-mouth disease virus peptides binding bovine leukocyte antigen (BoLA) class I molecules

    Pandya, Mital; Rasmussen, Michael; Hansen, Andreas

    2015-01-01

    Major histocompatibility complex (MHC) class I molecules regulate adaptive immune responses through the presentation of antigenic peptides to CD8+ T cells. Polymorphisms in the peptide binding region of class I molecules determine peptide binding affinity and stability during antigen presentation......, and different antigen peptide motifs are associated with specific genetic sequences of class I molecules. Understanding bovine leukocyte antigen (BoLA), peptide-MHC class I binding specificities may facilitate development of vaccines or reagents for quantifying the adaptive immune response to intracellular...... pathogens, such as foot-and-mouth disease virus (FMDV). Six synthetic BoLA class I (BoLA-I) molecules were produced, and the peptide binding motif was generated for five of the six molecules using a combined approach of positional scanning combinatorial peptide libraries (PSCPLs) and neural network...

  5. Icon of the Holy Mandylion and representation of multi-layered visual identity of Božidar Vuković

    Borozan Igor

    2015-01-01

    Full Text Available It was in the monastery of Saint Francis in Venice in the year 1520 when Božidar Vuković purchased the icon of the Holy Mandylion. By that particular acquisition, this prominent publisher originating from Zeta has visualized his new position in the sixteenth century Venice. The multi-layered identity of Božidar Vuković was manifested by the subsequent inclusion of the noble coat of arms of the House of Vuković on the back of the icon. By the use of verbal and visual language the artificial initiation of Božidar Vuković within the distinguished members of Venetian society has been confirmed. [Projekat Ministarstva nauke Republike Srbije, br. 177001: Predstave identiteta u verbalno-vizuelnoj kulturi novog doba

  6. Multichannel Luminescence Properties of Mixed-Valent Eu2+/Eu3+ Coactivated SrAl3BO7 Nanocrystalline Phosphors for Near-UV LEDs.

    Liu, Xiaoming; Xie, Weijie; Lü, Ying; Feng, Jingchun; Tang, Xinghua; Lin, Jun; Dai, Yuhua; Xie, Yu; Yan, Liushui

    2017-11-20

    Up to now, orchestrating the coexistence of Eu 2+ and Eu 3+ activators in a single host lattice has been an extremely difficult task, especially for the appearance of the characteristic emission of Eu 2+ and Eu 3+ in order to generate white light. Nevertheless, here we demonstrate a new Eu 2+ /Eu 3+ coactivated SrAl 3 BO 7 nanocrystalline phosphor with abundant and excellent multichannel luminescence properties. A series of Eu 2+ /Eu 3+ coactivated SrAl 3 BO 7 nanocrystalline phosphors were prepared through a Pechini-type sol-gel method followed by a reduction process. With excitation of UV/NUV light, the prepared SrAl 3 BO 7 :Eu 2+ ,Eu 3+ phosphors show not only the characteristic f-f transitions of Eu 3+ ion ( 5 D J → 7 F J,J' , J, J' = 0-3), but also the 5d → 4f transitions of Eu 2+ ion with comparable intensity from 400 to 700 nm in the whole visible spectral region. The luminescence color of the SrAl 3 BO 7 :Eu 2+ ,Eu 3+ phosphor can be tuned from blue, blue-green, white, and orange to orange-red by changing the excitation wavelength, the overall doping concentration of europium ions (Eu 2+ , Eu 3+ ), and the relative ratio of Eu 2+ to Eu 3+ ions to some extent. A single-phase white-light emission has been realized in SrAl 3 BO 7 :Eu 2+ ,Eu 3+ phosphor. The obtained SrAl 3 BO 7 :Eu 2+ ,Eu 3+ phosphor has potential application in the area of NUV white-light-emitting diodes.

  7. Czochralski growth and optical properties of Li 6Gd 1-xEu x(BO 3) 3 ( x=0-1) single crystals

    Yavetskiy, R. P.; Dolzhenkova, E. F.; Dubovik, M. F.; Korshikova, T. I.; Tolmachev, A. V.

    2005-04-01

    It was shown that a continuous series of Li 6Gd 1-xEu x(BO 3) 3 solid solutions exist within the whole concentration range ( x=0-1). Li 6Gd 1-xEu x(BO 3) 3 ( x=0-0.03; 1) single crystals up to 25 mm in length and up to 20 mm in diameter have been grown by the Czochralski method. The structural perfection of the crystals has been estimated from etch patterns and XPA analysis results. The optical absorption and thermally stimulated luminescence of the grown crystals has been studied.

  8. MCNP calculation of the critical H_3BO_3 concentrations for the first fuel loading into the reactor core of NPP MO-3-4 units

    Vrban, B.; Lueley, J.; Farkas, G.; Hascik, J.; Hinca, R.; Petriska, M.; Slugen, V.

    2012-01-01

    The purpose of the analysis was the determination of critical H_3BO_3 concentrations for the first fuel loading into the reactor core of MO34 units using 2"n"d generation fuel during the first start-up of new unit using calculation code MCNP 1.60. H_3BO_3 concentrations were computed for the given temperature of the primary circuit and position of the 6"t"h safety control rod group. Because of the very first start-up of these units, detailed analyses of active-core parameters are required by National Regulatory Authority and needed for safe operation of nuclear facility. (authors)

  9. Magnetic properties of Co 2 2+ Co 1 - x 3+ Fe x 3+ BO5 ( x = 0.10) single crystals with a ludwigite structure

    Knyazev, Yu. V.; Kazak, N. V.; Bayukov, O. A.; Platunov, M. S.; Velikanov, D. A.; Bezmaternykh, L. N.; Ivanova, N. B.; Ovchinnikov, S. G.

    2017-04-01

    The investigation of mixed Co-Fe ludwigite single crystals shows that their magnetic properties are close to the magnetic properties of Fe3BO5 despite the predominance of cobalt ions. The magnetic properties of Co3 - x Fe x BO5 single crystals with x = 0.10 are studied in detail. Magnetometric measurements demonstrate a strong magnetic anisotropy with easy magnetization axis b, and the orbital magnetic moment of cobalt is in a frozen state. The detected temperature dependence of the absorption of Mössbauer spectra allowed us to determine the magnetic ordering temperature, which agrees with the results of magnetization measurements ( T C = 84 K).

  10. Primerjava učinkovitosti različnih kombinacij herbicidov in njihov vpliv na plevelno združbo v vinogradu

    Arnečič, Suzana

    2011-01-01

    V letih 2008 in 2009 smo na Univerzitetnem centru Meranovo Fakultete za kmetijstvo in biosistemske vede v vinogradu sorte 'Renski rizling' ugotavljali učinkovitost enajstih herbicidov oziroma njihovih kombinacij za zatiranje plevelne združbe pod trtami. Poskus je bil zastavljen po metodi naključnih blokov v treh ponovitvah. Ocenjevali smo učinkovitost herbicidov in pokrovnost tal s plevelno združbo. V letu 2008 je bila statistično značilna najmanjša pokrovnost tal s plevelno združbo pri obrav...

  11. Improved Prediction of Bovine Leucocyte Antigens (BoLA) Presented Ligands by Use of Mass-Spectrometry-Determined Ligand and in Vitro Binding Data

    Nielsen, Morten; Connelley, Tim; Ternette, Nicola

    2018-01-01

    Peptide binding to MHC class I molecules is the single most selective step in antigen presentation and the strongest single correlate to peptide cellular immunogenicity. The cost of experimentally characterizing the rules of peptide presentation for a given MHC-I molecule is extensive, and predic...... available at http://www.cbs.dtu.dk/services/NetMHCpan/NetBoLApan . The approach has here been applied to the BoLA-I system, but the pipeline is readily applicable to MHC systems in other species....

  12. Assessment of benzene-induced hematotoxicity using a human-like hematopoietic lineage in NOD/Shi-scid/IL-2Rγnull mice.

    Masayuki Takahashi

    Full Text Available Despite recent advancements, it is still difficult to evaluate in vivo responses to toxicants in humans. Development of a system that can mimic the in vivo responses of human cells will enable more accurate health risk assessments. A surrogate human hematopoietic lineage can be established in NOD/Shi-scid/IL-2Rγ(null (NOG mice by transplanting human hematopoietic stem/progenitor cells (Hu-NOG mice. Here, we first evaluated the toxic response of human-like hematopoietic lineage in NOG mice to a representative toxic agent, benzene. Flow cytometric analysis showed that benzene caused a significant decrease in the number of human hematopoietic stem/progenitor cells in the bone marrow and the number of human leukocytes in the peripheral blood and hematopoietic organs. Next, we established chimeric mice by transplanting C57BL/6 mouse-derived bone marrow cells into NOG mice (Mo-NOG mice. A comparison of the degree of benzene-induced hematotoxicity in donor-derived hematopoietic lineage cells within Mo-NOG mice indicated that the toxic response of Hu-NOG mice reflected interspecies differences in susceptibilities to benzene. Responses to the toxic effects of benzene were greater in lymphoid cells than in myeloid cells in Mo-NOG and Hu-NOG mice. These findings suggested that Hu-NOG mice may be a powerful in vivo tool for assessing hematotoxicity in humans, while accounting for interspecies differences.

  13. [Textual research on Guang dong xin yu (New Sayings of Guangdong) quoted in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica].

    Zhang, Ruixian; Zhang, Wei; Li, Jian; Liang, Fei

    2014-05-01

    Altogether 15 terms for Guang dong xin yu (New Sayings of Guangdong) were used in Ben cao gang mu shi yi (Supplements to Compendium of Materia Medica), including Yue yu (Cantonese sayings), Chong yu (Sayings from Insect Drug), Jie yu (Sayings from Crustacean Drug), Xin yu (New Sayings), Yue hai xiang yu (Fragrant Sayings from Cantonese Region), Yue zhi mu yu (Sayings from Plants in Cantonese Annals), Guang dong suo yu (Trivial Sayings from Guangdong), Yue shan lu (Records of Cantonese Mountains), Yue lu (Cantonese Records), Jiao guang lu (Joint Guangdong Records), Yue cao zhi (Records of Cantonese Grasses), Guang guo lu (Records of Guangdong Fruits), Nan yue suo ji (Trivial Records of Southern Canton), Guang zhi (Guangdong Records), Yue zhi (Cantonese Records) etc. dealing with 57 sorts of drugs (with individual overlapping ones), the author of Xin yu was Qu Dajun, a surviving fogy of the Ming Dynasty actively involved in the activities to restore the old dynasty and resist the Qing Dynasty, and was persecuted in the literary inquisition in which his works were burnt so that Zhao Xuemin, when quoting his texts, had to go in a roundabout way.

  14. Estimativa por infravermelho da concentração da unidade estrutural b-O-4 em ligninas de angiospermas tropicais Infrared estimates of the concentration of the b-o-4 structural unit in lignins of tropical angiosperms

    Heber dos Santos Abreu

    1997-12-01

    Full Text Available Five Björkman lignins, codified as AM, LL, GG, PP and AP, were isolated from wood species of Aspidosperma macrocarpum Mart., Lophanthera lactescens Ducke, Gallesia gorazema (Vell. Miq., Peltogyne paniculata Bth. and Aspidosperma polyneuron Muell. Arg., respectively. Analyses of the lignins were carried out by Fourier transformed infrared spectroscopy using an experimental technique, Diffusely Reflected Infrared Fourier Transformed (DRIFT, admitting in the original spectra a band at 1500 cm-1 as an internal reference. Application of a deconvolution technique made possible to estimate the percentage per mol of b-O-4 unit content around 65.5% to AM, 68.0% to LL, 71.0% to GG. 73.4% to PP and 75.0% to AP, toward AM

  15. Study of total oxidation of ethanol using the perovskite-type oxides LaBO{sub 3} (B= Mn, Ni, Fe); Estudo da oxidacao total do etanol usando oxidos tipo perovskita LaBO{sub 3} (B= Mn, Ni, Fe)

    Soares, Ana Brigida [Centro Federal de Educacao Tecnologica do Espirito Santo, Vitoria, ES (Brazil). Centro de Ciencias e Tecnologias Quimicas]. E-mail: brigida@cefetes.br; Silva, Paulo Roberto Nagipe da [Universidade Estadual do Norte Fluminense (UENF), Campos dos Goytacases, RJ (Brazil). Centro de Ciencias e Tecnologia; Freitas, Jair C.C. [Universidade Federal do Espirito Santo, Vitoria, ES (Brazil). Centro de Ciencias Exatas. Dept. de Fisica; Almeida, Clara Muniz de [Pontificia Univ. Catolica do Rio de Janeiro, RJ (Brazil). Dept. de Fisica

    2007-09-15

    The present work investigated the effect of coprecipitation-oxidant synthesis on the specific surface area of perovskite-type oxides LaBO{sub 3} (BMn, Ni, Fe) for total oxidation of ethanol. The perovskite-type oxides were characterized by X-ray diffraction, nitrogen adsorption (BET method), thermogravimetric analysis (TGA-DTA), TPR and X-ray photoelectron spectroscopy (XPS). Through method involving the coprecipitation-oxidant was possible to obtain catalysts with different BET specific surface areas, of 33-51 m{sup 2}/g. The results of the catalytic test confirmed that all oxides investigated in this work have specific catalytic activity for total oxidation of ethanol, though the temperatures for total conversion change for each transition metal. (author)

  16. Un imaginaire dévoilé/déphasé. Stratégies narratives et mémoire culturelle dans le roman 54 des Wu Ming

    Matteo Martelli

    2015-02-01

    Full Text Available This essay analyses the narrative strategies through which cultural memory is portrayed in 54, a novel in which Wu Ming (a collective of four Italian fiction writers suggests a literary mapping of the Fifties. This is obtained by a recovery of a shared imaginary tradition which is close to the reader, mixing fictional and historical characters, films, books, different genres of popular literature. Nevertheless, the rewriting of these imaginary traditions involves their displacement, a presentation which is constantly created from an unusual point of view. Thus, shifting the image of what is already known, the text inquires into several modalities of a questioning about cultural memory and its redefinition in relation to contemporary culture. By focusing on these elements, this study proposes an analysis which starts from the construction of the characters, the role of suspense and the adoption of multiple traditions of novel writing.

  17. Cattle with the BoLA class II DRB3*0902 allele have significantly lower bovine leukemia proviral loads.

    Hayashi, Takumi; Mekata, Hirohisa; Sekiguchi, Satoshi; Kirino, Yumi; Mitoma, Shuya; Honkawa, Kazuyuki; Horii, Yoichiro; Norimine, Junzo

    2017-09-12

    The bovine MHC (BoLA) class II DRB3 alleles are associated with polyclonal expansion of lymphocytes caused by bovine leukemia virus (BLV) infection in cattle. To examine whether the DRB3*0902 allele, one of the resistance-associated alleles, is associated with the proviral load, we measured BLV proviral load of BLV-infected cattle and clarified their DRB3 alleles. Fifty-seven animals with DRB3*0902 were identified out of 835 BLV-infected cattle and had significantly lower proviral load (Pclass II DRA/DRB3*0902 molecule plays an important immunological role in suppressing viral replication, resulting in resistance to the disease progression.

  18. Passively Q-switched microchip Er, Yb:YAl3(BO3)4 diode-pumped laser.

    Kisel, V E; Gorbachenya, K N; Yasukevich, A S; Ivashko, A M; Kuleshov, N V; Maltsev, V V; Leonyuk, N I

    2012-07-01

    We report, for the first time to our knowledge, a diode-pumped cw and passively Q-switched microchip Er, Yb:YAl(3)(BO(3))(4) laser. A maximal output power of 800 mW at 1602 nm in the cw regime was obtained at an absorbed pump power of 7.7 W. By using Co(2+):MgAl(2)O(4) as a saturable absorber, a TEM(00)-mode Q-switched average output power of 315 mW was demonstrated at 1522 nm, with pulse duration of 5 ns and pulse energy of 5.25 μJ at a repetition rate of 60 kHz.

  19. Diode-pumped CW frequency-doubled Nd:CNGG-BiBO blue laser at 468 nm

    Lü, Y F; Xia, J; Lin, J Q; Gao, X; Dong, Y; Xu, L J; Sun, G C; Zhao, Z M; Tan, Y; Chen, J F; Liu, Z X; Li, C L; Cai, H X; Liu, Z T; Ma, Z Y; Ning, G B

    2011-01-01

    Efficient and compact blue laser output at 468 nm is generated by intracavity frequency doubling of a continuous-wave (CW) diode-pumped Nd:CNGG laser at 935 nm. With 17.8 W of diode pump power and the frequency-doubling crystal BiB 3 O 6 (BiBO), a maximum output power of 490 mW in the blue spectral range at 468 nm has been achieved, corresponding to an optical-to-optical conversion efficiency of 2.8%; the output power stability over 4 h is better than 2.6%. To the best of our knowledge, this is first work on intracavity frequency doubling of a diode pumped Nd:CNGG laser at 935 nm

  20. Manifestation of magnetoelastic interactions in Raman spectra of HoxNd1−xFe3(BO34 crystals

    A. S. Krylov

    2018-04-01

    Full Text Available Raman spectra of Ho1−xNdxFe(BO34 (x=1, 0.75, 0.5, 0.25 have been studied in temperature range 10–400K. Two compositions (x=1, x=0.75 demonstrate structural phase transition with soft mode restoration. The addition of Nd atoms increases interatomic spacing and decreases the temperature of structural phase transition. The solid solutions (x=0.75, 0.5, 0.25 demonstrate the emergence of the peaks corresponding to magnetoelastic interaction below Néel temperature. The order parameter of the magnetic phase transition has been determined. The equal concentrations of holmium and neodymium atoms prevent magnon soft modes condensation caused by exchange interactions in Fe–O–Fe chains are observed. Calculations confirm the data obtained in the experiment.

  1. Rare-Earth Calcium Oxyborate Piezoelectric Crystals ReCa4O(BO33: Growth and Piezoelectric Characterizations

    Fapeng Yu

    2014-07-01

    Full Text Available Rare-earth calcium oxyborate crystals, ReCa4O(BO33 (ReCOB, Re = Er, Y, Gd, Sm, Nd, Pr, and La , are potential piezoelectric materials for ultrahigh temperature sensor applications, due to their high electrical resistivity at elevated temperature, high piezoelectric sensitivity and temperature stability. In this paper, different techniques for ReCOB single-crystal growth are introduced, including the Bridgman and Czochralski pulling methods. Crystal orientations and the relationships between the crystallographic and physical axes of the monoclinic ReCOB crystals are discussed. The procedures for dielectric, elastic, electromechanical and piezoelectric property characterization, taking advantage of the impedance method, are presented. In addition, the maximum piezoelectric coefficients for different piezoelectric vibration modes are explored, and the optimized crystal cuts free of piezoelectric cross-talk are obtained by rotation calculations.

  2. Analysis of green luminescent Tb3+:Ca4GdO(BO3)3 powder phosphor

    Vengala Rao, B.; Rambabu, U.; Buddhudu, S.

    2007-01-01

    This paper reports on the emission analysis of a green luminescent Tb 3+ :Ca 4 GdO(BO 3 ) 3 powder phosphor based on the measurements of excitation, emission and lifetimes. Besides this, we have also observed an intense green emission from this powder phosphor under an UV source. The emission transitions of ( 5 D 4 →7 F 3,4,5,6 ) with λ exci =257 nm have been measured. Particularly, the green emission transition ( 5 D 4 →7 F 5 ) at 553 nm has been found to be more prominent and intense. Such green strong emission displaying powder phosphor will find applications in the development of coated screens in certain electronic systems. Apart from the emission analysis of this phosphor, XRD, SEM and FTIR studies have also been carried out in order to understand the structural details of it

  3. μ+SR Investigation of the Shastry-Sutherland Compound SrCu2(BO3)2

    Sassa, Y.; Wang, S.; Sugiyama, J.; Amato, A.; Rønnow, H. M.; Rüegg, C.; Månsson, M.

    In this study we have investigated the low-dimensional correlated spin system SrCu2(BO3)2 using ambient-pressure muon spin rotation/relaxation (μ+SR). The zero-field data are similar to previously published data, but in addition, they give an even clearer sign of the two low-temperature transitions (T1 ≈ 3 and T2 ≈ 7 K), which is fully consistent with inelastic neutron scattering (INS) measurements. Longitudinal field (LF) data clearly show that the copper spins are highly dynamic and a saturation of the low-temperature relaxation rate indicate that these are indeed two-dimensional (2D) quantum spin fluctuations.

  4. Ab initio energetics of LaBO3(001) (B=Mn, Fe, Co, and Ni) for solid oxide fuel cell cathodes

    Lee, Yueh-Lin; Kleis, Jesper; Rossmeisl, Jan

    2009-01-01

    LaBO3 (B=Mn, Fe, Co, and Ni) perovskites form a family of materials of significant interest for cathodes of solid oxide fuel cells (SOFCs). In this paper ab initio methods are used to study both bulk and surface properties of relevance for SOFCs, including vacancy formation and oxygen binding...... reduction reaction on perovskite SOFC cathodes....

  5. Potential tunable white-emitting phosphor LiSr4(BO3)3:Ce3+, Eu2+ for ultraviolet light-emitting diodes

    Wang Qian; Deng Degang; Hua Youjie; Huang Lihui; Wang Huanping; Zhao Shilong; Jia Guohua; Li Chenxia; Xu Shiqing

    2012-01-01

    A novel Ce 3+ /Eu 2+ co-activated LiSr 4 (BO 3 ) 3 phosphor has been synthesized by traditional solid-state reaction. The samples could display varied color emission from blue towards white and ultimately to yellow under the excitation of ultraviolet (UV) light with the appropriate adjustment of the relative proportion of Ce 3+ /Eu 2+ . The resonance-type energy transfer mechanism from Ce 3+ to Eu 2+ in LiSr 4 (BO 3 ) 3 :Ce 3+ , Eu 2+ phosphors is dominant by electric dipole–dipole interaction, and the critical distance is calculated to be about 29.14 Å by the spectra overlap method. White light was observed from LiSr 4 (BO 3 ) 3 :mCe 3+ , nEu 2+ phosphors with chromaticity coordinates (0.34, 0.30) upon 350 nm excitation. The LiSr 4 (BO 3 ) 3 :Ce 3+ , Eu 2+ phosphor has potential applications as an UV radiation-converting phosphor for white light-emitting diodes. - Highlights: ► White light was observed from the novel phosphor with chromaticity coordinate (0.34, 0.30). ► Resonant energy transfer between Ce 3+ and Eu 2+ occurs in the novel phosphor. ► This novel phosphor has potential applications as a UV-driven light-emitting phosphor.

  6. Stěžejní východiska a koncepce současné anglické náboženské pedagogiky

    Karim Sidibe

    2017-08-01

    Full Text Available Tento článek si klade za cíl analyzovat didaktické koncepce výuky náboženství pěti hlavních teoretiků současné anglické náboženské pedagogiky, Harolda Loukese, Niniana Smarta, Davida Haye, Cliva Errickera a Andrewa Wrighta. Loukes a Smart položili základy současné náboženské pedagogiky v Anglii v 60. letech 20. století. Loukes využil poznatky vývojové psychologie a Smart výuku sekularizoval. Hayovo pojetí z 80. let 20. století akcentuje niternou duchovní skutečnost žáků. V současné době Erricker aplikuje postmoderní filosofická východiska na výuku a akcentuje individualitu a nezávislost žáků, zatímco Wright vychází z filosofických východisek kritického realismu a akcentuje nutnost teologické a filosofické diskuze na hodinách náboženství.

  7. Concentration quenching of Eu2+ in a thermal-stable yellow phosphor Ca2BO3Cl:Eu2+ for LED application

    Zhang Xinguo; Zhang Jilin; Dong Zhiyue; Shi Jianxin; Gong Menglian

    2012-01-01

    A piece-shaped phosphor Ca 2 BO 3 Cl: Eu 2+ was synthesized by solid-state reaction method. This phosphor exhibited wide absorption in ultra-violet and visible range, and bright yellow emission band centering at 570 nm. The concentration quenching mechanism was verified to be a dipole–dipole interaction, and its critical transfer distance was about 17 Å by both calculated crystal structural method and experimental spectral method. This phosphor has a good thermal stability with a quenching temperature (T 1/2 ) of 200 °C. Yellow and white LEDs were fabricated with this phosphor and near UV chips, and the yellow LED has a high color purity of 97.0% and promising current tolerant property, while the white LED shows a luminous efficiency of 11.68 lm/W. - Highlights: ► Broadband excitable and strong yellow-emitting Ca 2 BO 3 Cl: Eu 2+ phosphor is obtained by solid state reaction. ► Concentration quenching mechanism of Ca 2 BO 3 Cl: Eu 2+ is dipole–dipole interaction. ► Quenching temperature (T 1/2 ) of Ca 2 BO 3 Cl: Eu 2+ is at 200 °C. ► As synthesized material can be used for LED phosphor application.

  8. Petrophysical characterization of the Dolomitic Member of the Boñar Formation (Upper Cretaceous; Duero Basin, Spain) as a potential CO2 reservoir

    Suarez-Gonzalez, A.; Kovacs, C.; Herrero-Hernandez, A.; Gomez-Fernandez, F.

    2016-07-01

    Boñar Formation (Upper Cretaceous) is a mainly carbonate succession, which outcrops in the North of Duero Basin (Spain). According to the existing data, the Dolomitic Member of this formation appears to be the most suitable for geological storage of CO2. The main objective of this study is to find evidence to support, clarify and specify –at an initial level– the potential of the Dolomitic Member of the Boñar Formation as a geological reservoir. The study covers density, porosity and permeability tests on samples obtained from the outcrop of the succession near the village of Boñar (León). According to the analysis and interpretation of the mentioned petrophysical properties, the porosity of the Dolomitic Member is within the acceptable range for CO2 geological storage, but the permeability values are far too low. This minimizes the possibilities of the Dolomitic Member –and probably of the whole Boñar Formation– to become an appropriate CO2 reservoir. (Author)

  9. Synthesis and photoluminescence properties of Pb{sup 2+} doped inorganic borate phosphor NaSr{sub 4}(BO{sub 3}){sub 3}

    Chauhan, A. O., E-mail: abhi2718@gmail.com; Koparkar, K. A.; Omanwar, S. K. [Department of Physics, SantGadge Baba Amravati University, Amravati MH, 444602 (India); Bajaj, N. S. [Department of Physics, Toshniwal Art, Commerce and Science College, Sengoan, Hingoli MH (India)

    2016-05-06

    A series of Inorganic borate phosphors NaSr{sub 4}(BO{sub 3}){sub 3} doped with Pb{sup 2+} was successfully synthesized by modified solid state diffusion method. The crystal structure and the phase purity of sample were characterized by powder X-ray diffraction (XRD). The photoluminescence properties of synthesized materials were investigated using spectrofluorometer at room temperature. The phosphor show strong broad band emission spectra in UVA region maximum at 370 nm under the excitation of 289 nm. The dependence of the emission intensity on the Pb{sup 2+} concentration for the NaSr{sub 4}(BO{sub 3}){sub 3} were studied in details. The concentration quenching of Pb{sup 2+} doped NaSr{sub 4}(BO{sub 3}){sub 3} was observed at 0.02 mol. The Stokes shifts of NaSr{sub 4}(BO{sub 3}){sub 3}: Pb{sup 2+} phosphor was calculated to be 7574 cm{sup −1}.

  10. X-ray photoelectron spectroscopy and full potential studies of the electronic density of state of ternary oxyborate Na3La9O3(BO3)(8)

    Reshak, Ali H; Auluck, S.; Kityk, I. V.

    2009-01-01

    Roč. 472, č. 1-2 (2009), s. 30-34 ISSN 0925-8388 Institutional research plan: CEZ:AV0Z60870520 Keywords : Electronic structure * FPLAPW * DFT Subject RIV: BO - Biophysics Impact factor: 2.135, year: 2009

  11. 40 CFR 721.6660 - Polymer of alkanepolyol and poly-alkyl-poly-iso-cyan-ato-car-bo-mo-no-cycle, acetone oxime...

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymer of alkanepolyol and poly-alkyl... Polymer of alkanepolyol and poly-alkyl-poly-iso-cyan-ato-car-bo-mo-no-cycle, acetone oxime-blocked... substance identified generically as a polymer of alkane-polyol and polyalkylpolyisocyanatocarbomonocy- cle...

  12. BoNT-A related changes of cortical activity in patients suffering from severe hand paralysis with arm spasticity following ischemic stroke.

    Veverka, Tomáš; Hluštík, Petr; Tomášová, Zuzana; Hok, Pavel; Otruba, Pavel; Král, Michal; Tüdös, Zbyněk; Zapletalová, Jana; Herzig, Roman; Krobot, Alois; Kaňovský, Petr

    2012-08-15

    Investigations were performed to localize and analyze the botulinum toxin (BoNT-A) related changes of cerebral cortex activation in chronic stroke patients suffering from severe hand paralysis with arm spasticity. Effects on task- related cerebral activation were evaluated by functional magnetic resonance imaging (fMRI). 14 patients (5 males, 9 females, mean age 55.3 years) suffering from upper limb post-stroke spasticity were investigated. The change of arm spasticity was assessed by using the modified Ashworth scale (MAS). FMRI sessions were performed before (W0), four weeks (W4) and 11 weeks (W11) after BoNT-A application. Patients were scanned while performing imaginary movement with the impaired hand. Group fMRI analysis included patient age as a covariate. BoNT-A treatment was effective in alleviation of arm spasticity. Mean MAS was at Week 0: 2.5 (SD 0.53), at Week 4: 1.45 (SD 0.38), at Week 11: 2.32 (SD 0.44). Task-related fMRI prior to the treatment showed extensive activation of bilateral frontoparietal sensorimotor cortical areas, anterior cingulate gyrus, pallidum, thalamus and cerebellum. Effective BoNT-A treatment (W4) resulted in partial reduction of active network volume in most of the observed areas, whereas BoNT-free data (W11) revealed further volume reduction in the sensorimotor network. On direct comparison, significant activation decreases associated with BoNT-A treatment were located in areas outside the classical sensorimotor system, namely, ipsilesional lateral occipital cortex, supramarginal gyrus and precuneus cortex. On comparison of W4 and W11, no activation increases were found, instead, activation further decreased in ipsilesional insular cortex, contralesional superior frontal gyrus and bilateral frontal pole. Whole brain activation patterns during BoNT-A treatment of post-stroke arm spasticity and further follow up document predominantly gradual changes both within and outside the classical sensorimotor system. Copyright © 2012

  13. Crystal structure and luminescence properties of a novel red-emitting phosphor BaAlBO{sub 3}F{sub 2}:Eu{sup 3+}

    Chen, Wanping, E-mail: cwp0918@aliyun.com; Zhou, Ahong; Liu, Yan; Dai, Xiaoyan; Yang, Xin

    2014-12-15

    A series of novel red-emitting phosphors BaAlBO{sub 3}F{sub 2}:xEu{sup 3+} (0.001≤x≤0.08) were first synthesized via a high temperature solid-state reaction. X-ray diffraction and photoluminescence spectroscopy were used to characterize the crystal structure and photoluminescence properties of the phosphor, respectively. The phosphor can be effectively excited with a 395 nm light, and shows a dominant {sup 5}D{sub 0}−{sup 7}F{sub 2} emission with chromatic coordination of 0.628 and 0.372. The optimal doping concentration is about 0.04. Rietveld refinement results and the luminescence behavior of Eu{sup 3+} indicate that the Eu{sup 3+} ion occupies a C{sub 3} symmetry site, and the host BaAlBO{sub 3}F{sub 2} has a hexagonal structure with P-6 space group. In addition, the phosphor could be a potential candidate as red-emitting phosphor for application in white light-emitting diode. - Graphical abstract: The luminescence behavior and Rietveld refinement of BaAlBO{sub 3}F{sub 2}:Eu{sup 3+} indicate that the red-emitting phosphor has potential application in white LED and the host has a hexagonal structure with P-6 space group. - Highlights: • A novel red-emitting phosphor BaAlBO{sub 3}F{sub 2}:Eu{sup 3+} is first synthesized. • The crystal structure of BaAlBO{sub 3}F{sub 2} is confirmed. • The phosphor shows potential application in white LED.

  14. Growth, thermal and spectral characteristics of Yb{sup 3+}:Sr{sub 6}YSc(BO{sub 3}){sub 6} crystal

    Yuan, Feifei [Key Laboratory of Optoelectronic Materials Chemistry and Physics, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou 350002 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhang, Lizhen; Huang, Yisheng; Sun, Shijia [Key Laboratory of Optoelectronic Materials Chemistry and Physics, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou 350002 (China); Lin, Zhoubin, E-mail: lzb@fjirsm.ac.cn [Key Laboratory of Optoelectronic Materials Chemistry and Physics, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou 350002 (China); Wang, Guofu [Key Laboratory of Optoelectronic Materials Chemistry and Physics, Fujian Institute of Research on the Structure of Matter, Chinese Academy of Sciences, Fuzhou 350002 (China)

    2014-09-15

    Highlights: • A new crystal of Yb{sup 3+}:Sr{sub 6}YSc(BO{sub 3}){sub 6} was grown successfully from a Li{sub 6}B{sub 4}O{sub 9} flux. • Yb{sup 3+}:Sr{sub 6}YSc(BO{sub 3}){sub 6} crystal has good thermal, mechanical and spectral properties. • Yb{sup 3+}:Sr{sub 6}YSc(BO{sub 3}){sub 6} has long fluorescence lifetime, broad absorption and emission bands. - Abstract: A crystal of Yb{sup 3+}:Sr{sub 6}YSc(BO{sub 3}){sub 6} was grown successfully from Li{sub 6}B{sub 4}O{sub 9} flux by the top-seeded solution growth method. The crystal's thermal, mechanical and spectral characteristics were investigated in detail. It possesses small thermal expansion coefficients, moderate thermal conductivities, and large hardness. The crystal has a strong absorption band at 967 nm with a full width at half-maximum of about 3.4 nm. The crystal has a broad emission band at 1016 nm with the full width at half-maximum of about 64 nm. The emission cross sections were calculated by reciprocity method and Füchtbauer-Ladenburg formula. The fluorescence lifetime is 5.98 ms. The results reveal that Yb{sup 3+}:Sr{sub 6}YSc(BO{sub 3}){sub 6} crystal is a new promising tunable and ultrashort pulse laser crystal.

  15. Applying dam height-storage curve to geomorphic features analysis within virtual geographic environment: a case study of the Hong-Shi-Mao watershed

    Wang, Daojun; Gong, Jianhua; Ma, Ainai; Li, Wenhang; Wang, Xijun

    2005-10-01

    There are generally two kinds of approaches to studying geomorphic features in terms of the quantification level and difference of major considerations. One is the earlier qualitative characterization, and the other is the 2-dimension measurement that includes section pattern and projection pattern. With the development of geo-information technology, especially the 3-D geo-visualization and virtual geographic environments (VGE), 3-dimension measurement and dynamic interactive between users and geo-data/geo-graphics can be developed to understand geomorphic features deeply, and to benefit to the effective applications of such features for geographic projects like dam construction. Storage-elevation curve is very useful for site selection of projects and flood dispatching in water conservancy region, but it is just a tool querying one value from the other one. In fact, storage-elevation curve can represent comprehensively the geomorphic features including vertical section, cross section of the stream and the landform nearby. In this paper, we use quadratic regression equation shaped like y = ax2 + bx + c and the DEM data of Hong-Shi-Mao watershed, Zi Chang County, ShaanXi Province, China to find out the relationship between the coefficients of the equation and the geomorphic features based on VGE platform. It's exciting that the coefficient "a" appear to be correlative strongly with the stream scale, and the coefficient "b" may give an index to the valley shape. In the end, we use a sub-basin named Hao-Jia-Gou of the watershed as an application. The result of correlative research about quadratic regression equation and geomorphic features can save computing and improve the efficiency in silt dam systems planning.

  16. Pituitary-dependent hyperadrenocorticism in a shi tzu dog treated with twice-daily oral trilostane: a case reportHyperadrenocorticismo hipófise dependente em um cão shi tzu tratado com trilostane oral a cada 12 horas: relato de caso

    Lucas Alécio Gomes

    2012-10-01

    Full Text Available Hyperadrenocorticism can be defined as a chronic high circulating cortisol, and is a relatively common disease in dogs when compared to cats. Of dogs with naturally occurring HAC, 80 to 85% have pituitary-dependent hyperadrenocorticism (PDH, which is an excessive secretion of ACTH by the pituitary, causing bilateral adrenal hyperplasia and excessive secretion of glucocorticoids. More than 90% of dogs with PDH have a pituitary tumor. The aim of this article is to report a case of a dog, seven years old, female, Shi Tzu, that presented with panting, polyuria/polydipsia, polyphagia, pendulous abdomen and bilateral abdominal alopecia, and intermittent weakness in the pelvic limbs. Based on laboratorial and screening tests a pituitary-dependent hyperadrenocorticism was diagnosed and treated with twice-daily trilostane, orally. In the early monitoring period, ACTH test was performed with an unusual interval (to 30 days. In this case, the starting dose didn’t show improvement in the cutaneous alterations, requiring an increase on the dosage. Hiperadrenocorticismo (HAC é uma doença relativamente comum em cães quando comparado aos gatos e pode ser definido como aumento persistente do cortisol na circulação sanguínea. Quanto ao tipo de manifestação o HAC hipófise-dependente ocorre em 80 a 85% dos casos, causando secreção excessiva de ACTH pela hipófise levando ao aumento bilateral das glândulas adrenais. Mais de 90% dos casos de HAC hipófise-dependente (em cães ocorrem devido a tumores na glândula. O objetivo deste trabalho é relatar o caso de uma cadela da raça Shi Tzu, com sete anos de idade, que apresentou respiração ofegante, poliúria/polidipsia, polifagia, abdome pendular, alopecia bilateral simétrica e fraqueza intermitente em membros pélvicos. Os exames laboratoriais de rotina associados aos testes de triagem confirmaram a suspeita de hiperadrenocorticismo hipófise dependente. O tratamento desde o início tem sido com

  17. Elemental Abundances and their Implications for the Chemical Enrichment of the Boötes I Ultrafaint Galaxy

    Gilmore, Gerard; Norris, John E.; Monaco, Lorenzo; Yong, David; Wyse, Rosemary F. G.; Geisler, D.

    2013-01-01

    We present a double-blind analysis of high-dispersion spectra of seven red giant members of the Boötes I ultrafaint dwarf spheroidal galaxy, complemented with re-analysis of a similar spectrum of an eighth-member star. The stars cover [Fe/H] from -3.7 to -1.9 and include a CEMP-no star with [Fe/H] = -3.33. We conclude from our chemical abundance data that Boötes I has evolved as a self-enriching star-forming system, from essentially primordial initial abundances. This allows us uniquely to investigate the place of CEMP-no stars in a chemically evolving system, in addition to limiting the timescale of star formation. The elemental abundances are formally consistent with a halo-like distribution, with enhanced mean [α/Fe] and small scatter about the mean. This is in accord with the high-mass stellar initial mass function in this low-stellar-density, low-metallicity system being indistinguishable from the present-day solar neighborhood value. There is a non-significant hint of a decline in [α/Fe] with [Fe/H]; together with the low scatter, this requires low star formation rates, allowing time for supernova ejecta to be mixed over the large spatial scales of interest. One star has very high [Ti/Fe], but we do not confirm a previously published high value of [Mg/Fe] for another star. We discuss the existence of CEMP-no stars, and the absence of any stars with lower CEMP-no enhancements at higher [Fe/H], a situation that is consistent with knowledge of CEMP-no stars in the Galactic field. We show that this observation requires there be two enrichment paths at very low metallicities: CEMP-no and "carbon-normal." Based on observations collected at the European Southern Observatory, Paranal, Chile (Proposal P82.182.B-0372, PI: G. Gilmore).

  18. The oxonitridoborate Eu{sub 5}(BO{sub 2.51(7)}N{sub 0.49(7)}){sub 4} and the mixed-valent borates Sr{sub 3}Ln{sub 2}(BO{sub 3}){sub 4} (Ln = Ho, Er)

    Hoeppe, Henning A.; Kazmierczak, Karolina; Grumbt, Christine; Schindler, Lisa [Institut fuer Physik, Universitaet Augsburg (Germany); Schellenberg, Inga; Poettgen, Rainer [Westfaelische Wilhelms-Universitaet Muenster, Institut fuer Anorganische und Analytische Chemie (Germany)

    2013-11-04

    The crystal structures of the mixed borates Sr{sub 3}Er{sub 2}(BO{sub 3}){sub 4} [Pnma, no. 62, Z = 4, a = 738.08(2), b = 1588.94(4), c = 867.81(2) pm, 683 reflections, 70 parameters, R1 = 0.037, wR2 = 0.077] and Sr{sub 3}Ho{sub 2}(BO{sub 3}){sub 4} [Pnma, no. 62, Z = 4, a = 738.45(7), b = 1591.55(12), c = 871.03(9) pm, 691 reflections, 59 parameters, R1 = 0.069, wR2 = 0.098] and europium oxonitridoborate Eu{sub 5}(BO{sub 2.51(7)}N{sub 0.49(7)}){sub 4} [Pnma, no. 62, Z = 12, a = 2232.2(5), b = 1603.1(3), c = 879.59(18) pm, 2880 reflections, 313 parameters, R1 = 0.027, wR2 = 0.059] were solved from single-crystal X-ray diffraction data. Eu{sub 5}(BO{sub 2.51(7)}N{sub 0.49(7)}){sub 4} adopts a threefold superstructure of the structure of Sr{sub 3}Ln{sub 2}(BO{sub 3}){sub 4} (Ln = Ho, Er). In both structure types, the different cations are situated on common sites with a pronounced preferential occupation but no complete ordering. These conclusions are based on the crystal structure refinement, {sup 151}Eu Moessbauer spectroscopy and MAPLE (Madelung part of lattice energy) calculations. The proposed Eu{sub 5}(BO{sub 3}){sub 4} contains nitrogen and has a formula Eu{sub 5}(BO{sub 2.51(7)}N{sub 0.49(7)}){sub 4} as confirmed by {sup 151}Eu Moessbauer spectroscopy. The optical reflectance spectrum of Eu{sub 5}(BO{sub 2.51(7)}N{sub 0.49(7)}){sub 4} is in accordance with the yellow colour of the compound. (Copyright copyright 2013 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  19. Prevalence of swallowing and speech problems in daily life after chemoradiation for head and neck cancer based on cut-off scores of the patient-reported outcome measures SWAL-QOL and SHI.

    Rinkel, Rico N; Verdonck-de Leeuw, Irma M; Doornaert, Patricia; Buter, Jan; de Bree, Remco; Langendijk, Johannes A; Aaronson, Neil K; Leemans, C René

    2016-07-01

    The objective of this study is to assess swallowing and speech outcome after chemoradiation therapy for head and neck cancer, based on the patient-reported outcome measures Swallowing Quality of Life Questionnaire (SWAL-QOL) and Speech Handicap Index (SHI), both provided with cut-off scores. This is a cross-sectional study. Department of Otolaryngology/Head and Neck Surgery of a University Medical Center. Sixty patients, 6 months to 5 years after chemoradiation for head and neck squamous cell carcinoma. Swallowing Quality of Life Questionnaire (SWAL-QOL) and SHI, both validated in Dutch and provided with cut-off scores. Associations were tested between the outcome measures and independent variables (age, gender, tumor stage and site, and radiotherapy technique, time since treatment, comorbidity and food intake). Fifty-two patients returned the SWAL-QOL and 47 the SHI (response rate 87 and 78 %, respectively). Swallowing and speech problems were present in 79 and 55 %, respectively. Normal food intake was noticed in 45, 35 % had a soft diet and 20 % tube feeding. Patients with soft diet and tube feeding reported more swallowing problems compared to patients with normal oral intake. Tumor subsite was significantly associated with swallowing outcome (less problems in larynx/hypopharynx compared to oral/oropharynx). Radiation technique was significantly associated with psychosocial speech problems (less problems in patients treated with IMRT). Swallowing and (to a lesser extent) speech problems in daily life are frequently present after chemoradiation therapy for head and neck cancer. Future prospective studies will give more insight into the course of speech and swallowing problems after chemoradiation and into efficacy of new radiation techniques and swallowing and speech rehabilitation programs.

  20. MRI-guided targeting delivery of doxorubicin with reduction-responsive lipid-polymer hybrid nanoparticles

    Wu B

    2017-09-01

    Full Text Available Bo Wu,1,2 Shu-Ting Lu,1 Kai Deng,2 Hui Yu,2 Can Cui,2 Yang Zhang,2 Ming Wu,2 Ren-Xi Zhuo,2 Hai-Bo Xu,1 Shi-Wen Huang2 1Department of Radiology, Zhongnan Hospital of Wuhan University, 2Key Laboratory of Biomedical Polymers, Ministry of Education, Department of Chemistry, Wuhan University, Wuhan, People’s Republic of China Abstract: In recent years, there has been increasing interest in developing a multifunctional nanoscale platform for cancer monitoring and chemotherapy. However, there is still a big challenge for current clinic contrast agents to improve their poor tumor selectivity and response. Herein, we report a new kind of Gd complex and folate-coated redox-sensitive lipid-polymer hybrid nanoparticle (Gd-FLPNP for tumor-targeted magnetic resonance imaging and therapy. Gd-FLPNPs can simultaneously accomplish diagnostic imaging, and specific targeting and controlled release of doxorubicin (DOX. They exhibit good monodispersity, excellent size stability, and a well-defined core-shell structure. Paramagnetic nanoparticles based on gadolinium-diethylenetriaminepentaacetic acid-bis-cetylamine have paramagnetic properties with an approximately two-fold enhancement in the longitudinal relaxivity compared to clinical used Magnevist. For targeted and reduction-sensitive drug delivery, Gd-FLPNPs released DOX faster and enhanced cell uptake in vitro, and exhibited better antitumor effect both in vitro and in vivo. Keywords: redox-sensitive, tumor-targeted, gadolinium, contrast agents, PLGA

  1. Growth and characterization of Nd-doped disordered Ca3Gd2(BO3)4 crystal

    Pan, Z. B.; Zhang, H. J.; Yu, H. H.; Xu, M.; Zhang, Y. Y.; Sun, S. Q.; Wang, J. Y.; Wang, Q.; Wei, Z. Y.; Zhang, Z. G.

    2012-01-01

    A high-quality disordered Nd3+:Ca3Gd2(BO3)4 (Nd3+:CGB) laser crystal was grown by the Czochralski method. The space group and effective segregation coefficient of Nd3+ were determined to be Pnma and 1.06, respectively. The thermal properties, including the average linear thermal expansion coefficient, thermal diffusivity, specific heat, and thermal conductivity were systematically measured for the first time. It was found that the thermal conductivity increases with increasing temperature, indicating glasslike behavior. The polarized spectral properties of the crystal were investigated, including the polarized absorption spectra, polarized fluorescence spectra, and fluorescence decay. The spectroscopic parameters of Nd3+ ions in Nd3+:CGB crystal have been obtained based on Judd-Ofelt theory. The anisotropy of the spectral properties for different polarized directions was discussed. Additionally, the continuous-wave (CW) laser performance at 1.06 μm was demonstrated for the first time. The maximum output power of 603 mW was achieved with corresponding optical conversion efficiency of 8.33% and slope efficiency of 9.95%.

  2. A potential green emitting citrate gel synthesized NaSrBO3:Tb3+ phosphor for display application

    Bedyal, A. K.; Kumar, Vinay; Swart, H. C.

    2018-04-01

    A potential green emitting NaSrBO3:Tb3+ (1-9 mol%) phosphor was synthesized by a citrate gel combustion method. X-ray diffraction patterns confirmed the monoclinic phase of the phosphor. The phosphor emitted intense green emission under near-UV and electron excitation due to the characteristic transitions 5D4→7F6(488 nm),5D4→7F5(544 nm),5D4→7F4(586 nm) and 5D4→7F3(622 nm) of Tb3+ ions. The optimal molar concentration of Tb3+ ions was found to be 6 mol%, after that concentration quenching occurred. The dipole-dipole interaction was found to be accountable for energy transfer between the Tb3+ ions. X-ray photoelectron spectroscopy was carried out to analyze the chemical states of the elements and suggest that terbium was mostly presented in the (+3) valance state in the phosphor. The approximated Commission Internationale de l‧Eclairage coordinates for the PL (0.31, 0.61) and CL (0.33, 0.57) were found to be very close to the well-known green emitting phosphor. The obtained results suggest that the studied phosphor could be an ultimate choice for green emission in display applications.

  3. A new promising phosphor, Na3La2(BO3)3:Ln (Ln=Eu, Tb)

    Li Zhihua; Zeng Jinghui; Zhang Guochun; Li Yadong

    2005-01-01

    We present an efficient way to search a host for ultraviolet (UV) phosphor from UV nonlinear optical (NLO) materials. With the guidance, Na 3 La 2 (BO 3 ) 3 (NLBO), as a promising NLO material with a broad transparency range and high damage threshold, was adopted as a host material for the first time. The lanthanide ions (Tb 3+ and Eu 3+ )-doped NLBO phosphors have been synthesized by solid-state reaction. Luminescent properties of the Ln-doped (Ln=Tb 3+ , Eu 3+ ) sodium lanthanum borate were investigated under UV ray excitation. The emission spectrum was employed to probe the local environments of Eu 3+ ions in NLBO crystal. For red phosphor, NLBO:Eu, the measured dominating emission peak was at 613 nm, which is attributed to 5 D - 7 F 2 transition of Eu 3+ . The luminescence indicates that the local symmetry of Eu 3+ in NLBO crystal lattice has no inversion center. Optimum Eu 3+ concentration of NLBO:Eu 3+ under UV excitation with 395 nm wavelength is about 30 mol%. The green phosphor, NLBO:Tb, showed bright green emission at 543 with 252 nm excited light. The measured concentration quenching curve demonstrated that the maximum concentration of Tb 3+ in NLBO was about 20%. The luminescence mechanism of Ln-doped NLBO (Tb 3+ and Eu 3+ ) was analyzed. The relative high quenching concentration was also discussed

  4. Scintillation and optical properties of Pb-doped YCa{sub 4}O(BO{sub 3}){sub 3} crystals

    Fujimoto, Yutaka, E-mail: fuji-you@tagen.tohoku.ac.jp [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); JSPS, 8 Ichibanmachi, Chiyoda-ku, Tokyo 102-8472 (Japan); Yanagida, Takayuki; Yokota, Yuui [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Kawaguchi, Noriaki [Tokuyama Corporation, 3 Shibuya Shibuya-ku, Tokyo 150-8383 (Japan); Fukuda, Kentaro [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Tokuyama Corporation, 3 Shibuya Shibuya-ku, Tokyo 150-8383 (Japan); Totsuka, Daisuke [Nihon Kessho Kogaku Co., Ltd., 810-5 Nobe-cho Tatebayashi Gunma (Japan); Watanabe, Kenichi; Yamazaki, Atsushi [Nagoya University, Furo-cho, Chikusa-ku, Nagoya 464-8603 (Japan); Chani, Valery [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); Yoshikawa, Akira [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai 980-8577 (Japan); NICHe, Tohoku University, 6-6-10 Aoba, Aramaki, Aoba-ku, Sendai 980-8579 (Japan)

    2011-10-01

    This communication reports optical properties and radiation responses of Pb{sup 2+} 0.5 and 1.0 mol%-doped YCa{sub 4}O(BO{sub 3}){sub 3} (YCOB) single crystals grown by the micro-pulling-down ({mu}-PD) method for neutron scintillator applications. The crystals had no impurity phases according to the results of X-ray powder diffraction. These Pb{sup 2+}-doped crystals demonstrated blue-light luminescence at 330 nm because of Pb{sup 2+1}S{sub 0}-{sup 3}P{sub 0,1} transition in the photoluminescence spectra. The main emission decay component was determined to be about 250-260 ns under 260 nm excitation wavelength. When irradiated by a {sup 252}Cf source, the relative light yield of 0.5% Pb{sup 2+}-doped crystal was about 300 ph/n that was determined using the light yield of a reference Li-glass scintillator.

  5. Scintillation properties of Ce-doped LuLiF{sub 4} and LuScBO{sub 3}

    Yanagida, Takayuki, E-mail: t_yanagi@tagen.tohoku.ac.jp [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Fujimoto, Yutaka [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Kawaguchi, Noriaki [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Tokuyama Corporation, Shibuya 3-chome, Shibuya-ku, Tokyo 150-8383 (Japan); Yokota, Yuui [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan); Kamada, Kei [Materials Research Laboratory, Furukawa, Co. Ltd., 1-25-13 Kannondai, Tsukuba, Ibaragi 305-0856 (Japan); Totsuka, Daisuke [Nihon Kessho Kogaku Co., Ltd., 810-5 Nobe-cho, Tatebayashi, Gunma 374-0047 (Japan); Hatamoto, Shun-Ichi [Corporate Research and Development Center, Mitsui Mining and Smelting Co., Ltd., 1333-2 Haraichi, Ageo Saitama 362-0023 (Japan); Yoshikawa, Akira; Chani, Valery [IMRAM, Tohoku University, 2-1-1 Katahira, Aoba-ku, Sendai, Miyagi 980-8577 (Japan)

    2011-10-01

    The crystals of 1 mol% Ce-doped LuLiF{sub 4} (Ce:LLF) grown by the micro-pulling down ({mu}-PD) method and 1 mol% Ce-doped LuScBO{sub 3} (Ce:LSBO) grown by the conventional Czochralski (Cz) method were examined for their scintillation properties. Ce:LLF and Ce:LSBO demonstrated {approx}80% transparency at wavelengths longer than 300 and 400 nm, respectively. When excited by {sup 241}Am {alpha}-ray to obtain radioactive luminescence spectra, Ce{sup 3+} 5d-4f emission peaks were detected at around 320 nm for Ce:LLF and at around 380 nm for Ce:LSBO. In Ce:LSBO, the host luminescence was also observed at 260 nm. By recording pulse height spectra under {gamma}-ray irradiation, the absolute light yield of Ce:LLF and Ce:LSBO was measured to be 3600{+-}400 and 4200{+-}400 ph/MeV, respectively. Decay time kinetics was also investigated using a pulse X-ray equipped streak camera system. The main component of Ce:LLF was {approx}320 ns and that of Ce:LSBO was {approx}31 ns. In addition, the light yield non-proportionality and energy resolution against the {gamma}-ray energy were evaluated.

  6. Growth, thermal properties and laser operation of a novel disordered Yb:Ca3La2(BO3)4 laser crystal

    Pan, Zhongben; Cai, Huaqiang; Huang, Hui; Yu, Haohai; Zhang, Huaijin; Wang, Jiyang

    2014-10-01

    A high quality disordered Yb:Ca3La2(BO3)4 laser crystal has been successfully grown by the Czochralski method. The complete set of anisotropic thermal properties were systematically measured for the first time. In addition, continuous-wave laser along the three crystallographic axis were obtained. Passively Q-switched by a Cr4+:YAG saturable absorber, the laser yielded an average output power of 0.47 W with a slope efficiency of 7.6% for the first time. The generated pulse energy, duration, and peak power were 94 μJ, 33 ns, and 2.85 KW, respectively. We believe that the reliability and stability of these lasers makes the disordered Yb:Ca3La2(BO3)4 crystal of considerable interest for future applications.

  7. Evolution of the mössbauer spectra of ludwigite Co3 - x Fe x O2BO3 with substitution of iron for cobalt

    Knyazev, Yu. V.; Ivanova, N. B.; Bayukov, O. A.; Kazak, N. V.; Bezmaternykh, L. N.; Vasiliev, A. D.

    2013-06-01

    A concentration series of single crystals of iron-cobalt ludwigites Co3 - x Fe x O2BO3 ( x = 0.0125, 0.025, 0.050, 0.10, 1.0) has been synthesized. The structure has been studied using X-ray diffraction and Mössbauer effect. A preferred occupation of nonequivalent crystallographic positions by iron in the ludwigite structure has been revealed. It has been found that the valence of substituting iron ions is three. It has been revealed that the structure of the γ-resonance spectrum of Co2FeO2BO3 is complicated due to a composition disorder in the system.

  8. Design and deployment of autoclave pressure vessels for the portable deep-sea drill rig MeBo (Meeresboden-Bohrgerät)

    Pape, Thomas; Hohnberg, Hans-Jürgen; Wunsch, David; Anders, Erik; Freudenthal, Tim; Huhn, Katrin; Bohrmann, Gerhard

    2017-11-01

    Pressure barrels for sampling and preservation of submarine sediments under in situ pressure with the robotic sea-floor drill rig MeBo (Meeresboden-Bohrgerät) housed at the MARUM (Bremen, Germany) were developed. Deployments of the so-called MDP (MeBo pressure vessel) during two offshore expeditions off New Zealand and off Spitsbergen, Norway, resulted in the recovery of sediment cores with pressure stages equaling in situ hydrostatic pressure. While initially designed for the quantification of gas and gas-hydrate contents in submarine sediments, the MDP also allows for analysis of the sediments under in situ pressure with methods typically applied by researchers from other scientific fields (geotechnics, sedimentology, microbiology, etc.). Here we report on the design and operational procedure of the MDP and demonstrate full functionality by presenting the first results from pressure-core degassing and molecular gas analysis.

  9. Synthesis and PL study of UV emitting phosphor KCa{sub 4}(BO{sub 3}){sub 3}:Pb{sup 2+}

    Gawande, A.B., E-mail: gawandeab@gmail.com [Department of Physics, SGB Amravati University, Amravati, Maharashtra (India); Sonekar, R.P., E-mail: sonekar_rp@yahoo.com [Department of Physics, G.S. College, Khamgaon, Buldhana District, Maharashtra (India); Omanwar, S.K. [Department of Physics, SGB Amravati University, Amravati, Maharashtra (India)

    2014-05-01

    Pb{sup 2+} doped KCa{sub 4}(BO{sub 3}){sub 3} materials were prepared by a novel solution combustion synthesis technique which is slight variation of combustion synthesis method. The synthesized materials were characterized by powder XRD and FT-IR. Scanning Electron Microscopy (SEM) observation indicated that the microstructure of the phosphor consisted of irregular grains which get finer and shaped in doped sample as compared to pure. The photoluminescence properties of synthesized materials were investigated using Spectrofluorometer at room temperature. The emission and excitation bands of the synthesized phosphors were observed at 335 nm and 260 nm respectively. The concentration of Pb{sup 2+} for which optimum emission is obtained was found to be 0.005 mol. The critical transfer distance (R{sub 0}) for optimum concentration was determined to be 16.88 Å. The Stokes shift of KCa{sub 4}(BO{sub 3}){sub 3}:Pb{sup 2+} was measured to be 8756 cm{sup −1}. The phosphor could find application in medical and lamp industry. - Highlights: • Inorganic borate phosphor KCa{sub 4}(BO{sub 3}){sub 3}:Pb{sup 2+} has been synthesized by solution combustion synthesis technique. • Structure confirmation of synthesized phosphor done by using powder XRD and FT-IR. • Doping effect on the surface morphology of synthesized material is shown by SEM images. • Stokes shift, optimum concentration and critical transfer distance for optimum concentration in KCa{sub 4}(BO{sub 3}){sub 3}:Pb{sup 2+} have been determined.

  10. Host composition dependent tunable multicolor emission in the single-phase Ba2(Ln(1-z)Tb(z))(BO3)2Cl:Eu phosphors.

    Xia, Zhiguo; Zhuang, Jiaqing; Meijerink, Andries; Jing, Xiping

    2013-05-14

    A new strategy based on the host composition design has been adopted to obtain efficient color-tunable emission from Ba2Ln(0.97-z)Tb(z)(BO3)2Cl:0.03Eu (Ln = Y, Gd and Lu, z = 0-0.97) phosphors. This study reveals that the single-phase Ba2Ln(1-z)Tb(z)(BO3)2Cl compounds can be applied to use allowed Eu(2+) absorption transitions to sensitize Eu(3+) emission via the energy transfer Eu(2+) → (Tb(3+))n → Eu(3+). The powder X-ray diffraction (XRD) and Rietveld refinement analysis shows single-phase Ba2Ln(1-z)Tb(z)(BO3)2Cl. As-prepared Ba2Ln(0.97-z)Tb(z)(BO3)2Cl:0.03Eu phosphors show intense green, yellow, orange and red emission under 377 nm near ultraviolet (n-UV) excitation due to a variation in the relative intensities of the Eu(2+), Tb(3+) and Eu(3+) emission depending on the Tb content (z) in the host composition, allowing color tuning. The variation in emission color is explained by energy transfer and has been investigated by photoluminescence and lifetime measurements and is further characterized by the Commission Internationale de l'éclairage (CIE) chromaticity indexes. The quantum efficiencies of the phosphors are high, up to 74%, and show good thermal stabilities up to 150 °C. This investigation demonstrates the possibility to sensitize Eu(3+) line emission by Eu(2+)via energy migration over Tb(3+) resulting in efficient color tunable phosphors which are promising for use in solid-state white light-emitting diodes (w-LEDs).

  11. The NeBoP score - a clinical prediction test for evaluation of children with Lyme Neuroborreliosis in Europe.

    Skogman, Barbro H; Sjöwall, Johanna; Lindgren, Per-Eric

    2015-12-17

    The diagnosis of Lyme neuroborreliosis (LNB) in Europe is based on clinical symptoms and laboratory data, such as pleocytosis and anti-Borrelia antibodies in serum and CSF according to guidelines. However, the decision to start antibiotic treatment on admission cannot be based on Borrelia serology since results are not available at the time of lumbar puncture. Therefore, an early prediction test would be useful in clinical practice. The aim of the study was to develop and evaluate a clinical prediction test for children with LNB in a relevant European setting. Clinical and laboratory data were collected retrospectively from a cohort of children being evaluated for LNB in Southeast Sweden. A clinical neuroborreliosis prediction test, the NeBoP score, was designed to differentiate between a high and a low risk of having LNB. The NeBoP score was then prospectively validated in a cohort of children being evaluated for LNB in Central and Southeast Sweden (n = 190) and controls with other specific diagnoses (n = 49). The sensitivity of the NeBoP score was 90 % (CI 95 %; 82-99 %) and the specificity was 90 % (CI 95 %; 85-96 %). Thus, the diagnostic accuracy (i.e. how the test correctly discriminates patients from controls) was 90 % and the area under the curve in a ROC analysis was 0.95. The positive predictive value (PPV) was 0.83 (CI 95 %; 0.75-0.93) and the negative predictive value (NPV) was 0.95 (CI 95 %; 0.90-0.99). The overall diagnostic performance of the NeBoP score is high (90 %) and the test is suggested to be useful for decision-making about early antibiotic treatment in children being evaluated for LNB in European Lyme endemic areas.

  12. Disorder- and correlation-induced charge carriers localization in oxyborate MgFeBO{sub 4}, Mg{sub 0.5}Co{sub 0.5}FeBO{sub 4}, CoFeBO{sub 4} single crystals

    Knyazev, Yu.V. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Kazak, N.V., E-mail: nat@iph.krasn.ru [Kirensky Institute of Physics, 660036 Krasnoyarsk (Russian Federation); Platunov, M.S. [Kirensky Institute of Physics, 660036 Krasnoyarsk (Russian Federation); Ivanova, N.B. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Bezmaternykh, L.N. [Kirensky Institute of Physics, 660036 Krasnoyarsk (Russian Federation); Arauzo, A. [Servicio de Medidas Físicas, Universidad de Zaragoza, 50009 Zaragoza (Spain); Bartolomé, J. [Instituto de Ciencia de Materiales de Aragón, CSIC-Universidad de Zaragoza and Departamento de Física de la Materia Condensada, 50009 Zaragoza (Spain); Ovchinnikov, S.G. [Siberian Federal University, 660074 Krasnoyarsk (Russian Federation); Kirensky Institute of Physics, 660036 Krasnoyarsk (Russian Federation); Siberian State Aerospace University, 660014 Krasnoyarsk (Russian Federation)

    2015-09-05

    Highlights: • The electrical resistance of the single crystalline warwickites has been measured. • The temperature-induced changes in the charge transfer mechanisms have been found. • The microscopic parameters of the electronic structure have been determined. • The studied warwickites have been classified as disordered correlated systems. • The Co substitution was found to lead to the weakening of the localization. - Abstract: The temperature dependence of the resistivity of single crystalline Mg{sub 1−x}Co{sub x}FeBO{sub 4} samples with x = 0.0, 0.5, 1.0 is investigated for the temperature range (210–400 K). The conduction was found to be governed by Mott variable-range hopping (VRH) in the low-temperature range (T = 210–270 K) and by thermo-activation mechanism in the high-temperature range (T = 280–400 K). Microscopic electronic parameters, such as the density of the localized states near the Fermi level, localization length, the hopping length, and the activation energy have been obtained. The change of the activation energy observed at high-temperature range was attributed to local structure distortions around Fe and Co atoms. The complicated behavior of charge transfer mechanisms is discussed based on two approaches: atomic disorder and electron correlations.

  13. Prediction of transits of Solar system objects in Kepler/K2 images: an extension of the Virtual Observatory service SkyBoT

    Berthier, J.; Carry, B.; Vachier, F.; Eggl, S.; Santerne, A.

    2016-05-01

    All the fields of the extended space mission Kepler/K2 are located within the ecliptic. Many Solar system objects thus cross the K2 stellar masks on a regular basis. We aim at providing to the entire community a simple tool to search and identify Solar system objects serendipitously observed by Kepler. The sky body tracker (SkyBoT) service hosted at Institut de mécanique céleste et de calcul des éphémérides provides a Virtual Observatory compliant cone search that lists all Solar system objects present within a field of view at a given epoch. To generate such a list in a timely manner, ephemerides are pre-computed, updated weekly, and stored in a relational data base to ensure a fast access. The SkyBoT web service can now be used with Kepler. Solar system objects within a small (few arcminutes) field of view are identified and listed in less than 10 s. Generating object data for the entire K2 field of view (14°) takes about a minute. This extension of the SkyBoT service opens new possibilities with respect to mining K2 data for Solar system science, as well as removing Solar system objects from stellar photometric time series.

  14. 石氏针药结合治疗急性踝关节扭伤早期疗效研究%Clinical Observation on the Treatment of Acute Ankle Sprain by Shi's Acupuncture Therapy Combined with Compound Zijing Plaster

    李涛; 郭海玲; 杨光月; 商海滨; 赵咏芳

    2017-01-01

    目的:研究石氏针刺结合复方紫荆消伤膏外用治疗急性踝关节扭伤早期症状改善特点,评价石氏针刺结合外用膏药治疗急性踝关节扭伤、弹力绷带固定治疗和功能锻炼治疗的优效性.方法:对上海市浦东新区6家医院2014年1月至2016年10月收治的300例急性踝关节扭伤患者随机分为针药结合治疗组、弹力绷带固定组和功能锻炼组,三组受试者分别予石氏针刺结合膏药外用治疗,弹力绷带固定结合膏药治疗和功能锻炼处方结合膏药治疗.在入组时(入组)、第7天(第1周、访视一)、第28天(第4周、访视二)和第42天(第6周、访视三)采用美国足踝外科学会AOFAS踝后足评分量表、VAS疼痛评分进行优效性评价.结果:三种治疗方法对急性踝关节扭伤均有疗效(P<0.05).在第7天,针药结合组AOFAS评分与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组AOFAS评分高于绷带固定组和功能锻炼组评分.在第7天、第28天针药结合组VAS疼痛评分变化与绷带固定组和功能锻炼组差异有统计学意义(P<0.05),针药结合组VAS疼痛评分改善大于弹力绷带固定组和功能锻炼组.针药结合组AOFAS疗效评定痊愈率和VAS疼痛疗效评定痊愈率高于绷带固定组和功能锻炼组(P<0.05).结论:石氏针药结合治疗急性踝关节扭伤临床疗效明确,对损伤早期的疼痛改善和功能恢复疗效优于弹力绷带固定治疗和功能锻炼治疗.%Objective:To study the improvement characteristics of early symptoms of acute ankle sprain treated with the Shi's acupuncture therapy combined with compound Zijing plaster,and to evaluate the superiority of the Shi's therapy combined with topical plaster,elastic bandage fixation and functional exercise therapy in the treatment of acute ankle sprain.Methods:All 300 cases of acute ankle sprain patients were randomly assigned to groups of Shi's therapy

  15. Filme kaladest : "Maelströmi" külm langemine, "Bo Ba Bu" kiviaegne röhkimine ja vanameister Imamura "Soe vesi punase silla all" / Erkki Luuk

    Luuk, Erkki, 1971-

    2001-01-01

    Temaatiliselt koos vaadeldakse kolme erineva kultuuritaustaga režissööri filme : kanadalase Denis Villeneuve "Maelström", usbeki Ali Hamrajevi "Bo Ba Bu" ja jaapanlase Shohei Imamura "Soe vesi punase silla all"

  16. FULIR Full-text Institutional Repository of the Ruđer Bošković Institute

    Macan, B.

    2014-11-01

    Full Text Available Institutional repositories are online platforms for gathering, archiving, dissemination and long-term preservation of an institution’s scientific output. Archiving full-text papers into the institutional and other open access repositories (OAR is one way of achieving open access to scientific informa tion, the so-called “green” OA. In 2006 the idea of implementing an institutional repository at the Ruđer Bošković Institute Library was initiated and one year later, the project had started, parallel with the subproject of digitizing RBI’s documentary materials. 4 Various open source solutions were tested, among which EPrints software was chosen as the most suitable to RBI’s needs. The first documents were archived in March 2011, and on October 18, 2012, the official version of the repository was published under the name Full-text Institutional Repository of the Ruđer Bošković Institute – FULIR. The goal of FULIR is to gather, archive, disseminate and preserve, for the long term, the whole scientific production and documentary materials of the Institute in digital form, as well as provide open access to archived materials where possible. It is possible to archive all kinds of materials in FULIR, such as articles published in journals, conference proceedings, books, book chapters, dissertations, but also various kinds of unpublished materials such as posters and presentations from conferences or lectures, reports, audio and video records and datasets. FULIR is based on the principle that the scientists themselves archive their materials, but in this initial phase, the librarians are also assisting the scientists in archiving new items. The repository allows different access rights to archived materials and a depositor may define to whom (all users/only registered users (RBI staff/only repository administrators, and when (immediately or after a cer tain embargo period full-texts of archived materials will be available. Repository

  17. Luminescent properties and energy transfer studies of color-tunable LuBO{sub 3}: Ce{sup 3+}/Tb{sup 3+}/Eu{sup 3+} phosphors

    Zhang, Xinguo, E-mail: sysuzxg@gmail.com [School of Pharmaceutical Sciences, Southern Medical University, Guangzhou 510515 (China); School of Chemistry and Chemical Engineering, Guangxi University, Nanning 530004 (China); Fu, Xionghui [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Song, Jiahui [Shenzhou High School, Hengshui 053800 (China); Gong, Menglian [School of Chemistry and Chemical Engineering, Sun Yat-Sen University, Guangzhou 510275 (China)

    2016-08-15

    Highlights: • A series of color-tunable LuBO{sub 3}: Ce{sup 3+}/Tb{sup 3+}/Eu{sup 3+} phosphors were synthesized. • Phosphors exhibit strong blue/green/red emission under UV excitation. • The reason of high Tb{sup 3+} content required for Ce{sup 3+} → Tb{sup 3+} → Eu{sup 3+} energy transfer is unveiled. • Green and red LED prototypes were fabricated and characterized. - Abstract: A series of LuBO{sub 3}: Ce{sup 3+}/Tb{sup 3+}/Eu{sup 3+} phosphors were synthesized via solid state reaction. The Ce{sup 3+}/Tb{sup 3+} co-doped and Ce{sup 3+}/Tb{sup 3+}/Eu{sup 3+} tri-doped phosphors absorb near UV light through 4f-5d transitions of Ce{sup 3+}, followed by sensitized Tb{sup 3+} green and Eu{sup 3+} red emission. Decay curves investigations for samples with various Tb{sup 3+} and Eu{sup 3+} contents reveal the occurrence of Ce{sup 3+} → Tb{sup 3+} → Eu{sup 3+} energy transfer. It is found that due to relative low Tb{sup 3+} → Eu{sup 3+} energy transfer rate, a high Tb{sup 3+} content (>40%) is required for efficient Ce{sup 3+} → Tb{sup 3+} → Eu{sup 3+} energy transfer. Emission color of LuBO{sub 3}: Ce{sup 3+}, Tb{sup 3+}, Eu{sup 3+} varies from blue through green to red with Ce{sup 3+}/Tb{sup 3+}/Eu{sup 3+} ratio. The quantum efficiency of LuBO{sub 3}: Ce{sup 3+}, Tb{sup 3+} green phosphor and LuBO{sub 3}: Ce{sup 3+}, Tb{sup 3+}, Eu{sup 3+} red phosphor is 50% and 30%, respectively. Green and red LED prototypes were fabricated. The results show that the obtained phosphors are potential candidates as down-converted phosphors for NUV LEDs.

  18. Modelling soil dust aerosol in the Bodélé depression during the BoDEx campaign

    Tegen, I.; Heinold, B.; Todd, M.; Helmert, J.; Washington, R.; Dubovik, O.

    2006-09-01

    We present regional model simulations of the dust emission events during the Bodélé Dust Experiment (BoDEx) that was carried out in February and March 2005 in Chad. A box model version of the dust emission model is used to test different input parameters for the emission model, and to compare the dust emissions computed with observed wind speeds to those calculated with wind speeds from the regional model simulation. While field observations indicate that dust production occurs via self-abrasion of saltating diatomite flakes in the Bodélé, the emission model based on the assumption of dust production by saltation and using observed surface wind speeds as input parameters reproduces observed dust optical thicknesses well. Although the peak wind speeds in the regional model underestimate the highest wind speeds occurring on 10-12 March 2005, the spatio-temporal evolution of the dust cloud can be reasonably well reproduced by this model. Dust aerosol interacts with solar and thermal radiation in the regional model; it is responsible for a decrease in maximum daytime temperatures by about 5 K at the beginning the dust storm on 10 March 2005. This direct radiative effect of dust aerosol accounts for about half of the measured temperature decrease compared to conditions on 8 March. Results from a global dust model suggest that the dust from the Bodélé is an important contributor to dust crossing the African Savannah region towards the Gulf of Guinea and the equatorial Atlantic, where it can contribute up to 40% to the dust optical thickness.

  19. Modelling soil dust aerosol in the Bodélé depression during the BoDEx campaign

    I. Tegen

    2006-01-01

    Full Text Available We present regional model simulations of the dust emission events during the Bodélé Dust Experiment (BoDEx that was carried out in February and March 2005 in Chad. A box model version of the dust emission model is used to test different input parameters for the emission model, and to compare the dust emissions computed with observed wind speeds to those calculated with wind speeds from the regional model simulation. While field observations indicate that dust production occurs via self-abrasion of saltating diatomite flakes in the Bodélé, the emission model based on the assumption of dust production by saltation and using observed surface wind speeds as input parameters reproduces observed dust optical thicknesses well. Although the peak wind speeds in the regional model underestimate the highest wind speeds occurring on 10–12 March 2005, the spatio-temporal evolution of the dust cloud can be reasonably well reproduced by this model. Dust aerosol interacts with solar and thermal radiation in the regional model; it is responsible for a decrease in maximum daytime temperatures by about 5 K at the beginning the dust storm on 10 March 2005. This direct radiative effect of dust aerosol accounts for about half of the measured temperature decrease compared to conditions on 8 March. Results from a global dust model suggest that the dust from the Bodélé is an important contributor to dust crossing the African Savannah region towards the Gulf of Guinea and the equatorial Atlantic, where it can contribute up to 40% to the dust optical thickness.

  20. Combustion synthesis and optical properties of Oxy-borate phosphors YCa4O(BO3)3:RE3+ (RE = Eu3+, Tb3+) under UV, VUV excitation

    Ingle, J.T.; Gawande, A.B.; Sonekar, R.P.; Omanwar, S.K.; Wang, Yuhua; Zhao, Lei

    2014-01-01

    Graphical abstract: VUV Photoluminescence of YCa 4 O(BO 3 ) 3 : Eu 3+ and YCa 4 O(BO 3 ) 3 : Tb 3+ for PDPs applications. Highlights: • Inorganic Oxy-borate phosphors YCa 4 O(BO 3 ) 3 :Eu 3+ ,Tb 3+ was synthesized by novel solution combustion synthesis. • This single host produces efficient and intense Red and Green color for display applications. • Good agreement with CIE co-ordinates as prescribes by NTCL, for flat panel, PDP display color. • Synthesized materials were characterized using powder XRD, FE-SEM, UV and VUV Spectophotometer. -- Abstract: The inorganic Oxy-borate host phosphors YCa 4 O(BO 3 ) 3 :RE 3+ (RE = Eu 3+ ,Tb 3+ ) were synthesized by a novel solution combustion technique. The synthesis is based on the exothermic reaction between the fuel (Urea) and Oxidizer (Ammonium nitrate). The heat generated in reaction is use for auto combustion of precursors. The structures of the prepared samples were confirmed by powder XRD technique. The photoluminescence properties of the powder samples were investigated under UV and VUV excitation; “The phosphor YCa 4 O(BO 3 ) 3 :Eu 3+ and YCa 4 O(BO 3 ) 3 :Tb 3+ shows strong absorption in UV and VUV region and exhibits intense red and green emission upon excited by 254 nm UV and 147 nm VUV radiation”

  1. Simultaneous determination of bioactive components in essential oil of Xiang-Fu-Si-Wu Formula in Beagle dog plasma by UPLC-MS/MS and its application to pharmacokinetics.

    Liu, Pei; Li, Zhenhao; Qian, Dawei; Li, Wei; Shang, Er-Xin; Duan, Jin-Ao

    2013-06-15

    A highly sensitive and rapid ultraperformance liquid chromatography-tandem mass spectrometry (UPLC-MS/MS) has been developed and validated for simultaneous quantification of the three main bioactive compounds, i.e., ligustilide, dehydrocostuslactone and α-cyperone in dog plasma after oral administration of the essential oil of Xiang-Fu-Si-Wu Formula (XEO). Clarithromycin was used as an internal standard (IS). Plasma samples were processed by protein precipitation with methanol. The separation was performed on an Acquity BEH C18 column (100mm×2.1mm, 1.7μm) at a flow rate of 0.4mLmin(-1), using 0.1% formic acid-acetonitrile as mobile phase. The MS/MS ion transit ions monitored were 190.5→90.9 for ligustilide, 231.1→185.1 for dehydrocostuslactone, 219.2→123.0 for α-cyperone and 748.5→158.1 for IS. Method validation was performed as per Food and Drug Administration guidelines and the results met the acceptance criteria. The lower limit of quantification (LLOQ) achieved was 5.12ng/mL for ligustilide, 1.06ng/mL for dehydrocostuslactone and 1.89ng/mL for α-cyperone, respectively, and the calibration curves obtained were linear (r>0.99) over the concentration range approximately 1-1000ng/mL. The intra- and inter-day precision was less than 15% and the accuracy was within ±9.2%. After validation, this method was successfully applied to a pharmacokinetic study where dogs were orally given 0.3g/kg XEO, equivalent to 183.6mg/kg of ligustilide, 5.0mg/kg of dehydrocostuslactone and 26.2mg/kg of α-cyperone, respectively. Copyright © 2013 Elsevier B.V. All rights reserved.

  2. An amino acid sequence coded by the exon 2 of the BoLA DRB3 gene associated with a BoLA class I specificity constitutes a likely genetic marker of resistance to dermatophilosis in Brahman zebu cattle of Martinique (FWI).

    Maillard, J C; Martinez, D; Bensaid, A

    1996-07-23

    One hundred and twenty-seven Brahman cattle from several locations in Martinique (FWI), reared under different environmental conditions, were followed over three years and checked for clinical signs of dermatophilosis. To confirm that these animals had been in contact with the pathogen Dermatophilus congolensis, their sera were tested by ELISA. On the basis of this epidemiological study, 12 animals were classified as resistant (seropositive without clinical signs), belonging to herds in which the prevalence of the disease ranged from 25 to nearly 98%. Eighteen animals classified as highly susceptible displayed severe characteristic skin lesions. These 30 selected animals were typed for class I antigens of the major histocompatibility complex (MHC). MHC class II genes were analyzed using the polymerase chain reaction (PCR) and restriction fragment length polymorphism (RFLP) techniques, on the exon 2 of the bovine leucocyte antigen (BoLA) DRB3 gene. Several alleles were found, according to patterns provided by the restriction enzymes used: Fnu 4HI, Dpn II, Hae III, and Rsa I. A particular sequence "EIAY" at amino acid positions 66/67/74/78 located in the antigen recognition sites (ARS) was found in the 12 animals classified as resistant, and 10 of them displayed also class I BoLA-A8 specificity. On the other hand, only 3 out of the 18 susceptible animals showed simultaneously the BoLA-DRB3 "EIAY" sequence and BoLA-A8 specificity. Interestingly, a serine residue at position 30 of the ARS was found in 8 of the susceptible animals and was completely absent from all resistant animals. Furthermore, in a same animal, the serine at position 30 and the EIAY sequence were never found simultaneously on the same haplotype. These results show a strong correlation between the resistant character to dermatophilosis and the association of MHC haplotypes: the BoLA-A8 specificity and the BoLA-DRB3 "EIAY" sequence at ARS positions 66/67/74/78 with the lack of serine in position 30. To

  3. Assessing interactions of binary mixtures of Penicillium mycotoxins (PMs) by using a bovine macrophage cell line (BoMacs)

    Oh, Se-Young, E-mail: ohs@uoguelph.ca [Department of Animal Biosciences, Ontario Agriculture College (OAC), University of Guelph, Guelph, ON N1G 2W1 (Canada); Cedergreen, Nina [Department of Life Sciences, University of Copenhagen, Frederiksberg (Denmark); Yiannikouris, Alexandros [Alltech Inc., Nicholasville, KY (United States); Swamy, H.V.L.N. [Trouw Nutrition Pvt. Ltd. India, Karnataka State 560065 (India); Karrow, Niel A., E-mail: nkarrow@uoguelph.ca [Department of Animal Biosciences, Ontario Agriculture College (OAC), University of Guelph, Guelph, ON N1G 2W1 (Canada)

    2017-03-01

    Penicillium mycotoxins (PMs) are toxic contaminants commonly found as mixtures in animal feed. Therefore, it is important to investigate potential joint toxicity of PM mixtures. In the present study, we assessed the joint effect of binary combinations of the following PMs: citrinin (CIT), ochratoxin A (OTA), patulin (PAT), mycophenolic acid (MPA) and penicillic acid (PA) using independent action (IA) and concentration addition (CA) concepts. Previously published toxicity data (i.e. IC25; PM concentration that inhibited bovine macrophage (BoMacs) proliferation by 25%) were initially analyzed, and both concepts agreed that OTA + PA demonstrated synergism (p < 0.05), while PAT + PA showed antagonism (p < 0.05). When a follow-up dilution study was carried out using binary combinations of PMs at three different dilution levels (i.e. IC25, 0.5 ∗ IC25, 0.25 ∗ IC25), only the mixture of CIT + OTA at 0.5 ∗ IC25 was determined to have synergism by both IA and CA concepts with Model Deviation Ratios (MDRs; the ratio of predicted versus observed effect concentrations) of 1.4 and 1.7, respectively. The joint effect of OTA + MPA, OTA + PA and CIT + PAT complied with the IA concept, while CIT + PA, PAT + MPA and PAT + PA were better predicted with the CA over the IA concept. The present study suggests to test both IA and CA concepts using multiple doses when assessing risk of mycotoxin mixtures if the mode of action is unknown. In addition, the study showed that the tested PMs could be predicted by IA or CA within an approximate two-fold certainty, raising the possibility for a joint risk assessment of mycotoxins in food and feed. - Highlights: • We investigated the potential joint toxicity of Penicillium mycotoxin (PM) mixtures. • Independent action (IA) and concentration addition (CA) concepts were used. • 7 out of 10 mixtures followed joint toxicity described by IA or CA concepts. • Both concepts agreed that CIT + OTA mixture had synergistic interaction.

  4. Mineral dust emission from the Bodélé Depression, northern Chad, during BoDEx 2005

    Todd, Martin C.; Washington, Richard; Martins, José Vanderlei; Dubovik, Oleg; Lizcano, Gil; M'bainayel, Samuel; Engelstaedter, Sebastian

    2007-03-01

    Mineral dust in the atmosphere is an important component of the climate system but is poorly quantified. The Bodélé Depression of northern Chad stands out as the world's greatest source region of mineral dust into the atmosphere. Frequent dust plumes are a distinguishing feature of the region's climate. There is a need for more detailed information on processes of dust emission/transport and dust optical properties to inform model simulations of this source. During the Bodélé Dust Experiment (BoDEx) in 2005, instrumentation was deployed to measure dust properties and boundary layer meteorology. Observations indicate that dust emission events are triggered when near-surface wind speeds exceed 10 ms-1, associated with synoptic-scale variability in the large-scale atmospheric circulation. Dust emission pulses in phase with the diurnal cycle of near-surface winds. Analysis of dust samples shows that the dust consists predominantly of fragments of diatomite sediment. The particle size distribution of this diatomite dust estimated from sun photometer data, using a modified Aeronet retrieval algorithm, indicates a dominant coarse mode (radius centered on 1-2 μm) similar to other Saharan dust observations. Single-scattering albedo values are high, broadly in line with other Saharan dust even though the diatomite composition of dust from the Bodélé is likely to be unusual. The radiative impact of high dust loadings results in a reduction in surface daytime maximum temperature of around 7°C in the Bodélé region. Using optical and physical properties of dust obtained in the field, we estimate the total dust flux emitted from the Bodélé to be 1.18 ± 0.45 Tg per day during a substantial dust event. We speculate that the Bodélé Depression (˜10,800 km2) may be responsible for between 6-18% of global dust emissions, although the uncertainty in both the Bodélé and global estimates remains high.

  5. Assessing interactions of binary mixtures of Penicillium mycotoxins (PMs) by using a bovine macrophage cell line (BoMacs)

    Oh, Se-Young; Cedergreen, Nina; Yiannikouris, Alexandros; Swamy, H.V.L.N.; Karrow, Niel A.

    2017-01-01

    Penicillium mycotoxins (PMs) are toxic contaminants commonly found as mixtures in animal feed. Therefore, it is important to investigate potential joint toxicity of PM mixtures. In the present study, we assessed the joint effect of binary combinations of the following PMs: citrinin (CIT), ochratoxin A (OTA), patulin (PAT), mycophenolic acid (MPA) and penicillic acid (PA) using independent action (IA) and concentration addition (CA) concepts. Previously published toxicity data (i.e. IC25; PM concentration that inhibited bovine macrophage (BoMacs) proliferation by 25%) were initially analyzed, and both concepts agreed that OTA + PA demonstrated synergism (p < 0.05), while PAT + PA showed antagonism (p < 0.05). When a follow-up dilution study was carried out using binary combinations of PMs at three different dilution levels (i.e. IC25, 0.5 ∗ IC25, 0.25 ∗ IC25), only the mixture of CIT + OTA at 0.5 ∗ IC25 was determined to have synergism by both IA and CA concepts with Model Deviation Ratios (MDRs; the ratio of predicted versus observed effect concentrations) of 1.4 and 1.7, respectively. The joint effect of OTA + MPA, OTA + PA and CIT + PAT complied with the IA concept, while CIT + PA, PAT + MPA and PAT + PA were better predicted with the CA over the IA concept. The present study suggests to test both IA and CA concepts using multiple doses when assessing risk of mycotoxin mixtures if the mode of action is unknown. In addition, the study showed that the tested PMs could be predicted by IA or CA within an approximate two-fold certainty, raising the possibility for a joint risk assessment of mycotoxins in food and feed. - Highlights: • We investigated the potential joint toxicity of Penicillium mycotoxin (PM) mixtures. • Independent action (IA) and concentration addition (CA) concepts were used. • 7 out of 10 mixtures followed joint toxicity described by IA or CA concepts. • Both concepts agreed that CIT + OTA mixture had synergistic interaction.

  6. Mini-CORK observatories using the MeBo seafloor drill rig - a new development for long-term data acquisition and sampling in shallow boreholes

    Kopf, A.; Freudenthal, T.; Ratmeyer, V.; Bergenthal, M.; Renken, J.; Zabel, M.; Wefer, G.

    2011-12-01

    State of the art technology for long-term monitoring of fluid migration within the sea floor is the sealing of a borehole with a Circulation Obviation Retrofit Kit (CORK) after sensor installation and/or fluid sampling devices within the drill string. However, the combined used of a drilling vessels and a remotely operated drilling (ROV) required for a CORK installation in the deep sea is a costly exercise that limits the number of monitoring stations installed. Robotic sea floor drill rigs are a cost effective alternative for shallow drillings down to 50-100 m below sea floor. Here we present a Mini-CORK system that is developed for installation with the sea floor drill rig MeBo. This rig was developed at MARUM Research Centre, University of Bremen in 2005 and can sample the sea floor in water depths up to 2000 m. The MeBo is deployed on the seabed and remotely controlled from the vessel. All required drill tools for wire-line core drilling down to 70 m below sea floor are stored on two rotating magazines and can be loaded below the top drive drill head for assembling the drill string. For one of the upcoming cruises with RV Sonne offshore Japan (Nankai Trough accretionary prism), MeBo will be used for the first time to place observatories. Two different designs have been developed. The first, relatively simple long-term device resembles a MeBo drill rod in its geometry, and contains a pressure and temperature transducer in the borehole plus an identical pair of transducers for seafloor reference. The device also contains a data logger, battery unit, and an acoustic modem so that data can be downloaded at any time from a ship of opportunity. The key element at the base of the observatory rod is a seal at the conical thread to separate the borehole hydraulically from the overlying water body. It is realized by an adapter, which also contains a hotstab hydraulic connection and an electrical connection. The second observatory device is a seafloor unit, which replaces

  7. Spectral properties and laser performances of Yb3+:LaCa4O(BO3)3 crystal with high concentration doping

    Ji, Yuexia; Cao, Jiafeng; Xu, Jinlong; You, Zhenyu; Zhu, Zhaojie; Li, Jianfu; Wang, Yan; Tu, Chaoyang

    2013-01-01

    Highlights: •Yb 3+ :LaCa 4 O(BO 3 ) 3 single crystal was grown with high concentration doping. •Laser potentiality was evaluated based on the spectral and laser parameters. •Continuous wave laser operation was realized. •An output power of 0.77 W and a slope efficiency of 15.71% at 1077 nm were obtained. •The spectra and laser properties of Yb 3+ :LaCa 4 O(BO 3 ) 3 crystal were firstly reported. -- Abstract: High concentration of 15 at.% Yb 3+ doped LaCa 4 O(BO 3 ) 3 (LaCOB) crystal was grown by Czochralski technique. The absorption cross section was conclulated to be 0.63 × 10 −20 cm 2 at 977 nm and the emission cross section to be 0.39 × 10 −20 cm 2 at 1030 nm, with the FWHM of 6.15 and 33 nm respectively. Laser potentiality was evaluated based on the gain cross section σ g , the minimum inversion fraction β min and the minimum pump intensity I min , which were calculated to be 0.18 × 10 −20 cm 2 , 0.05 and 0.47 kw/cm 2 , respectively. Continuous wave laser operation was realized with an output power of 0.77 W and a slope efficiency of 15.71%. The laser emitted around 1077 nm. The radiation trapping and continuous pump mode are contributed to the lasing wavelength for present crystal

  8. Local magnetic properties of multiferroic Nd0.5Gd0.5Fe3(BO3)4 in the excited states of Nd3+ ion

    Malakhovskii, A.V.; Gnatchenko, S.L.; Kachur, I.S.; Piryatinskaya, V.G.; Sukhachev, A.L.; Temerov, V.L.

    2015-01-01

    Polarized absorption spectra of single-crystal Nd 0.5 Gd 0.5 Fe 3 (BO 3 ) 4 were studied in the region of the transition 4 I 9/2 →( 4 G 5/2 + 2 G 7/2 ) in Nd 3+ ion as a function of temperature (2–34 K) and magnetic field (0–65 kOe). The spectra of natural circular dichroism were measured in the range of 5–40 K. It was found out that the local magnetic properties in the vicinity of the excited ion substantially depended on its state. In particular, a weak ferromagnetic moment appears in some excited states. It was found out that the selection rules for electron transitions in the magnetically ordered state substantially deviated from those in the paramagnetic state of the crystal. They are different for different transitions and they are very sensitive to the orientation of the sublattice magnetic moment relative to the light polarization. In the spectrum of the natural circular dichroism, the transition is revealed which is not observed in the absorption spectrum. - Highlights: • Temperature and field dependences of f-f transitions in Nd 0.5 Gd 0.5 Fe 3 (BO 3 ) 4 . • Natural circular dichroism in Nd 0.5 Gd 0.5 Fe 3 (BO 3 ) 4 below T N . • Weak ferromagnetic moment was identified in some excited 4f states. • Selection rules for f-f transitions substantially change below T N . • Intensities of f-f transitions strongly depend on magnetic moment orientation

  9. The new strains Brucella inopinata BO1 and Brucella species 83-210 behave biologically like classic infectious Brucella species and cause death in murine models of infection.

    Jiménez de Bagüés, María P; Iturralde, María; Arias, Maykel A; Pardo, Julián; Cloeckaert, Axel; Zygmunt, Michel S

    2014-08-01

    Recently, novel atypical Brucella strains isolated from humans and wild rodents have been reported. They are phenotypically close to Ochrobactrum species but belong to the genus Brucella, based on genetic relatedness, although genetic diversity is higher among the atypical Brucella strains than between the classic species. They were classified within or close to the novel species Brucella inopinata. However, with the exception of Brucella microti, the virulence of these novel strains has not been investigated in experimental models of infection. The type species B. inopinata strain BO1 (isolated from a human) and Brucella species strain 83-210 (isolated from a wild Australian rodent) were investigated. A classic infectious Brucella reference strain, B. suis 1330, was also used. BALB/c, C57BL/6, and CD1 mice models and C57BL/6 mouse bone-marrow-derived macrophages (BMDMs) were used as infection models. Strains BO1 and 83-210 behaved similarly to reference strain 1330 in all mouse infection models: there were similar growth curves in spleens and livers of mice and similar intracellular replication rates in BMDMs. However, unlike strain 1330, strains BO1 and 83-210 showed lethality in the 3 mouse models. The novel atypical Brucella strains of this study behave like classic intracellular Brucella pathogens. In addition, they cause death in murine models of infection, as previously published for B. microti, another recently described environmental and wildlife species. © The Author 2014. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  10. Evidence of enrichment by individual SN from elemental abundance ratios in the very metal-poor dSph galaxy Boötes I

    Feltzing, S.; Eriksson, K.; Kleyna, J.; Wilkinson, M. I.

    2009-12-01

    Aims. We establish the mean metallicity from high-resolution spectroscopy for the recently found dwarf spheroidal galaxy Boötes I and test whether it is a common feature for ultra-faint dwarf spheroidal galaxies to show signs of inhomogeneous chemical evolution (e.g. as found in the Hercules dwarf spheroidal galaxy). Methods: We analyse high-resolution, moderate signal-to-noise spectra for seven red giant stars in the Boötes I dSph galaxy using standard abundance analysis techniques. In particular, we assume local thermodynamic equilibrium and employ spherical model atmospheres and codes that take the sphericity of the star into account when calculating the elemental abundances. Results: We confirm previous determinations of the mean metallicity of the Boötes I dwarf spheroidal galaxy to be -2.3 dex. Whilst five stars are clustered around this metallicity, one is significantly more metal-poor, at -2.9 dex, and one is more metal-rich at, -1.9 dex. Additionally, we find that one of the stars, Boo-127, shows an atypically high [Mg/Ca] ratio, indicative of stochastic enrichment processes within the dSph galaxy. Similar results have previously only been found in the Hercules and Draco dSph galaxies and appear, so far, to be unique to this type of galaxy. The data presented herein were obtained at the W.M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W.M. Keck Foundation.

  11. Anisotropic lattice thermal expansion of PbFeBO4: A study by X-ray and neutron diffraction, Raman spectroscopy and DFT calculations

    Murshed, M. Mangir; Mendive, Cecilia B.; Curti, Mariano; Nénert, Gwilherm; Kalita, Patricia E.; Lipinska, Kris; Cornelius, Andrew L.; Huq, Ashfia; Gesing, Thorsten M.

    2014-01-01

    Highlights: • Mullite-type PbFeBO 4 shows uni-axial negative coefficient of thermal expansion. • Anisotropic thermal expansion of the metric parameters was modeled using modified Grüneisen approximation. • The model includes harmonic, quasi-harmonic and intrinsic anharmonic contributions to the internal energy. • DFT calculation, temperature- and pressure-dependent Raman spectra help understand the phonon decay and associated anharmonicity. - Abstract: The lattice thermal expansion of mullite-type PbFeBO 4 is presented in this study. The thermal expansion coefficients of the metric parameters were obtained from composite data collected from temperature-dependent neutron and X-ray powder diffraction between 10 K and 700 K. The volume thermal expansion was modeled using extended Grüneisen first-order approximation to the zero-pressure equation of state. The additive frame of the model includes harmonic, quasi-harmonic and intrinsic anharmonic potentials to describe the change of the internal energy as a function of temperature. The unit-cell volume at zero-pressure and 0 K was optimized during the DFT simulations. Harmonic frequencies of the optical Raman modes at the Γ-point of the Brillouin zone at 0 K were also calculated by DFT, which help to assign and crosscheck the experimental frequencies. The low-temperature Raman spectra showed significant anomaly in the antiferromagnetic regions, leading to softening or hardening of some phonons. Selected modes were analyzed using a modified Klemens model. The shift of the frequencies and the broadening of the line-widths helped to understand the anharmonic vibrational behaviors of the PbO 4 , FeO 6 and BO 3 polyhedra as a function of temperature

  12. Developing informational literacy among doctoral students and researchers - Case Åbo Akademi University Library and Turku University Library

    Eva Costiander-Huldén

    2013-12-01

    Full Text Available In recent years, there has been a demand to include doctoral students and researchers in the curriculum for information literacy. Not only information search, but also the expertise of the librarians in scientific publishing, bibliometric analysis is demanded. As a result of the demand the two universities in Turku/Åbo have developed their research services. The libraries have also met for benchmarking and further cooperation is being discussed. 1.The implementation of three focus group interviews with 18 researchers at Åbo Akademi University The Focus Group survey methodology has its roots in social science qualitative research. It is widely used in the library world and is considered to be suitable particularly well for the evaluation and development of library services. The overall purpose with our interviews was to obtain feedback on how library users (in this case, researchers and graduate students wish ÅAUL to develop its services to better meet their needs. Three group interviews were conducted, with 6-8 participators. The following questions were, among others, discussed in every session: How do the researchers perceive the library's role in their daily work? What is the starting point for retrieving information (e.g. The MetaLib portal, Google Scholar or other? Is there a need for courses/more supervision in information search and reference management? Is there a need for tailored and integrated library services? As a result of the sessions and analysis of the group discussions a number of measures were proposed: Targeted teaching of subject-specific databases, more topic-specific sessions in the library portal and RefWorks. Compulsory information retrieval course for first year doctoral students. Information Weeks or "hands on" sessions on campus libraries. The library should participate more in workshops and seminars to increase their visibility and their services. The library should actively consider how to measure the impact and

  13. Spectroscopic properties and diode-pumped 1594 nm laser performance of Er:Yb:Li6Y(BO3)3 crystal

    Zhao, Y. W.; Lin, Y. F.; Chen, Y. J.; Gong, X. H.; Luo, Z. D.; Huang, Y. D.

    2008-03-01

    An Er3+/Yb3+-codoped Li6Y(BO3)3 crystal was grown by the Czochralski method. The polarized absorption spectra and the fluorescence decay curve were recorded. The efficiency of energy transfer from Yb3+ to Er3+ ions was estimated. Quasi-continuous-wave output power of 325 mW at 1594 nm was realized under the absorbed pump power of 10.4 W in a hemispherical cavity. The absorbed pump threshold and slope efficiency of the laser are 6.0 W and 7.2%, respectively.

  14. Marketingová strategie ZŠ Boženy Němcové v Dačicích

    Kupcová, Marcela

    2011-01-01

    The thesis "Marketing Strategy of the Božena Němcová Basic School in Dačice" deals with the utility of the application of marketing activities in elementary school. The work is divided into theoretical and practical part. Theoretical part deals with the general concept of marketing, marketing in the public sector, it is mentioned specifically in marketing and education and its specifics. Another chapter is devoted to marketing planning and marketing strategy that will ensure achievement of se...

  15. Investigation of the chiral magnets NdFe{sub 3}({sup 11}BO{sub 3}){sub 4} and MnSi by means of neutron scattering

    Janoschek, Marc

    2008-09-05

    We investigated two different magnetic compounds that display magnetic chirality within the framework of this thesis, namely the multiferroic compound NdFe{sub 3}({sup 11}BO{sub 3}){sub 4} and the itinerant helimagnet MnSi. We investigated the magnetic structure of NdFe{sub 3}({sup 11}BO{sub 3}){sub 4} by unpolarised and polarised neutron scattering. As a result of this investigation we identified that NdFe{sub 3}({sup 11}BO{sub 3}){sub 4} orders antiferromagnetically below T{sub N}=31 K. By combined magnetic symmetry analysis and Rietvield fits of the powder diffraction data we identified two magnetic models for the commensurate magnetic phase that fitted our data equally well. By the use of spherical neutron polarimetry we finally revealed that for the correct magnetic model the magnetic moments of both Fe{sup 3+} and Nd{sup 3+} are oriented parallel to the basal hexagonal plane and couple antiferromagnetically along the hexagonal c-axis. Additionally the polarised neutron data yields that in the incommensurate magnetic phase below T{sub ICM} the magnetic structure is transformed into a long-period antiferromagnetic spiral that propagates parallel to the c-direction with a pitch of approximately 1140 A. Hence, our investigation clearly showed for the first time that NdFe{sub 3}({sup 11}BO{sub 3}){sub 4} is also a chiral magnet. Furthermore, a high resolution neutron diffraction experiment showed the presence of third order harmonics of the propagation vector in the incommensurate magnetic phase and suggests the evolution of a magnetic soliton lattice below the commensurate to incommensurate phase transition without the application of external forces like magnetic fields or pressure. Further we report our work on the cubic itinerant helimagnet MnSi. We carried out extensive unpolarised and polarised elastic neutron scattering experiments in the temperature regime where the sphere of magnetic intensity is observed in order to clarify the issue of a possible

  16. Investigation of the chiral magnets NdFe3(11BO3)4 and MnSi by means of neutron scattering

    Janoschek, Marc

    2008-01-01

    We investigated two different magnetic compounds that display magnetic chirality within the framework of this thesis, namely the multiferroic compound NdFe 3 ( 11 BO 3 ) 4 and the itinerant helimagnet MnSi. We investigated the magnetic structure of NdFe 3 ( 11 BO 3 ) 4 by unpolarised and polarised neutron scattering. As a result of this investigation we identified that NdFe 3 ( 11 BO 3 ) 4 orders antiferromagnetically below T N =31 K. By combined magnetic symmetry analysis and Rietvield fits of the powder diffraction data we identified two magnetic models for the commensurate magnetic phase that fitted our data equally well. By the use of spherical neutron polarimetry we finally revealed that for the correct magnetic model the magnetic moments of both Fe 3+ and Nd 3+ are oriented parallel to the basal hexagonal plane and couple antiferromagnetically along the hexagonal c-axis. Additionally the polarised neutron data yields that in the incommensurate magnetic phase below T ICM the magnetic structure is transformed into a long-period antiferromagnetic spiral that propagates parallel to the c-direction with a pitch of approximately 1140 A. Hence, our investigation clearly showed for the first time that NdFe 3 ( 11 BO 3 ) 4 is also a chiral magnet. Furthermore, a high resolution neutron diffraction experiment showed the presence of third order harmonics of the propagation vector in the incommensurate magnetic phase and suggests the evolution of a magnetic soliton lattice below the commensurate to incommensurate phase transition without the application of external forces like magnetic fields or pressure. Further we report our work on the cubic itinerant helimagnet MnSi. We carried out extensive unpolarised and polarised elastic neutron scattering experiments in the temperature regime where the sphere of magnetic intensity is observed in order to clarify the issue of a possible intermediate phase. Our data suggests that the cubic anisotropy energy that locks the

  17. Book review of Prof.Ph.D. Božidar Petrač: AGRARIAN ECONOMICS, Faculty of Economics in Osijek, 2002

    K. Zmaić

    2002-01-01

    Author of the book AGRARIAN ECONOMICS is Božidar Petrač, an assocciate professor of the Faculty of Economics in Osijek. The book is composed of 265 pages. This is the first book from agrarian economics field appeared in the Republic of Croatia. Research results obtained by Ph.D. B. Petrač, other domestic and foreign scientists as well as modern aspect of agriculture and agricultural economics development are included in the book. The main parts of the book are as follows: I. Introduction into...

  18. Phases of variable composition in the system Ba3-xSrxEr(BO3)3 (0≤x≤3.0)

    Khamaganova, T.N.

    2008-01-01

    The possibility of preparing two series of solid solutions in the system Ba 3-x Sr x Er(BO 3 ) 3 (0 ≤ x ≤ 3.0), crystallizing in different structural types, was examined. Samples of the phases of variable composition were synthesized by solid-phase reactions over the temperature range 500-1000 deg C, and their X-ray diffraction characteristics were determined. It is found that the triple phases prepared form two series of substitutional solid solutions in the system studied [ru

  19. Description of Paralactobacillus selangorensis gen. nov., sp. nov., a new lactic acid bacterium isolated from chili bo, a Malaysian food ingredient.

    Leisner, J J; Vancanneyt, M; Goris, J; Christensen, H; Rusul, G

    2000-01-01

    Paralactobacillus selangorensis gen. nov., sp. nov. is described. This organism, isolated from a Malaysian food ingredient called chili bo, is an obligatory homofermentative, rod-shaped lactic acid bacterium. The G+C content is 46.1-46.2+/-0.3 mol%. Earlier 16S rRNA studies showed that this organism constitutes a new taxon distantly related to the Lactobacillus casei-Pediococcus group. A phenotypic description that distinguishes Paralactobacillus selangorensis from other genera of lactic acid bacteria is presented. The type strain of Paralactobacillus selangorensis is LMG 17710T.

  20. Synthesis and crystal structure of terbium(III) meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}); Synthese und Kristallstruktur von Terbium(III)-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6})

    Nikelski, Tanja; Schleid, Thomas [Institut fuer Anorganische Chemie der Universitaet Stuttgart (Germany)

    2003-06-01

    The terbium meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) is obtained as single crystals by the reaction of terbium, Tb{sub 4}O{sub 7} and TbCl{sub 3} with an excess of B{sub 2}O{sub 3} in gastight sealed platinum ampoules at 950 C after three weeks. The compound appears to be air- and water-resistant and crystallizes as long, thin, colourless needles which tend to growth-twinning due to their marked fibrous habit. The crystal structure of Tb(BO{sub 2}){sub 3} (orthorhombic, Pnma; a = 1598.97(9), b = 741.39(4), c = 1229.58(7) pm; Z = 16) contains strongly corrugated oxoborate layers {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} built of vertex-linked [BO{sub 4}]{sup 5-} tetrahedra (d(B-O) = 143 - 154 pm, and angsph;(O-B-O) = 102-115 ) which spread out parallel (100). The four crystallographically different Tb{sup 3+} cations all exhibit coordination numbers of eight towards the oxygen atoms (d(Tb-O) = 228-287 pm). The corresponding metal cation polyhedra [TbO{sub 8}]{sup 13+} too convene to layers (composition: {sub {infinity}}{sup 2}{l_brace}(Tb{sub 2}O{sub 11}){sup 16-}{r_brace}) which are likewise oriented parallel to the (100) plane. (Abstract Copyright [2003], Wiley Periodicals, Inc.) [German] Das Terbium-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) entsteht einkristallin bei der Reaktion von Terbium, Tb{sub 4}O{sub 7} und TbCl{sub 3} mit einem Ueberschuss von B{sub 2}O{sub 3} in gasdicht verschlossenen Platinampullen nach drei Wochen bei 950 C. Die Verbindung ist luft- und wasserstabil und faellt in langen, duennen, farblosen Nadeln an, die aufgrund ihres ausgepraegt faserigen Habitus zur Wachstumsverzwillingung neigen. Die Kristallstruktur von Tb(BO{sub 2}){sub 3} (orthorhombisch, Pnma; a = 1598, 97(9), b = 741, 39(4), c = 1229, 58(7) pm; Z = 16) enthaelt parallel (100) verlaufende, stark gewellte Oxoborat-Schichten {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} aus

  1. Comparisons of pharmacokinetic and tissue distribution profile of four major bioactive components after oral administration of Xiang-Fu-Si-Wu Decoction effective fraction in normal and dysmenorrheal symptom rats.

    Liu, Pei; Li, Wei; Li, Zhen-hao; Qian, Da-wei; Guo, Jian-ming; Shang, Er-xin; Su, Shu-lan; Tang, Yu-ping; Duan, Jin-ao

    2014-07-03

    Xiang-Fu-Si-Wu Decoction (XFSWD) has been widely used to treat primary dysmenorrhea in clinical practice for hundreds of years and shown great efficacy. One fraction of XFSWD, which was an elution product by macroporous adsorption resin from aqueous extract solution with 60% ethanol (XFSWE), showed great analgesic effect. The present study was conducted to investigate the possible pharmacokinetic and tissue distribution profiles of four major bioactive constituents (berberine, protopine, tetrahydrocoptisine and tetrahydropalmatine) after oral administration of XFSWE in dysmenorrheal symptom rats, and to compare the difference between normal and dysmenorrheal symptom rats. Estradiol benzoate and oxytocin were used to produce dysmenorrheal symptom rat model. The experimental period was seven days. At the final day of experimental period, both normal and dysmenorrheal symptom rats were orally administrated with XFSWE, and then the blood and tissues samples were collected at different time points. Berberine, protopine, tetrahydrocoptisine and tetrahydropalmatine in blood and tissue samples were determined by LC-MS/MS. Pharmacokinetic parameters were calculated from the plasma concentration-time data using non-compartmental methods. The differences of pharmacokinetic parameters among groups were tested by one-way analysis of variance (ANOVA). There were statistically significant differences (Pnormal and dysmenorrheal symptom rats that orally administered with same dosage of XFSWE. In tissue distribution study, the results showed that the overall trend was C(Spleen)>C(Liver)>C(Kidney)>C(Uterus)>C(Heart)>C(Lung)>C(Ovary)>C(Brain)>C(Thymus), C(M-60 min)>C(M-120 min)>C(M-30 min)>C(C-60 min)>C(C-120 min)>C(C-30 min). The contents of protopine in liver, spleen and uterus were more than that in other tissues of dysmenorrheal symptom rats. Compared to normal rats, partial contents of the compounds in dysmenorrheal symptom rats׳ tissues at different time points had significant

  2. Risks and opportunities of the liberalized electricity market. Partial project: BoFiT, an integrated decision support system for retaining the competitiveness of the cogeneration technology. Final report; Risiken und Chancen des liberalisierten Strommarktes. Teilprojekt: Integrierte Entscheidungsunterstuetzung durch BoFiT zur Erhaltung der Wettbewerbsfaehigkeit der Kraft-Waerme-Kopplung. Abschlussbericht

    Stock, G.; Scheidt, M.

    2002-06-04

    The energy management system called BoFiT and specific new applications are explained which have been developed as one project task of the coordinated research project sponsored by the German ministry of economics,(BMWi), entitled ''Risks and opportunities of the liberalized electricity market''. The major objective of the project is: Finding efficient strategies to ensure the competitiveness of the cogeneration technology in the deregulated power and gas markets, in particular for the purpose of enhancing the penetration of the ecologically beneficial, cogenerated district heating supply in those markets. The focus of this report is on a specific application of the integrated BoFiT decision support system, for which the ''model for microsimulation of spot transactions at the Power Exchange based on a multi-agent system'' has been developed and is explained in great detail. (orig./CB) [German] Mit dem Energiemanagementsystem BoFiT soll den Unternehmen eine effektive und operativ nutzbare Entscheidungsunterstuetzung angeboten werden. Wesentliche Ziele des Verbundprojektes des BMWi sind: Unterstuetzung der KWK und speziell der darauf basierenden oekologisch sinnvollen Fernwaermeversorgung durch Anpassung von Arbeitsablaeufen und Werkzeugen zur Findung betriebswirtschaftlich optimaler Einsatz- und Betriebsstrategien; Kostenoptimierung der Kraftwerke, Vertraege und Stromhandelsaktivitaeten unter den Randbedingungen der deregulierten Strom- und Gasmaerkte. Als Beispiel einer solchen integrierten Entscheidungsunterstuetzung wird das ''Modell zur Mikrosimulation des Spothandels von Strom auf der Basis eines Multi-Agenten-Systems'' ausfuehrlich beschrieben. (orig./CB)

  3. T'ai Chi

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  4. Synthesis, structure, and electronic structure calculation of a new centrosymmetric borate Pb{sub 2}O[BO{sub 2}(OH)] based on anion-centered OPb{sub 4} tetrahedra

    Sun, Feng [College of Chemistry and Chemical Engineering, Xinjiang Normal University, Urumqi 830054 (China); Wang, Li, E-mail: wangliresearch@163.com [College of Chemistry and Chemical Engineering, Xinjiang Normal University, Urumqi 830054 (China); Stoumpos, Constantinos C. [Department of Chemistry, Northwestern University, Evanston, IL 60208 (United States)

    2016-08-15

    The synthesis, structure, and characterization of a new centrosymmetric borate Pb{sub 2}O[BO{sub 2}(OH)] based on anion-centered OPb{sub 4} tetrahedra are reported. Pb{sub 2}O[BO{sub 2}(OH)] crystallizes in monoclinic space group C2/m with a=12.725(7) Å, b=5.698(3) Å, c=7.344(4) Å, β=116.277(6)°. The electronic band structure and density of states of Pb{sub 2}O[BO{sub 2}(OH)] have been calculated via the density functional theory (DFT). Electron density difference calculation indicates that lone-pair electrons of Pb{sup 2+} cation should be stereoactive. - Graphical abstract: An indirect gap compound of Pb{sub 2}O[BO{sub 2}(OH)] with 2D inorganic layers motif based on OPb{sub 4} tetrahedra has been synthesized and full characterized by crystallographic, IR, TG, UV–vis-NIR Diffuse Reflectance, and theoretical calculations. Display Omitted - Highlights: • A centrosymmetric borate Pb{sub 2}O[BO{sub 2}(OH)] was synthesized and characterized. • The crystalstructure, electronic band and density states was analyzed. • The lone-pair electrons of Pb{sup 2+} were proved to be stereoactive.

  5. Charge-transfer and Mott-Hubbard Excitations in FeBo3: Fe K-edge resonant Inelastic x-ray scattering study

    Kim, J.; Shvydko, Y.

    2011-01-01

    Momentum-resolved resonant inelastic x-ray scattering (RIXS) spectroscopy has been carried out successfully at the Fe K-edge for the first time. The RIXS spectra of a FeBO 3 single crystal reveal a wealth of information on ∼ 1-10 eV electronic excitations. The IXS signal resonates when the incident photon energy approaches the pre-edge (1s - -3d) and the main-edge (1s - -4p) of the Fe K-edge absorption spectrum. The RIXS spectra measured at the pre-edge and the main-edge show quantitatively different dependences on the incident photon energy, momentum transfer, photon polarization, and temperature. We present a multielectron analysis of the Mott-Hubbard (MH) and charge transfer (CT) excitations, and calculate their energies. Electronic excitations observed in the pre-edge and main-edge RIXS spectra are interpreted as MH and CT excitations, respectively. We propose the electronic structure around the chemical potential in FeBO 3 based on the experimental data.

  6. Magneto-electric coupling in NdFe{sub 3}(BO{sub 3}){sub 4} studied by resonant x-ray scattering

    Hamann-Borrero, J.E.; Partzsch, S.; Hess, C.; Buechner, B.; Geck, J. [IFW Dresden, 01171 Dresden (Germany); Valencia, S.; Feyerherm, R. [Helmholtz Zentrum Berlin, Albert Einstein Str. 15, 12489 Berlin (Germany); Mazzoli, C.; Herrero-Martin, J. [ESRF, Boite Postale 220, 38043 Grenoble (France); Vasiliev, A. [Faculty of Physics, Moscow State University (Russian Federation); Bezmaternykh, L. [Kirensky Institute of Physics, Russian Academy of Sciences, Krasnoyarsk (Russian Federation)

    2011-07-01

    Resonant x-ray magnetic scattering (RXS) experiments on NdFe{sub 3}(BO{sub 3}){sub 4} were performed at the Nd L{sub 2,3} and Fe K edges in order to determine its magnetic structure as a function of temperature (T) as well as applied magnetic (B) and electric (E) fields. Results of the T dependent measurements show that the magnetic structure changes from a commensurate collinear structure to an incommensurate spin helix structure. Moreover, the analysis of the resonant intensities shows that the T dependence of the magnetic order is different for the Nd and for the Fe sublattice. A mean field analysis implies that the magnetization of the Nd sublattice is induced by the Fe magnetization. When a B field is applied along the a-direction, the spin helix is destroyed and a collinear structure is formed where the moments align perpendicular to B. Since the critical B at which the spin helix is destroyed is the same at which the magnetic induced electric polarization is maximum. This shows that the spin helix is not the origin of the electric polarization in NdFe{sub 3}(BO{sub 3}){sub 4}.

  7. TEKNIK PENGATURAN AIR PADA INTENSIFIKASI PADI AEROB TERKENDALI-BERBASIS ORGANIK (IPAT-BO UNTUK MENINGKATKAN POPULASI RHIZOBACTERIA, EFISIENSI PENGGUNAAN AIR, PERAKARAN TANAMAN, DAN HASIL TANAMAN PADI

    Hingdri -

    2013-03-01

    Full Text Available Teknik pengaturan air pada budidaya tanaman padi melalui Intensifikasi Padi Aerob Terkendali-Berbasis Organik (IPAT-BO perlu dilakukan untuk meningkatkan efisiensi penggunaan air. Penelitian ini bertujuan untuk mengtahui aktivitas rhizobacteria, tingkat efisiensi penggunaan air, perkaran tanaman, dan hasil tanaman pada berbagai teknik pengaturan air.Penelitian dilaksanakan di lahan percobaan Fakultas Pertanian Universitas Winaya Mukti, Tanjungsari pada inceptisol pada skala pot plastik. Rancangan percobaan yang digunakan adalah Rancangan Acak Kelompok (RAK faktor tunggal dengan 16 perlakuan dan diulang tiga kali, yaitu terdiri dari kombinasi antara perlakuan air dan empat varietas. Perlakuan air: tinggi muka air + 5cm, 0 cm, – 5 cm dan  – 10 cm. Empat varietas: Ciherang, Sintanur, Inpari 13 dan Fatmawati..Hasil penelitian menunjukkan terdapat pengaruhnyata terhadap populasi Rhizobacteria, perkembangan akar, dan hasil tanaman. Perlakuan tinggi muka air – 10 cm varietas Fatmawati memberikan hasil tertinggi pada volume akar 186,67 ml, populasi bakteri Azotobacter sp. (1,43 x 1010 CFU g-1, bakteri pelarut fosfat (6,07 x 108 CFU g-1, hasil tanaman tertinggi 95,9 g rumpun-1 setara dengan 9,14 ton ha-1 serta meningkatkan efisiensi penggunaan air 47,1 % dibandingkan dengan pengenangan 5 cm.Kata kunci:  Teknik pengaturan air, efisiensi penggunaan air, IPAT-BO, populasi rhizobakteria

  8. Electronic structure and magnetism of new ilmenite compounds for spintronic devices: FeBO{sub 3} (B = Ti, Hf, Zr, Si, Ge, Sn)

    Ribeiro, R.A.P. [Department of Chemistry, State University of Ponta Grossa, Av. General Carlos Cavalcanti, 4748, 84030-900 Ponta Grossa, PR (Brazil); Camilo, A. [Department of Physics, State University of Ponta Grossa, Av. General Carlos Cavalcanti, 4748, 84030-900 Ponta Grossa, PR (Brazil); Lazaro, S.R. de, E-mail: srlazaro@uepg.br [Department of Chemistry, State University of Ponta Grossa, Av. General Carlos Cavalcanti, 4748, 84030-900 Ponta Grossa, PR (Brazil)

    2015-11-15

    First-principles calculations were performed in the framework of Density Functional Theory (DFT) within hybrid functional (B3LYP) to study the electronic structure and magnetic properties of new ilmenite FeBO{sub 3} (B=Ti, Hf, Zr, Si, Ge, Sn) materials. In particular, the magnetic exchange interaction between Fe{sup 2+} layers is dependent on the interlayer distance and it can be controlled by ionic radius of B-site cation. Thus, Fe(Ti, Si, Ge)O{sub 3} are antiferromagnetic materials, while Fe(Zr, Hf, Sn)O{sub 3} are ferromagnetic. We also argue that antiferromagnetic materials and FeZrO{sub 3} are convectional semiconductors, whereas FeHfO{sub 3} and FeSnO{sub 3} exhibit intrinsic half-metallic behavior, making them promising candidates for spintronic devices. - Highlights: • We study electronic structure and magnetism of new FeBO{sub 3} (B=Ti, Hf, Zr, Si, Ge, Sn) ilmenite materials. • We found that magnetic ordering of Fe-based ilmenite materials can be controlled by size of B-site cation. • Fe(Ti, Zr, Si, Ge)O{sub 3} are convectional semiconductors. • FeHfO{sub 3} and FeSnO{sub 3} exhibit intrinsic half-metallic behavior with potential application for spintronic devices.

  9. Effect of Relative Humidity on the Tribological Properties of Self-Lubricating H3BO3 Films Formed on the Surface of Steel Suitable for Biomedical Applications

    E. Hernández-Sanchez

    2015-01-01

    Full Text Available The effect of environmental humidity on the self-lubricating properties of a thin film of boric acid (H3BO3 was evaluated. H3BO4 films were successfully formed on the surface of AISI 316L steel. The study was conducted on AISI 316L steel because of its use in biomedical applications. First, the samples were exposed to boriding to generate a continuous surface layer of iron borides. The samples were then exposed to a short annealing process (SAP at 1023 K for 5 min and cooled to room temperature while controlling the relative humidity (RH. Five different RH conditions were tested. The purpose of SAP was to promote the formation of a surface film of boric acid from the boron atoms present in the iron boride layers. The presence of the boric acid at the surface of the borided layer was confirmed by Raman spectroscopy and X-ray diffraction (XRD. The self-lubricating capability of the films was demonstrated using the pin-on-disk technique. The influence of RH was reflected by the friction coefficient (FC, as the samples cooled with 20% of RH exhibited FC values of 0.16, whereas the samples cooled at 60% RH showed FC values of 0.02.

  10. Magnetoelectric coupling mechanisms in YMn2-xFexO5 and NdFe3(BO3)4 revealed by resonant X-ray diffraction

    Partzsch, Sven

    2014-01-01

    Multiferroic materials with a coupled ordering of electric and magnetic moments could be used to build energy-efficient, magnetic computer memory that is written with an electrical field. To understand the interaction between the magnetic and electric ordering in such materials, two examples, namely yttrium manganate YMn 2 O 5 and neodymium iron borate NdFe 3 (BO 3 ) 4 , are studied by means of resonant x-ray diffraction. The important role of a pure electronic contribution to the ferroelectric polarization is shown in YMn 2 O 5 . Furthermore, substitution of Fe can change the magnetic order of YMn 2 O 5 from antiferromagnetic into ferrimagnetic, allowing the storage of easily readable magnetic information. Therefore the change of the magnetic structure upon small Fe substitution is studied. Although most of the magnetic structure of the parent compound is kept, the Fe moments have larger components along the c-direction. In NdFe 3 (BO 3 ) 4 the microscopic origin of the magnetoelectric coupling is addressed as the consequence of the frustration of the Fe and Nd magnetic sublattices. The application of an electrical field shifts the balance from the helical to the collinear magnetic domains, revealing again the strong magnetoelectric coupling.

  11. Phase relations in the pseudo ternary system In2O3-TiO2-BO (B: Zn, Co and Ni) at 1200 °C in air

    Brown, Francisco; Jacobo-Herrera, Ivan Edmundo; Alvarez-Montaño, Victor Emmanuel; Kimizuka, Noboru; Hirano, Tomonosuke; Sekine, Ryotaro; Denholme, Saleem J.; Miyakawa, Nobuaki; Kudo, Akihiko; Iwase, Akihide; Michiue, Yuichi

    2018-02-01

    Phase relations in the pseudo ternary systems In2O3-TiO2-ZnO, In2O3-TiO2-CoO and In2O3-TiO2-NiO at 1200 °C in air were determined by means of a classic quenching method. In6Ti6BO22 (B: Zn, Co and Ni) which has the monoclinic In(Fe1/4Ti3/4)O27/8-type of structure with a 4-dimensional super space group exists in a stable form. There exist homologous phases In1+x(Ti1/2Zn1/2)1-xO3(ZnO)m (m: natural number, 0ternary system In2O3-TiO2-ZnO. All the ions are on the trigonal lattice points, the In(III) is in the octahedral coordination with the oxygen and the {Inx(Ti1/2Zn1/2)1-xZnm} is in the trigonalbipyramidal coordination with oxygen in the crystal structures of each homologous compound. They have R 3 bar m (No. 166) for m = odd or P63/mmc (No. 194) for m = even in space group. Lattice constants for each of the homologous compounds as a hexagonal setting and In6Ti6BO22 as the monoclinic system were determined by means of the powder X-ray diffraction method at room temperature. The temperature dependence of resistivity for In1+x(Ti1/2Zn1/2)1-x(ZnO)4 (0.15 ≤ x ≤ 1) showed semiconducting-like behavior for all samples examined at T(K) = 2-300. The resistivity increased systematically with decreasing x (0.7 ≤ x ≤ 1), and it was found that samples where x ≤ 0.7 became insulators. The optical band gap Eg (eV) of In1+x(Ti1/2Zn1/2)1-x(ZnO)4 has been estimated from the diffuse reflection spectra for the whole range of x (0.15 ≤ x ≤ 1). A minimum value of 2.0717 eV for x = 1 and a maximum one of 3.066 eV for x = 0.15 were observed. Dependence of the crystal structures of the InAO3(BO), In(Ti1/2B1/2)O3(B‧O) and stability of In6Ti6BO22 upon the constituent cations in the pseudo quaternary system In2O3-TiO2-A2O3-BO (A: Fe, Ga and Cr; B, B‧: Mg, Zn, Co, Ni, Ca and Sr) were discussed in terms of their ionic radii and site preference effects.

  12. A novel single-phase white phosphor NaBaBO{sub 3}:Dy{sup 3+},K{sup +} for near-UV white light-emitting diodes

    Zheng, Jianghui; Cheng, Qijin; Wu, Jieyang; Cui, Xin; Chen, Rong; Chen, Wenzhi [School of Energy Research, Xiamen University, Xiamen 361005 (China); Chen, Chao, E-mail: cchen@xmu.edu.cn [School of Energy Research, Xiamen University, Xiamen 361005 (China); School of Physics and Mechanical & Electrical Engineering, Xiamen University, Xiamen, 361005 (China)

    2016-01-15

    Highlights: • A white phosphor NaBaBO{sub 3}:Dy{sup 3+},K{sup +} with CIE coordinate (0.301, 0.308) was synthesized. • The optimum doping concentration of Dy{sup 3+} ions was found. • The effect and mechanism of K{sup +} ion as a charge compensator were discussed. • Temperature-dependent PL property of NaBaBO{sub 3}:Dy{sup 3+},K{sup +} was studied. • PL decay and quantum efficiency behaviors of the samples were investigated. - Abstract: A novel Dy{sup 3+}-doped NaBaBO{sub 3} white-emitting phosphor has been prepared by high temperature solid-state reaction method. The phase structure and luminescence properties of NaBaBO{sub 3}:Dy{sup 3+},K{sup +} samples were investigated. Photoluminescence results show that the as-prepared samples could be effectively excited by near-ultraviolet (NUV) light and generate white light emission due to the {sup 4}F{sub 9/2} → {sup 6}H{sub 15/2} (blue) transition and {sup 4}F{sub 9/2} → {sup 6}H{sub 13/2} (yellow) transition of Dy{sup 3+} ions, respectively. The optimum doping concentration of Dy{sup 3+} ions in the NaBaBO{sub 3} host was determined to be 5.0 mol% and the CIE chromaticity of the sample was determined to be (0.301, 0.308). Moreover, the mechanism of K{sup +} ion as a charge compensator on the improvement of photoluminescence property and the effect of temperature on the photoluminescence property of NaBaBO{sub 3}:Dy{sup 3+},K{sup +} were investigated. Furthermore, photoluminescence decay and quantum efficiency behaviors of NaBaBO{sub 3}:Dy{sup 3+},K{sup +} were also studied. The present work demonstrates that the NaBaBO{sub 3}:Dy{sup 3+},K{sup +} phosphor is a potential candidate for NUV white light emitting diodes.

  13. Efficacy of a gE-deleted, bovine herpesvirus 1 (BoHV-1 inactivated vaccine Eficácia de uma vacina inativada, gE-deletada, contra o herpesvírus bovino tipo 1 (BoHV-1

    Alessandra D. Silva

    2009-07-01

    Full Text Available Bovine herpesvirus type 1 (BoHV-1 is recognized as a major cause of economic losses in cattle. Vaccination has been widely applied to minimize losses induced by BoHV-1 infections. We have previously reported the development of a differential BoHV-1 vaccine, based on a recombinant glycoprotein E (gE-deleted virus (265gE-. In present paper the efficacy of such recombinant was evaluated as an inactivated vaccine. Five BoHV-1 seronegative calves were vaccinated intramuscularly on day 0 and boostered 30 days later with an inactivated, oil adjuvanted vaccine containing an antigenic mass equivalent to 10(7.0 fifty per cent cell culture infectious doses (CCID50 of 265gE-. Three calves were kept as non vaccinated controls. On day 60 post vaccination both vaccinated and controls were challenged with the virulent parental strain. No clinical signs or adverse effects were seen after or during vaccination. After challenge, 2/5 vaccinated calves showed mild clinical signs of infection, whereas all non vaccinated controls displayed intense rhinotracheitis and shed virus for longer and to higher titres than vaccinated calves. Serological responses were detected in all vaccinated animals after the second dose of vaccine, but not on control calves. Following corticosteroid administration in attempting to induce reactivation of the latent infection, no clinical signs were observed in vaccinated calves, whereas non vaccinated controls showed clinical signs of respiratory disease. In view of its immunogenicity and protective effect upon challenge with a virulent BoHV-1, the oil adjuvanted preparation with the inactivated 265gE- recombinant was shown to be suitable for use as a vaccine.O Herpesvírus bovino tipo 1 (BoHV-1 é reconhecido como um importante agente de perdas econômicas em bovinos. Vacinação tem sido amplamente empregada para minimizar as perdas conseqüentes a infecções com o BoHV-1. Reportamos previamente o desenvolvimento de uma vacina

  14. In search of the X{sub 2}BO and X{sub 2}BS (X = H, F) free radicals: Ab initio studies of their spectroscopic signatures

    Clouthier, Dennis J., E-mail: dclaser@uky.edu [Department of Chemistry, University of Kentucky, Lexington, Kentucky 40506-0055 (United States)

    2014-12-28

    The F{sub 2}BO free radical is a known, although little studied, species but similar X{sub 2}BY (X = H, D, F; Y = O, S) molecules are largely unknown. High level ab initio methods have been used to predict the molecular structures, vibrational frequencies (in cm{sup −1}), and relative energies of the ground and first two excited electronic states of these free radicals, as an aid to their eventual spectroscopic identification. The chosen theoretical methods and basis sets were tested on F{sub 2}BO and found to give good agreement with the known experimental quantities. In particular, complete basis set extrapolations of coupled-cluster single and doubles with perturbative triple excitations/aug-cc-pVXZ (X = 3, 4, 5) energies gave excellent electronic term values, due to small changes in geometry between states and the lack of significant multireference character in the wavefunctions. The radicals are found to have planar C{sub 2v} geometries in the X{sup ~2}B{sub 2} ground state, the low-lying A{sup ~2}B{sub 1} first excited state, and the higher B{sup ~2}A{sub 1} state. Some of these radicals have very small ground state dipole moments hindering microwave measurements. Infrared studies in matrices or in the gas phase may be possible although the fundamentals of H{sub 2}BO and H{sub 2}BS are quite weak. The most promising method of identifying these species in the gas phase appears to be absorption or laser-induced fluorescence spectroscopy through the allowed B{sup ~}-X{sup ~} transitions which occur in the visible-near UV region of the electromagnetic spectrum. The ab initio results have been used to calculate the Franck-Condon profiles of the absorption and emission spectra, and the rotational structure of the B{sup ~}-X{sup ~}0{sub 0}{sup 0} bands has been simulated. The calculated single vibronic level emission spectra provide a unique, readily recognizable fingerprint of each particular radical, facilitating the experimental identification of new X{sub 2}BY

  15. On-site ocean horizontal aerosol extinction coefficient inversion under different weather conditions on the Bo-hai and Huang-hai Seas

    Zeng, Xianjiang; Xia, Min; Ge, Yinghui; Guo, Wenping; Yang, Kecheng

    2018-03-01

    In this paper, we explore the horizontal extinction characteristics under different weather conditions on the ocean surface with on-site experiments on the Bo-hai and Huang-hai Seas in the summer of 2016. An experimental lidar system is designed to collect the on-site experimental data. By aiming at the inhomogeneity and uncertainty of the horizontal aerosol in practice, a joint retrieval method is proposed to retrieve the aerosol extinction coefficients (AEC) from the raw data along the optical path. The retrieval results of both the simulated and the real signals demonstrate that the joint retrieval method is practical. Finally, the sequence observation results of the on-site experiments under different weather conditions are reported and analyzed. These results can provide the attenuation information to analyze the atmospheric aerosol characteristics on the ocean surface.

  16. The exploration and characterization of an orange emitting long persistent luminescence phosphor LiSr4(BO3)3:Eu2+

    Jin, Yahong; Hu, Yihua; Wu, Haoyi; Chen, Li; Wang, Xiaojuan

    2016-01-01

    An orange emitting long persistent phosphor LiSr 4 (BO 3 ) 3 :Eu 2+ was prepared successfully using a conventional solid state reaction method. The luminescent and persistent luminescence properties were studied using fluorescence spectra, decay curves, persistent luminescence spectra and thermoluminescence (TL) glow curves. The effects on the fluorescence and persistent luminescence properties by the dosage of Li 2 CO 3 were explored. The relationship between the Eu 2+ contents and persistent luminescence properties were studied. The optimal doping concentration of Eu 2+ was experimentally to be 1 mol%. The detailed processes and a possible mechanism were also discussed. - Highlights: • Li 2 CO 3 plays a critical role in producing persistent luminescence. • 40 % excess of Li 2 CO 3 makes the largest enhancement on persistent luminescence. • The optimal doping concentration of Eu 2+ was experimentally to be 1mol %. • Possible mechanism for persistent luminescence was discussed.

  17. A study on the unstructured music database—Taking the Bo people’s music and its music iconography database as an example

    Liu Yutong

    2015-01-01

    Full Text Available An unstructured music iconography data system constructed by key technologies like Dublin Core, Lucene technology and MVC framework is studied in this paper. Results indicate that the traditional directory tree and the existing indexing and searching tools are severely insufficient in the organization and management of the massive unstructured data. Relevant documents can be searched effectively and rapidly through the index established by provided by BeFS. Key technologies, such as Dublin Core, Lucene technology and MVC framework, can be applied to the construction of the enormous unstructured database of music and image resources. The database system test can be divided into two links, functional test and performance test. The test results of the Bo people’s music and image database system obtained through the tested design scheme indicate that the performance of the system is relatively high and able to satisfy the concurrent access of massive data with excellent user experience.

  18. Spin-wave dynamics and exchange interactions in multiferroic NdFe3(BO3)4 explored by inelastic neutron scattering

    Golosovsky, I. V.; Ovsyanikov, A. K.; Aristov, D. N.; Matveeva, P. G.; Mukhin, A. A.; Boehm, M.; Regnault, L.-P.; Bezmaternykh, L. N.

    2018-04-01

    Magnetic excitations and exchange interactions in multiferroic NdFe3(BO3)4 were studied by inelastic neutron scattering in the phase with commensurate antiferromagnetic structure. The observed spectra were analyzed in the frame of the linear spin-wave theory. It was shown that only the model, which includes the exchange interactions within eight coordination spheres, describes satisfactorily all observed dispersion curves. The calculation showed that the spin-wave dynamics is governed by the strongest antiferromagnetic intra-chain interaction and three almost the same inter-chain interactions. Other interactions, including ferromagnetic exchange, appeared to be insignificant. The overall energy balance of the antiferromagnetic inter-chain exchange interactions, which couple the moments from the adjacent ferromagnetic layers as well as within a layer, stabilizes ferromagnetic arrangement in the latter. It demonstrates that the pathway geometry plays a crucial role in forming of the magnetic structure.

  19. Passively Q-switched self-frequency-doubled Nd3+:GdCa4O(BO3)3 laser

    Zhang, Xingyu; Zhao, Shengzhi; Wang, Qingpu; Zhang, Shujun; Sun, Lianke; Liu, Xunmin; Zhang, Shaojun; Chen, Huanchu

    2001-01-01

    The performance of a flash-lamp-pumped self-frequency-doubled Nd 3+ :GdCa 4 O(BO 3 ) 3 (Nd:GdCOB) laser that is passively Q switched with Cr 4+ :YAG saturable absorbers is demonstrated. The maximum 0.53-μm pulse energy obtained is 2.6 mJ, and the maximum peak intensity is 15 MW/cm2. The dependence of the pulse characteristics on the orientation of the saturable absorber and on the cavity length is measured. Meanwhile, the transversal distribution of the intracavity photon density is taken into account in the rate equations for an intracavity frequency-doubled passively Q-switched laser, and the solutions are used to account for the behavior of the passively Q-switched Nd:GdCOB laser. [copyright] 2001 Optical Society of America

  20. Theory of lattice response to external magnetic field in SrCu2(BO3)2: magnetostriction driven by panthograph effect

    Saul, Andres; Radtke, Guillaume; Jaime, Marcelo; Salamon, Myron; Dabkowska, Hanna

    2015-03-01

    Recent magnetostriction experiments have shown that the macroscopic physical dimensions of the Shastry-Sutherland compound SrCu2(BO3)2 change with the applied magnetic field mimicking the same complex behavior observed in the magnetization. Using Density Functional based methods we find that the driving force behind the magnetoelastic coupling is the Cu-O-Cu superexchange angle which, thanks to the orthogonal Cu2+ dimers acting as pantographs, can shrink significantly (0.44%) with minute (0.01%) variations in the lattice parameters. The consequence is a reduction of the order of ~10% in the antiferromagnetic intra-dimer exchange integral J, sufficient to compensate the elastic energy loss in the deformation.

  1. Optical bands and energy levels of Nd{sup 3+} ion in the YAl{sub 3}(BO{sub 3}){sub 4} nonlinear laser crystal

    Jaque, D.; Capmany, J.; Garcia Sole, J. [Departamento de Fisica de Materiales, Universidad Autonoma de Madrid, Cantoblanco, 28049 Madrid (Spain); Luo, Z.D. [Fujian Institute of Research on The Structure of Matter, Chinese Academy of Sciences, Fuzhou, Fujian 350002 (China)

    1997-11-03

    In this paper the polarized optical spectra (absorption and fluorescence) of the Nd{sup 3+} ion in the YAl{sub 3}(BO{sub 3}){sub 4} nonlinear crystal have been systematically investigated at low (10 K) and room temperature. Most energy levels of Nd{sup 3+} in this crystal (103) have been identified and conveniently labelled with their crystal field quantum numbers, {mu}=1/2 and {mu}=3/2. The radiative emitting states have been identified. Analysing the optical absorption spectra with the anisotropic Judd-Ofelt theory, the radiative lifetimes and branching ratios from the metastable state {sup 4}F{sub 3/2} have been calculated. Then, relevant spectroscopic parameters (quantum efficiency and emission cross sections) for laser applications have been estimated. Infrared to visible up-conversion is reported for the first time in this host crystal. (author)

  2. El queso como recurso turístico para el desarrollo regional:la Vall de Boí como caso de estudio

    Francesc Fusté Forné

    2016-01-01

    Full Text Available El turismo gastronómico es una tipología turística que sea o no la motivación principal de un desplazamiento turístico, está presente en cualquier viaje. Éste representa una fuente de ingresos provenientes de los turistas y a la vez genera también sinergias que benefician el desarrollo de la comunidad local. Este artículo analiza cómo el queso actúa como un recurso turístico y a la vez como una herramienta para el desarrollo de los productores autóctonos, desde un punto de vista cualitativo. Para ello se analiza en qué formas el queso está presente en las cartas de los restaurantes de la Vall de Boí, destino Patrimonio de la Humanidad en el Pirineo catalán.

  3. NMR of the Shastry-Sutherland lattice SrCu{sub 2}(BO{sub 3}){sub 2} in pulsed magnetic fields

    Stern, R. [National Institute of Chemical Physics and Biophysics, 12618 Tallinn (Estonia); Kohlrautz, J.; Haase, J. [Universitaet Leipzig, Faculty of Physics and Earth Sciences, 04103 Leipzig (Germany); Kuehne, H.; Green, E.L.; Wosnitza, J. [Hochfeld-Magnetlabor Dresden (HLD), Helmholtz-Zentrum Dresden-Rossendorf, 01314 Dresden (Germany)

    2015-07-01

    SrCu{sub 2}(BO{sub 3}){sub 2} is a quasi-two-dimensional spin system consisting of Cu{sup 2+} ions which form orthogonal spin-singlet dimers, also known as the Shastry-Sutherland lattice. This system has been studied extensively using a variety of techniques to probe the spin-triplet excitations, including recent magnetization measurements over 100 T. Spectroscopic techniques, such as nuclear magnetic resonance (NMR), can provide further insight into the spin-coupling mechanisms and excitations. We present {sup 11}B NMR spectra measured in pulsed magnetic fields up to 54 T, and compare those with prior results obtained in static magnetic fields at 41 T. Herewith, we prove the feasibility and efficacy of this technique, yielding the capability for extended studies at highest magnetic fields up to the 100 T regime that determine the spin structure in the 1/3 magnetization plateau and beyond.

  4. APLIKASI KOMBINASI KOMPOS JERAMI, KOMPOS AZOLLA DAN PUPUK HAYATI UNTUK MENINGKATKAN JUMLAH POPULASI BAKTERI PENAMBAT NITROGEN DAN PRODUKTIVITAS TANAMAN PADI BERRBASIS IPAT-BO

    Ferina Rosiana

    2013-03-01

    Full Text Available Penelitian untuk mengetahui efek pemberian kombinasi kompos jerami dengan Azolla dan pupuk hayati majemuk terhadap peningkatan populasi bakteri penambat N dan produktivitas tanaman padi dengan teknologi IPAT-BO dilaksanakan dari bulan April hingga Juli 2012 di kebun percobaan Fakultas Pertanian, Universitas Padjadjaran, Jatinangor, dengan ketinggian + 740 m dpl. Penelitian ini menggunakan rancangan acak kelompok faktor tunggal dengan dua belas perlakuan dan tiga kali ulangan. Perlakuan terdiri dari (A tanpa kompos jerami, (B kompos jerami 2,5 ton ha-1, (C kompos jerami 5 ton ha-1, (D kompos Azolla 0,5 ton ha-1, (E kompos jerami 2,5 ton ha-1 + kompos Azolla 0,5 ton ha-1, (F kompos jerami 5 ton ha-1 + kompos Azolla 0,5 ton ha-1, (G pupuk hayati 400 g ha-1, (H kompos jerami 2,5 ton ha-1 + pupuk hayati 400 g ha-1, (I kompos jerami 5 ton ha-1 + pupuk hayati 400 g ha-1, (J kompos Azolla 0,5 ton ha-1 + pupuk hayati 400 g ha-1, (K kompos jerami 2,5 ton ha-1 + kompos Azolla 0,5 ton ha-1 + pupuk hayati 400 g ha-1, (L kompos jerami 5 ton ha-1 + kompos Azolla 0,5 ton ha-1 + pupuk hayati 400 g ha-1.Aplikasi perlakuan kompos jerami, kompos Azolla dan pupuk hayati majemuk memberikan pengaruh terhadap populasi penambat N (Azotobacter sp. dan Azospirilium sp. dan produktifitas tanaman padi. Aplikasi kompos jerami 2,5 ton ha-1 dengan pupuk hayati 400 g ha-1 memberikan hasil GKP yaitu 64,39 g tanaman-1 (6,13 ton ha-1. Kata kunci: IPAT-BO, kompos Azolla, kompos jerami, pupuk hayati.

  5. Reductions in biomarkers of exposure (BoE) to harmful or potentially harmful constituents (HPHCs) following partial or complete substitution of cigarettes with electronic cigarettes in adult smokers

    O’Connell, Grant; Graff, Donald W.; D’Ruiz, Carl D.

    2016-01-01

    Abstract Changes in fifteen urine, blood and exhaled breath BoEs of HPHCs representing classes of compounds reported by FDA to be significant contributors to smoking-associated disease risks were measured in 105 clinical-confined subjects following randomization and a five-day forced-switch from usual brand conventional combustible cigarettes to: (i) exclusive commercial e-cigarette use; (ii) dual-use of commercial e-cigarettes and the subject’s usual cigarette brand; or (iii) discontinued use of all tobacco or nicotine products. Levels of urinary biomarkers in subjects that completely substituted their usual cigarette with e-cigarettes were significantly lower (29–95%) after 5 days. Percent reductions in eight of nine urinary BoEs were indistinguishable to smokers who had quit smoking, except for nicotine equivalents, which declined by 25–40%. Dual users who halved self-reported daily cigarette consumption with e-cigarettes exhibited reductions (7–38%) in eight of nine urinary biomarkers, but had increase (1–20%) in nicotine equivalents. Reductions were broadly proportional to the reduced numbers of cigarettes smoked. Dual user urinary nicotine equivalents were slightly higher, but not statistically significant. After 5 days, blood nicotine biomarker levels were lower in the cessation (75–96%) and exclusive use groups (11–83%); with dual users experiencing no significant reductions. All subjects experienced significant decreases in exhaled CO. Decreases in the cessation and exclusive groups ranged from 88–89% and 27–32% in dual users. Exhaled NO increased in the cessation and exclusive groups (46–63% respectively), whereas the dual users experienced minimal changes. Overall, smokers who completely or partially substituted conventional cigarettes with e-cigarettes over five days, experienced reductions in HPHCs. PMID:27401591

  6. Reductions in biomarkers of exposure (BoE) to harmful or potentially harmful constituents (HPHCs) following partial or complete substitution of cigarettes with electronic cigarettes in adult smokers.

    O'Connell, Grant; Graff, Donald W; D'Ruiz, Carl D

    2016-07-01

    Changes in fifteen urine, blood and exhaled breath BoEs of HPHCs representing classes of compounds reported by FDA to be significant contributors to smoking-associated disease risks were measured in 105 clinical-confined subjects following randomization and a five-day forced-switch from usual brand conventional combustible cigarettes to: (i) exclusive commercial e-cigarette use; (ii) dual-use of commercial e-cigarettes and the subject's usual cigarette brand; or (iii) discontinued use of all tobacco or nicotine products. Levels of urinary biomarkers in subjects that completely substituted their usual cigarette with e-cigarettes were significantly lower (29-95%) after 5 days. Percent reductions in eight of nine urinary BoEs were indistinguishable to smokers who had quit smoking, except for nicotine equivalents, which declined by 25-40%. Dual users who halved self-reported daily cigarette consumption with e-cigarettes exhibited reductions (7-38%) in eight of nine urinary biomarkers, but had increase (1-20%) in nicotine equivalents. Reductions were broadly proportional to the reduced numbers of cigarettes smoked. Dual user urinary nicotine equivalents were slightly higher, but not statistically significant. After 5 days, blood nicotine biomarker levels were lower in the cessation (75-96%) and exclusive use groups (11-83%); with dual users experiencing no significant reductions. All subjects experienced significant decreases in exhaled CO. Decreases in the cessation and exclusive groups ranged from 88-89% and 27-32% in dual users. Exhaled NO increased in the cessation and exclusive groups (46-63% respectively), whereas the dual users experienced minimal changes. Overall, smokers who completely or partially substituted conventional cigarettes with e-cigarettes over five days, experienced reductions in HPHCs.

  7. Field evaluation of safety during gestation and horizontal spread of a recombinant differential bovine herpesvirus 1 (BoHV-1 vaccine Avaliação a campo da segurança para vacas prenhes e capacidade de disseminação horizontal de uma vacina diferencial recombinante contra o Herpes-vírus Bovino tipo 1 (BoHV-1

    Fernando R. Spilki

    2005-03-01

    Full Text Available Bovine herpesvirus type 1 (BoHV-1 is recognized as a major cause of respiratory, reproductive disease and abortion in cattle. Vaccination is widely applied to minimize losses induced by BoHV-1 infections; however, vaccination of dams during pregnancy with modified live virus (MLV vaccines has been occasionally associated to abortions. We have previously reported the development of a BoHV-1 recombinant virus, constructed with basis on a Brazilian BoHV-1 (Franco et al. 2002a from which the gene coding for glycoprotein E (gE was deleted (gE- by genetic manipulation. Such recombinant has been previously evaluated in its potential as a differential vaccine (gE- vaccine that allows differentiation between vaccinated and infected animals. Here, in the first part of the present study, the safety of the gE- vaccine during pregnancy was evaluated by the intramuscular inoculation of 10(7.4 tissue culture 50 % infective doses (TCID50 of the virus into 22 pregnant dams (14 BoHV-1 seronegative; 8 seropositive, at different stages of gestation. Other 15 pregnant dams were kept as non-vaccinated controls. No abortions, stillbirths or fetal abnormalities were seen after vaccination. Seroconversion was observed in both groups of previously seronegative vaccinated animals. In the second part of the study, the potential of the gE- vaccine virus to spread among beef cattle under field conditions was examined. Four heifers were inoculated intranasally with a larger amount (10(7,6 TCID50 of the gE- vaccine (to increase chances of transmission and mixed with other sixteen animals at the same age and body condition, in the same grazing area, at a population density equal to the average cattle farming density within the region (one cattle head per 10,000 m², for 180 days. All animals were monitored daily for clinical signs. Serum samples were collected on days 0, 30, 60 and 180 post-vaccination. Seroconversion was observed only in vaccinated heifers. These results

  8. Synthesis, crystal structure and Raman spectrum of Ba{sub 7}[BO{sub 3}]{sub 3}Br(O{sub 1.33}F{sub 1.33})

    Reckeweg, Olaf; DiSalvo, Francis J. [Cornell Univ., Ithaca, NY (United States). Dept. of Chemistry and Chemical Biology; Schulz, Armin [Max-Planck-Institut fuer Festkoerperforschung, Stuttgart (Germany)

    2017-05-01

    In addition to amorphous material and Ba{sub 7}[BO{sub 3}]{sub 4-x}F{sub 2-3x}, air and moisture sensitive single crystals of Ba{sub 7}[BO{sub 3}]{sub 3}Br(O{sub 1.33}F{sub 1.33}) were formed from H{sub 3}BO{sub 3}, Ba(OH){sub 2}, BaF{sub 2} and BaBr{sub 2} . H{sub 2}O in alumina crucibles open to the atmosphere at 1300 K for 13 h. Ba{sub 7}[BO{sub 3}]{sub 3}Br(O{sub 1.33}F{sub 1.33}) crystallizes in the hexagonal space group P6{sub 3}mc (no. 186, Z=2) with the lattice parameters a=1118.1(2) and c=723.93(13) pm. The Raman spectrum of the title compounds was also acquired and is compared to literature data.

  9. Synthesis and photoluminescence characteristics of (Y,Gd)BO3:RE (RE = Eu(3+), Ce(3+), Dy(3+) and Tb(3+)) phosphors for blue chip and near-UV white LEDs.

    Rangari, V V; Singh, V; Dhoble, S J

    2016-03-01

    A series of Eu(3+)-, Ce(3+)-, Dy(3+)- and Tb(3+)-doped (Y,Gd)BO3 phosphors was synthesized by a solid-state diffusion method. X-Ray diffraction confirmed their hexagonal structure and the scanning electron microscopy results showed crystalline particles. The excitation spectra revealed that (Y,Gd)BO3 phosphors doped with Eu(3+), Ce(3+), Dy(3+) and Tb(3+) are effectively excited with near UV-light of 395 nm/blue light, 364, 351 and 314 nm, respectively. Photoluminescence spectra of Eu(3+)-, Ce(3+)- and Tb(3+)/Dy(3+)-doped phosphor showed intense emission of reddish orange, blue and white light, respectively. The phosphor Y0.60Gd0.38BO3:Ce0.02 showed CIE 1931 color coordinates of (0.158, 0.031) and better color purity compared with commercially available blue BAM:Eu(2+) phosphor. The phosphor (Y,Gd)BO3 doped with Eu(3+), Dy(3+) and Tb(3+) showed CIE 1931 color coordinates of (0.667, 0.332), (0.251, 0.299) and (0.333, 0.391) respectively. Significant photoluminescence characteristics of the prepared phosphors indicate that they might serve as potential candidates for blue chip and near-UV white light-emitting diode applications. Copyright © 2015 John Wiley & Sons, Ltd.

  10. Color tunable emission in Ce3+ and Tb3+ co-doped Ba2Ln(BO3)2Cl (Ln=Gd and Y) phosphors for white light-emitting diodes.

    Zhang, Niumiao; Guo, Chongfeng; Jing, Heng; Jeong, Jung Hyun

    2013-12-01

    Ce(3+) and Tb(3+) co-doped Ba2Ln(BO3)2Cl (Ln=Y and Gd) green emitting phosphors were prepared by solid state reaction in reductive atmosphere. The emission and excitation spectra as well as luminescence decays were investigated, showing the occurrence of efficient energy transfer from Ce(3+) to Tb(3+) in this system. The phosphors exhibit both a blue emission from Ce(3+) and a green emission from Tb(3+) under near ultraviolet light excitation with 325-375 nm wavelength. Emission colors of phosphors could be tuned from deep blue through cyan to green by adjusting the Tb(3+) concentrations. The energy transfer efficiency and emission intensity of Ba2Y(BO3)2Cl:Ce(3+), Tb(3+) precede those of Ba2Gd(BO3)2Cl:Ce(3+), Tb(3+), and the sample Ba2Y(BO3)2Cl:0.03Ce(3+), 0.10Tb(3+) is the best candidate for n-UV LEDs. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. Feleucin-BO1: a novel antimicrobial non-apeptide amide from the skin secretion of the toad, Bombina orientalis, and design of a potent broad-spectrum synthetic analogue, feleucin-K3.

    Hou, Xiaojuan; Du, Qiang; Li, Renjie; Zhou, Mei; Wang, Hui; Wang, Lei; Guo, Can; Chen, Tianbao; Shaw, Chris

    2015-03-01

    Feleucins-BV1 and -BV2 are recently described prototypes of a novel antimicrobial non-apeptide (AMP) family identified in the skin secretion of the bombinid toad, Bombina variegata. They are encoded on different precursors that also encode a novel bombinin. Here we describe the identification of feleucin-BO1 (FLGLLGSLLamide) which is co-encoded with a different novel bombinin, named feleucin precursor-associated bombinin (FPA-bombinin-BO), from the skin secretion of Bombina orientalis. Synthetic feleucin-BO1 displayed activity against a reference Gram-positive bacterium. Staphylococcus aureus (MIC 34 μm) but was inactive (> 250 μm) against the Gram-negative bacterium, Escherichia coli, and the yeast, Candida albicans. This pattern of activity was similar to that of the prototypes. Design and synthesis of a cationicity-enhanced analogue, feleucin-K3 (F-K3), in which the amino acid residues at positions 3 (G), 6 (G) and 7 (S) of feleucin-BO1 were substituted with Lys (K) residues, resulted in a peptide with significantly enhanced potency and spectrum of activity. The MICs of F-K3 against the reference micro-organisms were 7 μm (S. aureus), 14 μm (E. coli) and 7 μm (C. albicans). These data indicate that the skin secretions of amphibians can continue to provide novel peptide templates for the rational design of analogues with possible therapeutic utility. © 2014 John Wiley & Sons A/S.

  12. Interdependence of Pes1, Bop1, and WDR12 controls nucleolar localization and assembly of the PeBoW complex required for maturation of the 60S ribosomal subunit.

    Rohrmoser, Michaela; Hölzel, Michael; Grimm, Thomas; Malamoussi, Anastassia; Harasim, Thomas; Orban, Mathias; Pfisterer, Iris; Gruber-Eber, Anita; Kremmer, Elisabeth; Eick, Dirk

    2007-05-01

    The PeBoW complex is essential for cell proliferation and maturation of the large ribosomal subunit in mammalian cells. Here we examined the role of PeBoW-specific proteins Pes1, Bop1, and WDR12 in complex assembly and stability, nucleolar transport, and pre-ribosome association. Recombinant expression of the three subunits is sufficient for complex formation. The stability of all three subunits strongly increases upon incorporation into the complex. Only overexpression of Bop1 inhibits cell proliferation and rRNA processing, and its negative effects could be rescued by coexpression of WDR12, but not Pes1. Elevated levels of Bop1 induce Bop1/WDR12 and Bop1/Pes1 subcomplexes. Knockdown of Bop1 abolishes the copurification of Pes1 with WDR12, demonstrating Bop1 as the integral component of the complex. Overexpressed Bop1 substitutes for endogenous Bop1 in PeBoW complex assembly, leading to the instability of endogenous Bop1. Finally, indirect immunofluorescence, cell fractionation, and sucrose gradient centrifugation experiments indicate that transport of Bop1 from the cytoplasm to the nucleolus is Pes1 dependent, while Pes1 can migrate to the nucleolus and bind to preribosomal particles independently of Bop1. We conclude that the assembly and integrity of the PeBoW complex are highly sensitive to changes in Bop1 protein levels.

  13. Bošácká keramika z Kolína. Doklad kontaktu postbadenských kultur v závěru středního eneolitu

    Dobeš, Miroslav; Šumberová, Radka; Kyselý, René

    2013-01-01

    Roč. 65, č. 2 (2013), s. 382-400 ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : Bohemia * Eneolithic * Bošáca culture * Řivnáč culture * pottery hoard * osteology Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Efficient continuous-wave and passively Q-switched pulse laser operations in a diffusion-bonded sapphire/Er:Yb:YAl3(BO3)4/sapphire composite crystal around 1.55 μm.

    Chen, Yujin; Lin, Yanfu; Huang, Jianhua; Gong, Xinghong; Luo, Zundu; Huang, Yidong

    2018-01-08

    A composite crystal consisting of a 1.5-mm-thick Er:Yb:YAl 3 (BO 3 ) 4 crystal between two 1.2-mm-thick sapphire crystals was fabricated by the thermal diffusion bonding technique. Compared with a lone Er:Yb:YAl 3 (BO 3 ) 4 crystal measured under the identical experimental conditions, higher laser performances were demonstrated in the sapphire/Er:Yb:YAl 3 (BO 3 ) 4 /sapphire composite crystal due to the reduction of the thermal effects. End-pumped by a 976 nm laser diode in a hemispherical cavity, a 1.55 μm continuous-wave laser with a maximum output power of 1.75 W and a slope efficiency of 36% was obtained in the composite crystal when the incident pump power was 6.54 W. Passively Q-switched by a Co 2+ :MgAl 2 O 4 crystal, a 1.52 μm pulse laser with energy of 10 μJ and repetition frequency of 105 kHz was also realized in the composite crystal. Pulse width was 315 ns. The results show that the sapphire/Er:Yb:YAl 3 (BO 3 ) 4 /sapphire composite crystal is an excellent active element for 1.55 μm laser.

  15. Towards the identification of alkaline phosphatase binding ligands in Li-Dan-Hua-Shi pills: A Box-Behnken design optimized affinity selection approach tandem with UHPLC-Q-TOF/MS analysis.

    Tao, Yi; Huang, Surun; Gu, Xianghui; Li, Weidong; Cai, Baochang

    2018-05-30

    Alkaline phosphatase conjugated magnetic microspheres were synthesized via amide reaction, and employed as an effective adsorbent in affinity selection of binding ligands followed by UHPLC-Q-TOF/MS analysis. The analytical validity of the developed approach was evaluated under optimized conditions and the following figures of merit were obtained: linearity, 0.01-0.5 g L -1 with good determination coefficients (R 2  = 0.9992); limits of detection (LODs), 0.003 g L -1 ; and limits of quantitation (LOQ), 0.01 g L -1 . The precision (RSD%) of the proposed affinity selection approach was studied based on intra-day (0.8%) and inter-day (1.3%) precisions. Finally, the adsorbent was successfully applied to identification of binding ligands in Li-Dan-Hua-Shi pills and good recoveries were obtained in the range from 96.9 to 99.4% (RSDs 1.6-3.0%). Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Tunable luminescence and energy transfer properties of KSr{sub 4}(BO{sub 3}){sub 3}:Dy{sup 3+}, Eu{sup 3+} phosphors for near-UV warm-white LEDs

    Leng, Zhihua; Li, Linlin; Liu, Yali; Zhang, Nannan; Gan, Shucai, E-mail: gansc@jlu.edu.cn

    2016-05-15

    Dy{sup 3+} and Eu{sup 3+} codoped KSr{sub 4}(BO{sub 3}){sub 3} phosphors were successfully synthesized by solid-state reaction process. Under near-ultraviolet (near-UV) excitation, individual Dy{sup 3+} or Eu{sup 3+} ion activated sample exhibits characteristic emissions in their respective regions. In KSr{sub 4}(BO{sub 3}){sub 3}:Dy{sup 3+}, xEu{sup 3+} phosphors, the energy transfer from Dy{sup 3+} to Eu{sup 3+} was revealed to be resonant type by dipole–dipole mechanism. And the critical distance R{sub Dy–Eu} was calculated to be 13.95 Å. The energy transfer efficiency of KSr{sub 4}(BO{sub 3}){sub 3}:Dy{sup 3+}, xEu{sup 3+} reached about 20% when the concentration of Eu{sup 3+} was 0.035. Moreover, the emitting colors of Dy{sup 3+} and Eu{sup 3+} codoped samples can be adjusted from the edge of white area to warm white via tuning the activator (Eu{sup 3+}) doped concentration. More significantly, the chromaticity coordinates (0.334, 0.351) of KSr{sub 4}(BO{sub 3}){sub 3}:0.005Dy{sup 3+}, 0.015Eu{sup 3+} sample are extremely adjacent to standard white light (0.33, 0.33). The quantum efficiency of the KSr{sub 4}(BO{sub 3}){sub 3}:0.005Dy{sup 3+}, 0.015Eu{sup 3+} phosphor with 389 nm excitation is found to be 42%, demonstrating that the obtained single-component white-emitting phosphor exhibits potential applications for solid state lighting.

  17. Comparison of the cytokine immune response to pathogenic Yersinia enterocolitica bioserotype 1B/O:8 and 2/O:9 in susceptible BALB/C and resistant C57BL/6 mice.

    Wang, Xin; Gu, Wenpeng; Qiu, Haiyan; Xia, Shengli; Zheng, Han; Xiao, Yuchun; Liang, Junrong; Jing, Huaiqi

    2013-10-01

    We investigated the lethality of pathogenic Yersinia enterocolitica bioserotypes 1B/O:8 and 2/O:9 in susceptible BALB/C and resistant C57BL/6 mice; the cytokine alterations and histopathological changes were observed comparing the two strains in BALB/C mice. The data showed the 50% lethal dose (LD50) for the pathogenic Y. enterocolitica bioserotype 1B/O:8 was 10³ cfu in both BALB/C and C57BL/6 mice; while the LD50 for the 2/O:9 was 10⁸ cfu in BALB/C mice and 10⁹ cfu in C57BL/6 mice, a large difference. After infection with the two strains in BALB/C mice, GM-CSF (granulocyte-macrophage colony stimulating factor), IFN-γ (interferon-γ), IL-1β (interleukin-1β), IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, and TNF-α (tumor necrosis factor-α) appeared as a cytokine storm in a short period, reached peak values, and then quickly decreased. This appeared important for the immune response and cytokine immunopathogenesis in pathogenic Y. enterocolitica infections. In the initial infection stage, GM-CSF, IL-6, and TNF-α of 2/O:9 were higher than 1B/O:8; and subsequently the status was reversed. However, levels of IFN-γ, IL-1β, IL-2, IL-4, IL-5, IL-10, IL-12 following infection with 1B/O:8 were always higher than with 2/O:9. The histopathological changes in the liver and spleen in BALB/C mice infected with the two strains were similar at different times and doses. These observations show the different immunological effects and changes for pathogenic Y. enterocolitica 1B/O:8 and 2/O:9 infections using the mouse model. Copyright © 2013 Elsevier Ltd. All rights reserved.

  18. Temporal variability of secondary processes in alkaline geothermal waters associated to granitic rocks: the Caldes de Boí geothermal system (Spain)

    Asta, M.; Gimeno, M.J.; Auqué, L.F.; Galve, J.P.; Gómez, J.; Acero, P.; Lapuente, P.

    2017-11-01

    The Caldes de Boí geothermal waters show important differences in pH (6.5–9.6) and temperature (15.9ºC–52ºC) despite they have a common origin and a very simple circuit at depth (4km below the recharge area level). Thes differences are the result of secondary processes such as conductive cooling, mixing with colder shallower waters, and input of external CO2, which affect each spring to a different extent in the terminal part of the thermal circuit. In this paper, the secondary processes that control the geochemical evolution of this system have been addressed using a geochemical dataset spanning over 20 years and combining different approaches: classical geochemical calculations and geochemical modelling. Mixing between a cold and a thermal end-member, cooling and CO2 exchange are the processes affecting the spring waters with different intensity over time. These differences in the intensity of the secondary processes could be controlled by the effect of climate and indirectly by the geomorphological and hydrogeological setting of the different springs. Infiltration recharging the shallow aquifer is dominant during the rainy seasons and the extent of the mixing process is greater, at least in some springs.Moreover, significant rainfall can produce a decrease in the ground temperature favouring the conductive cooling. Finally, the geomorphological settings of the springs determine the thickness and the hydraulic properties of the saturated layer below them and, therefore, they affect the extent of the mixing process between the deep thermal waters and the shallower cold waters. The understanding of the compositional changes in the thermal waters and the main factors that could affect them is a key issue to plan the future management of the geothermal resources of the Caldes de Boí system. Here, we propose to use a simple methodology to assess the effect of those factors, which could affect the quality of the thermal waters for balneotherapy at long

  19. Temporal variability of secondary processes in alkaline geothermal waters associated to granitic rocks: the Caldes de Boí geothermal system (Spain)

    Asta, M.; Gimeno, M.J.; Auqué, L.F.; Galve, J.P.; Gómez, J.; Acero, P.; Lapuente, P.

    2017-01-01

    The Caldes de Boí geothermal waters show important differences in pH (6.5–9.6) and temperature (15.9ºC–52ºC) despite they have a common origin and a very simple circuit at depth (4km below the recharge area level). Thes differences are the result of secondary processes such as conductive cooling, mixing with colder shallower waters, and input of external CO2, which affect each spring to a different extent in the terminal part of the thermal circuit. In this paper, the secondary processes that control the geochemical evolution of this system have been addressed using a geochemical dataset spanning over 20 years and combining different approaches: classical geochemical calculations and geochemical modelling. Mixing between a cold and a thermal end-member, cooling and CO2 exchange are the processes affecting the spring waters with different intensity over time. These differences in the intensity of the secondary processes could be controlled by the effect of climate and indirectly by the geomorphological and hydrogeological setting of the different springs. Infiltration recharging the shallow aquifer is dominant during the rainy seasons and the extent of the mixing process is greater, at least in some springs.Moreover, significant rainfall can produce a decrease in the ground temperature favouring the conductive cooling. Finally, the geomorphological settings of the springs determine the thickness and the hydraulic properties of the saturated layer below them and, therefore, they affect the extent of the mixing process between the deep thermal waters and the shallower cold waters. The understanding of the compositional changes in the thermal waters and the main factors that could affect them is a key issue to plan the future management of the geothermal resources of the Caldes de Boí system. Here, we propose to use a simple methodology to assess the effect of those factors, which could affect the quality of the thermal waters for balneotherapy at long

  20. Validation of an indirect ELISA to detect antibodies against BoHV-1 in bovine and guinea-pig serum samples using ISO/IEC 17025 standards.

    Parreño, Viviana; Romera, S Alejandra; Makek, Lucia; Rodriguez, Daniela; Malacari, Darío; Maidana, Silvina; Compaired, Diego; Combessies, Gustavo; Vena, María Marta; Garaicoechea, Lorena; Wigdorovitz, Andrés; Marangunich, Laura; Fernandez, Fernando

    2010-10-01

    Two ELISAs to quantify antibodies to BoHV-1 in the sera of cattle and immunized guinea pigs were developed and validated using ISO/IEC 17025 standards. The cut-off value of the assay was established at 20% positivity of a high positive control for screening of cattle. Using this threshold, the assay properly classified the OIE bovine reference sera EU1, EU2 and EU3. For vaccine potency testing, a cut-off of 40% was selected for both species. The reliability of the assays, given by their diagnostic sensitivity and specificity, using the threshold of 40% was 89.7% and 100%, respectively, for bovines and 94.9% and 100% for guinea pigs, respectively. There was almost perfect agreement between the ELISA and virus neutralization results. In addition, after vaccination, there was a good correlation between the neutralizing and ELISA antibody titers of the serum from the same bovine or guinea pig, sampled at 60 and 30 days post-vaccination, respectively (R(bovine)=0.88, R(guinea pig)=0.92; p<0.0001). A similar correlation was observed when analyzing the mean antibody titers of groups of vaccinated animals (R(bovine)=0.95 and R(guinea pig)=0.97; p<0.0001), indicating the relevance of the ELISAs for batch to batch vaccine potency testing in the target species and in the laboratory animal model. The intermediate precision of the assays expressed as the relative coefficient of variation (CV) of the positive control assayed over a 3-year period in the same laboratory was 22.2% for bovines and 23.1% for guinea pigs. The reproducibility of both techniques obtained in inter-laboratory assays was CV=12.4% for bovines and CV approximately 0 for guinea pigs, which met the requirements of the OIE (CV<30%). The validated ELISAs represent important methods for vaccine potency testing and for controlling BoHV-1 infections. Copyright (c) 2010 Elsevier B.V. All rights reserved.

  1. LOFAR-Boötes: properties of high- and low-excitation radio galaxies at 0.5 < z < 2.0

    Williams, W. L.; Calistro Rivera, G.; Best, P. N.; Hardcastle, M. J.; Röttgering, H. J. A.; Duncan, K. J.; de Gasperin, F.; Jarvis, M. J.; Miley, G. K.; Mahony, E. K.; Morabito, L. K.; Nisbet, D. M.; Prandoni, I.; Smith, D. J. B.; Tasse, C.; White, G. J.

    2018-04-01

    This paper presents a study of the redshift evolution of radio-loud active galactic nuclei (AGN) as a function of the properties of their galaxy hosts in the Boötes field. To achieve this we match low-frequency radio sources from deep 150-MHz LOFAR (LOw Frequency ARray) observations to an I-band-selected catalogue of galaxies, for which we have derived photometric redshifts, stellar masses, and rest-frame colours. We present spectral energy distribution (SED) fitting to determine the mid-infrared AGN contribution for the radio sources and use this information to classify them as high- versus low-excitation radio galaxies (HERGs and LERGs) or star-forming galaxies. Based on these classifications, we construct luminosity functions for the separate redshift ranges going out to z = 2. From the matched radio-optical catalogues, we select a sub-sample of 624 high power (P150 MHz > 1025 W Hz-1) radio sources between 0.5 ≤ z negative evolution of the LERG luminosity functions over this redshift range, is consistent with LERGs being fuelled by hot gas in quiescent galaxies.

  2. Growth and spectroscopic properties of Yb{sup 3+}-doped Li{sub 6}Y(BO{sub 3}){sub 3} single crystal

    Brenier, A. [Laboratoire de Physico-Chimie des Materiaux Luminescents, UMR CNRS no 5620, Universite Claude Bernard-Lyon1, 10 rue Ampere, 69622 Villeurbanne (France)]. E-mail: brenier@pcml.univ-lyon1.fr; Yoshikawa, A. [Institute of Multidisciplinary for Advanced Materials, Tohoku University, Sendai 980 8577 (Japan); Lebbou, K. [Laboratoire de Physico-Chimie des Materiaux Luminescents, UMR CNRS no 5620, Universite Claude Bernard-Lyon1, 10 rue Ampere, 69622 Villeurbanne (France); Jouini, A. [Laboratoire de Physico-Chimie des Materiaux Luminescents, UMR CNRS no 5620, Universite Claude Bernard-Lyon1, 10 rue Ampere, 69622 Villeurbanne (France); Institute of Multidisciplinary for Advanced Materials, Tohoku University, Sendai 980 8577 (Japan); Aloui-Lebbou, O. [Laboratoire de Physico-Chimie des Materiaux Luminescents, UMR CNRS no 5620, Universite Claude Bernard-Lyon1, 10 rue Ampere, 69622 Villeurbanne (France); Boulon, G. [Laboratoire de Physico-Chimie des Materiaux Luminescents, UMR CNRS no 5620, Universite Claude Bernard-Lyon1, 10 rue Ampere, 69622 Villeurbanne (France); Institute of Multidisciplinary for Advanced Materials, Tohoku University, Sendai 980 8577 (Japan); Fukuda, T. [Institute of Multidisciplinary for Advanced Materials, Tohoku University, Sendai 980 8577 (Japan)

    2007-10-15

    The spectroscopic properties of high-quality Czochralski grown 20% Yb{sup 3+}-doped Li{sub 6}Y(BO{sub 3}){sub 3} single crystal as new promising laser material are presented. The crystal was seeded-grown in the <0 1 0> direction and its crystallinity was measured using X-ray rocking curve analysis. Low temperature transmission spectrum exhibits broad bands in a short range of wavelengths and two sharp lines at 972.5 and 978 nm, interpreted as two zero-lines of two nonequivalent Yb{sup 3+} centers inside the lattice. The fluorescence lifetimes associated to these two intense lines are different: 0.867 and 1.33 ms. An attempt of determination of the Stark sublevels energies of the {sup 4}F{sub 5/2} and {sup 4}F{sub 7/2} manifolds of the two Yb{sup 3+} nonequivalent ions is given. The polarized absorption and emission spectra were also recorded at room temperature and we conclude that the most favorable emission line for laser application could be around 1042 nm in n {sub g} polarization.

  3. Optical and magnetic spectroscopy of rare-earth-doped yttrium aluminium borate (YAl sub 3 (BO sub 3) sub 4) single crystals

    Watterich, A; Borowiec, M T; Zayarnyuk, T; Szymczak, H; Beregi, E; Kovács, L G

    2003-01-01

    For Ce sup 3 sup + , Er sup 3 sup + and Yb sup 3 sup + ions, electron paramagnetic resonance (EPR) spectra typical for S' = 1/2 ions are measured for YAl sub 3 (BO sub 3) sub 4 (YAB) single crystal. The spectra show axial symmetry indicating that all three dopants replace Y sup 3 sup + at the given dopant concentration. Corresponding g-tilde - and hyperfine A-tilde -tensors are determined. The EPR linewidth of Ce broadens with increasing temperature due to an Orbach relaxation process. Fitting the curve with an exponential, the energy difference is found to be equal to 270 +- 16 cm sup - sup 1. The optical absorption and excitation spectra of Ce in YAB single crystal measured at 300 K are similar to those found for polycrystalline materials. High-resolution polarized emission from the lowest excited to the sup 2 F sub 5 sub / sub 2 ground state, measured at 4.2 K, indicates a splitting of the ground state into three levels. The second level is located 277 +- 18 cm sup - sup 1 above the first one, in excellent...

  4. Atmospheric metallic and arsenic pollution at an offshore drilling platform in the Bo Sea: A health risk assessment for the workers.

    Xu, Hong; Han, Suqin; Bi, Xiaohui; Zhao, Zhijing; Zhang, Lei; Yang, Wenjie; Zhang, Min; Chen, Jing; Wu, Jianhui; Zhang, Yufen; Feng, Yinchang

    2016-03-05

    To investigate the ambient metal pollution at the offshore drilling platform in the Bo Sea, which few studies have focused on, PM2.5 samples were collected and ten heavy metals, as well as As, were analyzed. High concentration levels of metals were observed, and the heavy metal pollution was quite serious compared to air quality standards and other marine areas. Back trajectories and wind dependent and PCA analyses showed that the marine sources included ship traffic emissions and corrosive stainless steels from the equipment at the platform as well as industrial emissions from stainless steel production and coal combustion sources, which were transported from the surrounding mainland. Both contributed greatly to the ambient metallic particles at the offshore platform. The Hazard Index values of the metals, which were much less than 1, the Carcinogenic Risk data, which were lower than the EPA's acceptable range, and the fact that the metal concentrations did not the exceed the permissible exposure limits of OSHA, indicated that the health risks from the ambient metallic particles for the oil-drilling workers were not significant. Copyright © 2015 Elsevier B.V. All rights reserved.

  5. Nicolas Lyon-Caen , La boîte à Perrette, le jansénisme parisien au xviiie siècle

    Vermander, Benoît

    2012-01-01

    Nicolas Lyon-­­­Caen publie ici sa thèse sou­­te­­nue en 2008 à l’uni­­ver­­sité Paris I (dir. Cl. Mi­­­chaud) sous le titre Mar­­chands de miracles. La bour­­geoi­­sie jan­­sé­­niste pari­­sienne au xviiie siècle, elle-­­­même pro­­lon­­ge­­ment d’une thèse de l’École des Chartes consa­­crée au finan­­ce­­ment du « parti » jan­­sé­­niste au xviiie siècle (La boîte à Perrette, 2002). Ce n’est donc pas une his­­toire de l’ensemble des jan­­sé­­nistes pari­­siens que l’on trou­­vera dans cet ou...

  6. Myšlení pozdního Wittgensteina a gramatika náboženského diskursu

    Jan Regner

    2014-10-01

    Full Text Available The aim of the present paper is to find a way of the theological method after Ludwig Wittgenstein’s remarks, especially in his Philosophical Investigations. As he maintains, language and human behaviour is connected, and so we cannot judge religious discourse without observing other nonverbal phenomena. We focused on works and authors who influenced Wittgenstein’s thoughts such as William James and James G. Frazer; and we briefly introduced to Wittgenstein’s argumentation against scientism. Hlavním cílem tohoto článku je najít podobu teologické metody, která by vzala v potaz pozdní myšlení Ludwiga Wittgensteina, zejména jeho Filosofická zkoumání. Rakouský autor je přesvědčen, že jazyk je úzce spojen s lidským jednáním, a proto není možné posuzovat náboženský diskurs, aniž bychom bedlivě pozorovali nonverbální projevy, které tento diskurs provázejí. Zaměřili jsme se na díla autorů, kteří ovlivnili Wittgensteinovo myšlení, jako byl William James nebo James G. Frazer, a představili jsme také Wittgensteinovu argumentaci proti scientismu.

  7. THE ORIGIN AND EVOLUTION OF THE HALO PN BoBn 1: FROM A VIEWPOINT OF CHEMICAL ABUNDANCES BASED ON MULTIWAVELENGTH SPECTRA

    Otsuka, Masaaki; Tajitsu, Akito; Hyung, Siek; Izumiura, Hideyuki

    2010-01-01

    We have performed a comprehensive chemical abundance analysis of the extremely metal-poor ([Ar/H] -6 M sun . The photoionization models built with non-LTE theoretical stellar atmospheres indicate that the progenitor was a 1-1.5 M sun star that would evolve into a white dwarf with an ∼0.62 M sun core mass and ∼0.09 M sun ionized nebula. We have measured a heliocentric radial velocity of +191.6 ±1.3 km s -1 and expansion velocity 2V exp of 40.5 ± 3.3 km s -1 from an average over 300 lines. The derived elemental abundances have been reviewed from the standpoint of theoretical nucleosynthesis models. It is likely that the elemental abundances except N could be explained either by a 1.5 M sun single star model or by a binary model composed of 0.75 M sun + 1.5 M sun stars. Careful examination implies that BoBn 1 has evolved from a 0.75 M sun + 1.5 M sun binary and experienced coalescence during the evolution to become a visible PN, similar to the other extremely metal-poor halo PN, K 648 in M 15.

  8. Effect of compositional variations on charge compensation of AlO4 and BO4 entities and on crystallization tendency of a rare-earth-rich aluminoborosilicate glass

    Quintas, A.; Caurant, D.; Majerus, O.; Charpentier, T.; Dussossoy, J.-L.

    2009-01-01

    This paper presents the structural and crystallization study of a rare-earth-rich aluminoborosilicate glass that is a simplified version of a new nuclear glass proven to be a potential candidate for the immobilization of highly concentrated radioactive wastes that will be produced in the future. In this work, we studied the impact of changing the nature of alkali (Li + , Na + , K + , Rb + , Cs + ) or alkaline-earth (Mg 2+ , Ca 2+ , Sr 2+ , Ba 2+ ) cations present in glass composition on glass structure (by 27 Al and 11 B nuclear magnetic resonance spectroscopy) and on its crystallization tendency during melt cooling at 1 K/min (average cooling rate during industrial process). From these composition changes, it was established that alkali cations were preferentially involved in charge compensation of (AlO 4 ) - and (BO 4 ) - entities in the glassy network comparatively to alkaline-earth cations. Whatever the nature of alkali cations, glass compositions containing calcium gave way to the crystallization of an apatite silicate phase bearing calcium and rare-earth (RE) cations (Ca 2 RE 8 (SiO 4 ) 6 O 2 , RE = Nd or La) but melt crystallization tendency during cooling strongly varied with the nature of alkaline-earth cations.

  9. Characterisation of Yersinia Secretion Apparatus--Pathogenicity Island (Ysa-PI) of Yersinia enterocolitica 1B/O8 in Poland: an Idle Ysa is a Specific Hallmark of the Epidemic Sensu Stricto Strain.

    Wołkowicz, Tomasz; Zacharczuk, Katarzyna; Rokosz-Chudziak, Natalia; Rastawicki, Waldemar; Gierczyński, Rafał

    2015-01-01

    Yersinia secretion apparatus (Ysa), the chromosomal type three secretion system (T3SS) is considered to contribute to virulence of high-pathogenicity Yersina enterocolitica biovar 1B. DNA-sequence of Ysa pathogenicity island was determined for clinical isolate DM0110 of Y enterocolitica 1B/08 with origin in Poland. We found a premature stop-codon in the regulatory gene ysrR (mutation at position 269). Altered ysrR was detected in all tested 78 isolates of Y enterocolitica 1B/O8 collected from clinical samples in Poland from 2004 to 2013. Since aberrations in YsrR are considered to inactivate Ysa, our findings may suggest Ysa is not indispensable for Y enterocolitica 1B/O8 to infect humans.

  10. Luminescent and laser properties of Yb Er:GdCa4O(BO3)3: a new crystal for eye-safe 1.5-μm lasers

    Denker, B.; Galagan, B.; Ivleva, L.; Osiko, V.; Sverchkov, S.; Voronina, I.; Hellstrom, J. E.; Karlsson, G.; Laurell, F.

    2004-09-01

    We present for the first time 1.5-μm laser emission in Yb Er:GdCa4O(BO3)3 (GdCOB). The crystals were grown by the Czochralski method from platinum crucibles. Spectroscopic and laser tests of the crystals are described. A continuous-wave output power of 80 mW was achieved in a monolithic microchip cavity under laser-diode pumping.

  11. Concentration quenching of Eu{sup 2+} in a thermal-stable yellow phosphor Ca{sub 2}BO{sub 3}Cl:Eu{sup 2+} for LED application

    Zhang Xinguo; Zhang Jilin; Dong Zhiyue; Shi Jianxin [State Key Laboratory of Optoelectronic Materials and Technologies, Ministry of Education Laboratory of Bioinorganic and Synthetic Chemistry, School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou 510275 (China); Gong Menglian, E-mail: cesgml@mail.sysu.edu.cn [State Key Laboratory of Optoelectronic Materials and Technologies, Ministry of Education Laboratory of Bioinorganic and Synthetic Chemistry, School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou 510275 (China)

    2012-04-15

    A piece-shaped phosphor Ca{sub 2}BO{sub 3}Cl: Eu{sup 2+} was synthesized by solid-state reaction method. This phosphor exhibited wide absorption in ultra-violet and visible range, and bright yellow emission band centering at 570 nm. The concentration quenching mechanism was verified to be a dipole-dipole interaction, and its critical transfer distance was about 17 A by both calculated crystal structural method and experimental spectral method. This phosphor has a good thermal stability with a quenching temperature (T{sub 1/2}) of 200 Degree-Sign C. Yellow and white LEDs were fabricated with this phosphor and near UV chips, and the yellow LED has a high color purity of 97.0% and promising current tolerant property, while the white LED shows a luminous efficiency of 11.68 lm/W. - Highlights: Black-Right-Pointing-Pointer Broadband excitable and strong yellow-emitting Ca{sub 2}BO{sub 3}Cl: Eu{sup 2+} phosphor is obtained by solid state reaction. Black-Right-Pointing-Pointer Concentration quenching mechanism of Ca{sub 2}BO{sub 3}Cl: Eu{sup 2+} is dipole-dipole interaction. Black-Right-Pointing-Pointer Quenching temperature (T{sub 1/2}) of Ca{sub 2}BO{sub 3}Cl: Eu{sup 2+} is at 200 Degree-Sign C. Black-Right-Pointing-Pointer As synthesized material can be used for LED phosphor application.

  12. Transformation from an easy-plane to an easy-axis antiferromagnetic structure in the mixed rare-earth ferroborates Pr x Y1-x Fe3(BO3)4: magnetic properties and crystal field calculations.

    Pankrats, A I; Demidov, A A; Ritter, C; Velikanov, D A; Semenov, S V; Tugarinov, V I; Temerov, V L; Gudim, I A

    2016-10-05

    The magnetic structure of the mixed rare-earth system Pr x Y1-x Fe3(BO3)4 (x  =  0.75, 0.67, 0.55, 0.45, 0.25) was studied via magnetic and resonance measurements. These data evidence the successive spin reorientation from the easy-axis antiferromagnetic structure formed in PrFe3(BO3)4 to the easy-plane one of YFe3(BO3)4 associated with the weakening of the magnetic anisotropy of the Pr subsystem due to its diamagnetic dilution by nonmagnetic Y. This reorientation occurs through the formation of an inclined magnetic structure, as was confirmed by our previous neutron research in the range of x  =  0.67 ÷ 0.45. In the compounds with x  =  0.75 and 0.67 whose magnetic structure is close to the easy-axis one, a two-step spin reorientation takes place in the magnetic field H||c. Such a peculiarity is explained by the formation of an interjacent inclined magnetic structure with magnetic moments of Fe ions located closer to the basal plane than in the initial state, with these intermediate states remaining stable in some ranges of the magnetic field. An approach based on a crystal field model for the Pr(3+) ion and the molecular-field approximation is used to describe the magnetic characteristics of the system Pr x Y1-x Fe3(BO3)4. With the parameters of the d-d and f-d exchange interactions, of the magnetic anisotropy of the iron subsystem and of the crystal field parameters of praseodymium thus determined, it is possible to achieve a good agreement between the experimental and calculated temperature and field dependences of the magnetization curves (up to 90 kOe) and magnetic susceptibilities (2-300 K).

  13. Effects of Tb{sup 3+} concentration on the La{sub 2}Sr{sub 3}(BO{sub 3}){sub 4}: X% Tb{sup 3+} polycrystalline nanophosphor

    Mlotswa, D.V. [Physics Department, University of the Free State, Private Bag x13, Phuthaditjhaba 9866 (South Africa); Madihlaba, R.M. [Chemistry Department, University of the Western Cape, Private Bag x17, Bellville 7535 (South Africa); Koao, L.F. [Physics Department, University of the Free State, Private Bag x13, Phuthaditjhaba 9866 (South Africa); Onani, M.O., E-mail: monani@uwc.ac.za [Chemistry Department, University of the Western Cape, Private Bag x17, Bellville 7535 (South Africa); Dejene, F.B. [Physics Department, University of the Free State, Private Bag x13, Phuthaditjhaba 9866 (South Africa)

    2016-01-01

    A new green phosphor, La{sub 2}Sr{sub 3}(BO{sub 3}){sub 4}): x% Tb{sup 3+} was fabricated by solution-combustion method using urea as a fuel and ammonium nitrate as an oxidizer. The phosphor was characterised using Fourier transform infrared spectroscopy (FTIR), Thermogravimetric analysis (TGA), Differential scanning calorimetry (DSC), Energy dispersive spectroscopy, X-ray diffraction (XRD), scanning electron microscopy (SEM) and photoluminescence spectroscopy (PL. The results exhibit that La{sub 2}Sr{sub 3}(BO{sub 3}){sub 4}): x% Tb{sup 3+} phosphor has the strongest excitation at 209 nm with a full-width at half-maximum (FWHM) of 20 nm, and can emit bright green light at 545 nm under 209 nm excitation. The optimum concentration for Tb{sup 3+} in La{sub 2}Sr{sub 3}(BO{sub 3}){sub 4}): x% Tb{sup 3+} is 0.033 mol%. The prominent green luminescence was due to the {sup 5}D{sub 4}–{sup 7}F{sub 5} transition of Tb{sup 3+} ion. Herein, the green phosphors are promising good candidates employed in tri-color lamps.

  14. An investigation on photoluminescence and energy transfer of Eu{sup 3+}/Sm{sup 3+} single-doped and co-doped Ca{sub 4}YO(BO{sub 3}){sub 3} phosphors

    Bandi, Vengala Rao; Grandhe, Bhaskar Kumar [Department of Physics, Changwon National University, Changwon 641-773 (Korea, Republic of); Jang, Kiwan, E-mail: kwjang@changwon.ac.kr [Department of Physics, Changwon National University, Changwon 641-773 (Korea, Republic of); Shin, Dong-Soo [Department of Chemistry, Changwon National University, Changwon (Korea, Republic of); Yi, Soung-Soo [Department of Photonics, Silla University, Busan (Korea, Republic of); Jeong, Jung-Hyun [Department of Physics, Pukyong National University, Busan (Korea, Republic of)

    2013-07-15

    The present investigation aims to demonstrate the potentiality of Eu{sup 3+}/Sm{sup 3+} single-doped and co-doped Ca{sub 4}YO(BO{sub 3}){sub 3} phosphors, which were prepared by a sol–gel method. The X-ray diffraction (XRD) profiles showed that all the observed peaks could be attributed to the monoclinic phase of Ca{sub 4}YO(BO{sub 3}){sub 3}. From the measured emission profiles, we have noticed that both the single-doped Eu{sup 3+}/Sm{sup 3+} phosphors shows four emission transitions of {sup 5}D{sub 0} → {sup 7}F{sub 0,1,2,3} and {sup 4}G{sub 5/2} → {sup 6}H{sub 5/2,7/2,9/2,11/2} respectively. Among them, the {sup 5}D{sub 0} → {sup 7}F{sub 2} of Eu{sup 3+} and {sup 4}G{sub 5/2} → {sup 6}H{sub 7/2} of Sm{sup 3+} are intense emission transitions, leading to an intense red color emission from the prepared phosphors. The excitation spectra showed that Eu{sup 3+}/Sm{sup 3+} doped samples can be excited efficiently by 394 nm and 402 nm respectively, incidentally which matches well with the characteristic emission from UVLED. The co-doping of Sm{sup 3+} ions can broaden and strengthen the absorption of near UV region and to be efficient to sensitize the emission of the Ca{sub 4}YO(BO{sub 3}){sub 3}:Eu{sup 3+} phosphor. The mechanism involved in the energy transfer between Eu{sup 3+} and Sm{sup 3+} has been explained and elucidated by an energy level diagram. - Highlights: • Eu{sup 3+} or/and Sm{sup 3+}:Ca{sub 4}YO(BO{sub 3}){sub 3} phosphors were prepared by sol–gel method. • The co-doping of Sm{sup 3+} to Ca{sub 4}YO(BO{sub 3}){sub 3}:Eu{sup 3+} extends its absorption of NUV region. • It has intense absorption in NUV region, which is suitable for NUV LED. • The energy transfer process between Eu{sup 3+} and Sm{sup 3+} ions were discussed.

  15. Implementación de un equipo de laboratorio para la planta piloto de lácteos campus Juan Lunardi, para el análisis de la leche en tres razas de vacas (Holstein, Jersey y Criollas) de la comuna indígena de Shiña-Nabón

    Ascaribay Andrade, Saúl Geovani

    2013-01-01

    El presente trabajo de grado trata sobre la implementación de un equipo de laboratorio para el análisis comparativo de la leche entre tres razas de vacas, (Holstein, Jersey y Criollas), este análisis se lo realizo en la Asociación de Productores Agropecuarios de la comuna indígena de Shiña perteneciente al cantón Nabón provincia del Azuay, los parámetros a ser analizados están basados dentro de las normas técnicas que dicta el INEN, las normas que fueron analizadas fueron: Leche Cruda Requisi...

  16. Electron paramagnetic resonance and optical properties of Cr{sup 3+} doped YAl{sub 3}(BO{sub 3}){sub 4}

    Wells, Jon-Paul R [Department of Physics and Astronomy, University of Sheffield, Sheffield (United Kingdom); Yamaga, Mitsuo [Department of Mathematical and Design Engineering, Gifu University, Gifu (Japan); Han, Thomas P J [Department of Physics, University of Strathclyde, Glasgow (United Kingdom); Honda, Makoto [Faculty of Science, Naruto University of Education, Naruto (Japan)

    2003-01-29

    We report on the electron paramagnetic resonance (EPR) and optical absorption and fluorescence spectroscopy of YAl{sub 3}(BO{sub 3}){sub 4} single crystals doped with 0.2 mol% of trivalent chromium. From EPR we determine that the Cr{sup 3+} ions reside in sites of essentially octahedral symmetry with an orthorhombic distortion. The ground state {sup 4}A{sub 2} splitting is determined to be 2{radical}D{sup 2} + 3E{sup 2} {approx} 1.05 {+-} 0.04 cm{sup -1}, where D and E are fine-structure parameters, and we can attribute this splitting to the combined effect of a low-symmetry distortion and spin-orbit coupling. The g-values and fine-structure parameters D and E of the ground state {sup 4}A{sub 2} are measured to be g{sub x} {approx} g{sub y} {approx} g{sub z} = 1.978 {+-} 0.005, vertical bar D vertical bar = 0.52 {+-} 0.02 cm{sup -1} and vertical bar E vertical bar 0.010 {+-} 0.005 cm{sup -1} respectively. From 10 K optical absorption we have measured the position and crystal-field splittings of the {sup 2}E, {sup 2}T{sub 1}, {sup 4}T{sub 2}, {sup 2}T{sub 2} and {sup 4}T{sub 1} states with the {sup 4}T{sub 2} and {sup 4}T{sub 1} levels appearing as vibronically broadened bands.

  17. National law of the nuclear activity of the Argentine Republic. (Sanctioned on April 2, 1997 and partially promulgated on April 23, 1997; B.O. 25-Apr-1997)

    1997-01-01

    The Argentine National State, will establish the nuclear policy and perform the functions of research, development, regulation and supervision through two organisations, the National Atomic Energy Commission (CNEA) and the Nuclear Regulatory Authority (ARN). The National Atomic Energy Commission will continue to function as an autonomous entity, depending from the Ministry of Culture and Education of the Nation. Among the activities under its responsibility it will have to advise the National Executive Power on nuclear policy issues, promote the training of highly-specialised human resources, scientific and technological developments, execute development programs, promote programs for technological innovation, perform the responsibility for radiation waste management, etc. The Nuclear Regulatory Authority will act as an aunotomous entity in the jurisdiction of the Presidency of the Nation and will be responsible for the functions of regulation and control of the nuclear activity in everything which is related to radiological and nuclear safety, physical protection and control of the use of nuclear materials, nuclear facilities, licensing and international safeguards and give advise to the National Executive Power. Both institutions will depend from a Board of Directors composed by six members, one of which will be the Chairman and they will be responsible for the actions to comply with the objectives and functions mentioned above. In its last chapter, the law declares as subject to the privatisation the activities of nuclear energy generation presently developed by Nucleoelectrica Argentina Sociedad Anonima (NASA), as well as the Nuyclear Fuel Cycle used for the nuclear energy generation for industry or research and the Production of Radioisotopes developed by CNEA. This law revokes the articles numbers 2, 5, 9, 11, 16 and 17 of the Decree-Law N' 22.498/56 (B.O. 28-Dec-1956)

  18. The SHiP facility at CERN

    AUTHOR|(SzGeCERN)452451

    2016-01-01

    Searches for new physics with accelerators are being performed at the LHC, looking for high massive particles coupled to matter with ordinary strength. A new experimental facility meant to search for very weakly coupled particles in the few GeV mass domain has been recently proposed. The existence of such particles, foreseen in dierent theoretical models beyond the Standard Model, is largely unexplored from the experimental point of view. A beam dump facility, built at CERN in the north area, using 400 GeV protons is a copious factory of charmed hadrons and could be used to probe the existence of such particles. The beam dump is also an ideal source of tau neutrinos, the less known particle in the Standard Model. In particular, tau anti-neutrinos have not been directly observed so far. We report the physics potential of such an experiment and outline the performances of a detector operating at the same facility for the search for the tau --> mu mu mu decay

  19. Coaxing shy particles into an atomic jar

    Hellemans, A

    2000-01-01

    A Dutch-American team claim they can produce anti-hydrogen atoms in far greater quantities than any other current method. They use rubidium ions to trap electrons by applying a pulsed electric field in a series of steps (1 page).

  20. Do talented women shy away from competition?

    Hoyer, Britta; van Huizen, T.M.; Keijzer, L.M.; Rezaei Khavas, T.; Rosenkranz, S.; Westbrock, B.

    2016-01-01

    We study the willingness to compete in a cognitive task among an entire cohort of fresh man business and economics students. Combining data from a lab-in-thefield experiment with university admissions data, we trace the gender gap in competitiveness at different levels of high school performance.